SELF-REPLICATING DNA EXPRESSION SYSTEM AND IMMUNOGEN
20240344100 ยท 2024-10-17
Inventors
- Edward Peter Rybicki (Rondebosch, ZA)
- Guy Louis Regnard (Rondebosch, ZA)
- Warren Ralph Josephus De Moor (Rondebosch, ZA)
Cpc classification
C12N2750/10052
CHEMISTRY; METALLURGY
C12N2750/10043
CHEMISTRY; METALLURGY
International classification
Abstract
The present invention relates to self-replicating DNA expression vectors comprising elements from Beak and Feather Disease Virus (BFDV), including a BFDV LIR element comprising an origin of replication (Ori), genes encoding a BFDV Rep protein and a heterologous polypeptide of interest under the control of a mammalian promoter, wherein the Rep protein is capable of binding to the Ori to initiate replication of the expression vector. Pharmaceutical compositions and cells comprising the self-replicating vectors are also provided. The self-replicating vectors may be used in methods of inducing an immune response or expressing a polypeptide in a subject, or as an expression system.
Claims
1. A self-replicating DNA expression vector comprising: a) at least one BFDV LIR element comprising an origin of replication (Ori); b) a gene encoding a BFDV replication-associated protein (Rep); c) a gene encoding a heterologous polypeptide of interest; and d) a mammalian promoter operably linked to (b) and (c), wherein the Rep protein is capable of binding to the Ori to initiate replication of the expression vector.
2. The self-replicating DNA expression vector of claim 1, further comprising a vector backbone.
3. The self-replicating DNA expression vector of claim 1, further comprising a second BFDV LIR element.
4. The self-replicating DNA expression vector of claim 1, wherein (a) and (b) are in a forward orientation on the vector.
5. The self-replicating DNA expression vector of claim 1, wherein (c) and (d) are in reverse orientation on the vector.
6. The self-replicating DNA expression vector of claim 1, wherein the mammalian promoter is a simian vacuolating virus 40 promoter (SV40).
7. The self-replicating DNA expression vector of claim 1, wherein the vector has a truncated or absent BFDV capsid protein gene.
8. The self-replicating DNA expression vector of claim 1, further comprising one or more restriction enzyme recognition sites.
9. The self-replicating DNA expression vector of claim 1, further comprising a partial Kozak sequence, optionally having a nucleic acid sequence of SEQ ID NO:5.
10. The self-replicating DNA expression vector of claim 1, wherein the vector is capable of replicating to high copy number and remaining as an episome.
11. A pharmaceutical composition comprising the self-replicating DNA expression vector of claim 1 and a pharmaceutically acceptable diluent or excipient.
12. The pharmaceutical composition of claim 11, wherein the pharmaceutical composition is capable of eliciting a protective immune response in a subject against a disease.
13. The pharmaceutical composition of claim 11, which is formulated for intramuscular, intradermal, intravenous or subcutaneous administration.
14. A cell comprising the self-replicating DNA expression vector of claim 1.
15.-18. (canceled)
19. A method of inducing an immune response in a subject comprising administering the self-replicating DNA expression vector of claim 1 to the subject.
20. The method of claim 19, wherein the immune response is a neutralizing antibody response or a cytotoxic T lymphocyte response.
21. A method of expressing a polypeptide in a subject comprising administering the self-replicating DNA expression vector of claim 1 to the subject.
22. The method of claim 19, wherein the subject is a human.
23. An in vitro or ex vivo method of expressing a polypeptide in a cell comprising transfecting the cell with the self-replicating DNA expression vector of claim 1.
24. The method of claim 23, further comprising recovering the polypeptide from the cell.
25. The method of claim 21, wherein the subject is a human.
Description
BRIEF DESCRIPTION OF THE FIGURES
[0031] Non-limiting embodiments of the invention will now be described by way of example only and with reference to the following figures:
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
SEQUENCE LISTING
[0044] The nucleic acid sequences listed in the accompanying sequence listing are shown using standard letter abbreviations for nucleotide bases, and the standard three letter abbreviations for amino acids. It will be understood by those of skill in the art that only one strand of each nucleic acid sequence is shown, but that the complementary strand is included by any reference to the displayed strand. In the accompanying sequence listing: [0045] SEQ ID NO:1nucleotide sequence of BFDV LIR element (Ori). [0046] SEQ ID NO:2nucleotide sequence of rep gene. [0047] SEQ ID NO:3amino acid sequence of Rep protein. [0048] SEQ ID NO:4nucleotide sequence of SV40 promoter. [0049] SEQ ID NO:5nucleotide sequence of partial Kozak sequence. [0050] SEQ ID NO:6nucleotide sequence of BFDV rep sense primer. [0051] SEQ ID NO:7nucleotide sequence of BFDV rep antisense primer. [0052] SEQ ID NO:8nucleotide sequence of egfp sense primer. [0053] SEQ ID NO:9nucleotide sequence of egfp antisense primer [0054] SEQ ID NO:10nucleotide sequence of BFDV LIR element (Ori) binding motif.
DETAILED DESCRIPTION OF THE INVENTION
[0055] The present invention will now be described more fully hereinafter with reference to the accompanying drawings, in which some, but not all embodiments of the invention are shown.
[0056] The invention as described should not be limited to the specific embodiments disclosed and modifications and other embodiments are intended to be included within the scope of the invention. Although specific terms are employed herein, they are used in a generic and descriptive sense only and not for purposes of limitation.
[0057] As used throughout this specification and in the claims which follow, the singular forms a, an and the include the plural form, unless the context clearly indicates otherwise.
[0058] The terminology and phraseology used herein is for the purpose of description and should not be regarded as limiting. The use of the terms comprising, containing, having and including and variations thereof used herein, are meant to encompass the items listed thereafter and equivalents thereof as well as additional items. It is, however, contemplated as a specific embodiment of the present disclosure that the term comprising encompasses the possibility of no further members being present, i.e., in some embodiments comprising is to be understood as having the meaning of consisting of.
[0059] The present invention, in its broadest sense, relates to chimeric Beak and Feather disease virus (BFDV) derived DNA expression vectors capable of undergoing self-replication. The inventors have shown that the self-replicating vectors described herein are capable of self-regulating in terms of both gene expression and DNA amplification levels.
[0060] The inventors have constructed self-replicating DNA expression vectors, which have the potential to mitigate many of the issues faced by DNA vaccines and gene expression systems, such as loss from biological degradation and/or inactivation from methylation or gene silencing mechanisms and innate cellular responses. These vectors employ a viral rolling circle replication (RCR) cycle within host mammalian cells that amplifies the DNA vector or a select fragment of DNA containing key genetic elements used by the system and a gene of interest (GOI). This has resulted in the development of a dynamic gene expression system that increases both gene of interest expression levels and gene copy number. Replicating DNA vaccines offer several advantages over conventional DNA vaccines. These include amplifying recombinant gene expression by increasing gene copy number, extending the half-life of DNA activity and presence within cells and sustaining antigen expression over time, thereby increasing total overall antigen exposure to the immune system. The vectors of the present invention result in rapid DNA amplification and increased antigen expression, in a manner that resembles acute viral infection at the subcellular level. Thus, the vectors of the present invention have potential to enhance the activation of innate antiviral immune responses due to these unique characteristics. Furthermore, the accumulation of amplicon DNA, which transitions through various DNA states during RCR, should stimulate DNA damage recognition receptors to generate a strong DNA damage-associated molecular pattern (DAMP) response. DAMP signalling combined with pathogen recognition receptor (PRR) stimulation has been reported to strengthen pathogen-associated molecular patterns (PAMPs) and enhance activation of innate antiviral immune responses.
[0061] In terms of safety, the absence of the BFDV capsid protein in these replicating DNA vectors effectively confines replication specifically to DNA only and this may only occur within the cells that initially took up the DNA vector. As the RCR episomes lack the ability to relocate outside of the nucleus or to the extracellular environment and lack any protection from DNA degradation which occurs outside the nucleus, the RCR episomes are considered extremely safe and are expected to be destroyed entirely upon host cell death, which is all but guaranteed, by the destructive pathogenic nature the viral RCR cycle within a host cell that was observed in cell culture, as found by the inventors. The increasingly destructive nature of the RCR episomes, which promotes cell death, substantially differentiates RCR expression systems from non-replicating DNA vectors where the possibility of oncogenic genome integration, albeit unlikely, has been a concern.
[0062] The self-replicating vectors of the present invention have been optimised to function in a more viral like manner for immunological inducing applications such as cancer vaccines and pathogenic vaccines, or the production of difficult to express or toxic proteins in cell culture. In particular, the inventors have surprisingly found that some BFDV-derived replicating vectors include genes or express products that acted as a negative feedback mechanism on protein expression. The inventors of the present invention have constructed vectors that overcome these negative feedback mechanisms in order to replicate to high copy number and ensure high levels of expression of a polypeptide of interest.
[0063] In one embodiment the self-replicating vector of the present invention includes a BFDV large intergenic region (LIR) element comprising an origin of replication (ori); followed immediately by the BFDV rep gene in a forward orientation; a gene of interest to be expressed; a powerful mammalian promoter element in reverse orientation to Rep, with a restriction site that incorporates a partial Kozak sequence to maximise gene of interest expression levels and facilitate easy addition of a gene of interest; a second LIR element in the same orientation as the first LIR element and the rep gene to allow for the removal of the plasmid backbone for maximal amplification production and stability and minimal size (
[0064] The self-replicating DNA vector of the present invention may be used in several different ways. In one embodiment, the DNA vector may be used as an immunogenic vaccine, for example against pathogenic diseases and cancers. The self-replicating nature of self-replicating DNA vector enables the amplification of gene expression and mitigates against genetic silencing and normal biological losses that have hindered the successful use of non-replicating DNA expression systems as gene therapies or vaccines. As a cancer vaccine the self-replicating nature may also activate innate cellular immunological and antiviral defence mechanisms that are key in eliciting immunological responses to cancerous cell lines. Only self-replicating DNA can achieve this type of cellular effect, which non-replicating DNA vaccines cannot. Self-replication enables localised increases in expression levels of a gene of interest at the individual cellular level which cannot be achieved by non-replicating DNA expression systems. Enabling excessive antigen or gene of interest expression at the cellular level is critical in overwhelming the host cell and triggering a powerful innate cellular immune response. Using the viral-like nature of the self-replicating DNA vector of the present invention may generate strong T-cell and antibody responses. Thus, the self-replicating DNA vector may be suitable as a rapidly deployable, cheap to manufacture and scalable vaccine in response to future pandemics or as a targeted cancer vaccine for inducing innate immune responses in cancerous cells that have otherwise evaded eliciting an immune response.
[0065] In a further embodiment of the invention, the self-replicating DNA vector is suitable as an enhanced gene expression system for the manufacture of proteins or peptides of interest in mammalian cell culture. The inventors have demonstrated that the self-replicating DNA can hinder cellular apoptosis that plagues protein production attempts, particularly when the target protein is slightly toxic to the cell or when the target protein becomes toxic at high concentration levels. The self-replicating DNA vector's ability to both amplify cellular expression levels, while simultaneously suppressing cellular apoptosis, make it suitable for complex and advanced protein expression and manufacturing applications by potentially significantly improving production yields.
[0066] A protein, peptide or polypeptide is any chain of two or more amino acids, including naturally occurring or non-naturally occurring amino acids or amino acid analogues, irrespective of post-translational modification (e.g., glycosylation or phosphorylation).
[0067] The terms nucleic acid or nucleic acid molecule and polynucleotide are used herein interchangeably and encompass both ribonucelotides (RNA) and deoxyribonucleotides (DNA), including cDNA, genomic DNA, and synthetic DNA. The nucleic acid may be double-stranded or single-stranded. Where the nucleic acid is single-stranded, the nucleic acid may be the sense strand or the antisense strand. A nucleic acid molecule may be any chain of two or more covalently bonded nucleotides, including naturally occurring or non-naturally occurring nucleotides, or nucleotide analogs or derivatives. By RNA is meant a sequence of two or more covalently bonded, naturally occurring or modified ribonucleotides. The term DNA refers to a sequence of two or more covalently bonded, naturally occurring or modified deoxyribonucleotides.
[0068] The term heterologous polypeptide of interest or polypeptide of interest as used herein refers to any polypeptide that does not occur naturally in a Beak and Feather Disease Virus (BFDV). A heterologous polypeptide of interest may thus include protozoal, bacterial, viral, fungal or animal proteins. The heterologous polypeptide of interest is intended for expression in a mammalian cell according to a non-limiting embodiment of the present invention. Preferably, the mammalian cell is a non-native mammalian cell i.e., mammalian host cells other than cells from psittacines (parrots). Non-limiting examples of heterologous polypeptides of interest may include, pharmacological polypeptides (e.g., for medical uses, for cell- and tissue culture) or industrial polypeptides (e.g. enzymes, growth factors) that can be produced using the self-replicating DNA vectors of the present invention. The self-replicating DNA vectors including a gene encoding a heterologous polypeptide of interest, such as an antigen, may be useful as vaccines. Alternatively, the self-replicating DNA vectors may be used to produce heterologous polypeptides of interest in an expression system, which may be recovered and used in a vaccine, or in other reagents or diagnostics.
[0069] As used herein the terms host mammalian cell, mammalian host cell and mammalian cell refer to a cell of a mammal. In one embodiment the mammalian cell may be a human cell. In an alternative embodiment the mammalian cell may be an animal cell. Preferably, the animal cell is not from the native host for BFDV, in particular psittacines (parrots).
[0070] The terms heterologous gene of interest or gene of interest as used herein refers to a nucleic acid that encodes a heterologous polypeptide of interest as defined herein. Such gene of interest may be codon-optimised for expression in a mammalian cell.
[0071] The term complementary refers to two nucleic acids molecules, e.g., DNA or RNA, which are capable of forming Watson-Crick base pairs to produce a region of double-strandedness between the two nucleic acid molecules. It will be appreciated by those of skill in the art that each nucleotide in a nucleic acid molecule need not form a matched Watson-Crick base pair with a nucleotide in an opposing complementary strand to form a duplex. One nucleic acid molecule is thus complementary to a second nucleic acid molecule if it hybridizes, under conditions of high stringency, with the second nucleic acid molecule. A nucleic acid molecule according to the invention includes both complementary molecules.
[0072] As used herein a substantially identical sequence is an amino acid or nucleotide sequence that differs from a reference sequence only by one or more conservative substitutions, or by one or more non-conservative substitutions, deletions, or insertions located at positions of the sequence that do not destroy or substantially reduce the antigenicity of one or more of the expressed polypeptides or of the polypeptides encoded by the nucleic acid molecules. Alignment for purposes of determining percent sequence identity can be achieved in various ways that are within the knowledge of those with skill in the art. These include using, for instance, computer software such as ALIGN, Megalign (DNASTAR), CLUSTALW or BLAST software.
[0073] Those skilled in the art can readily determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared. In one embodiment of the invention there is provided for a polypeptide or polynucleotide sequence that has at least about 80% sequence identity, at least about 90% sequence identity, or even greater sequence identity, such as about 95%, about 96%, about 97%, about 98% or about 99% sequence identity to the sequences described herein.
[0074] Alternatively, or additionally, two nucleic acid sequences may be substantially identical if they hybridize under high stringency conditions. The stringency of a hybridisation reaction is readily determinable by one of ordinary skill in the art, and generally is an empirical calculation which depends upon probe length, washing temperature, and salt concentration. In general, longer probes required higher temperatures for proper annealing, while shorter probes require lower temperatures. Hybridisation generally depends on the ability of denatured DNA to re-anneal when complementary strands are present in an environment below their melting temperature. A typical example of such stringent hybridisation conditions would be hybridisation carried out for 18 hours at 65? C. with gentle shaking, a first wash for 12 min at 65? C. in Wash Buffer A (0.5% SDS; 2?SSC), and a second wash for 10 min at 65? C. in Wash Buffer B (0.1% SDS; 0.5% SSC).
[0075] Those skilled in the art will appreciate that polypeptides, peptides or peptide analogues can be synthesised using standard chemical techniques, for instance, by automated synthesis using solution or solid phase synthesis methodology. Automated peptide synthesisers are commercially available and use techniques known in the art. Polypeptides, peptides and peptide analogues can also be prepared from their corresponding nucleic acid molecules using recombinant DNA technology.
[0076] In some embodiments, the nucleic acid molecules of the invention may be operably linked to other sequences. By operably linked is meant that the nucleic acid molecules encoding the Rep protein and/or heterologous polypeptides of interest are connected to regulatory sequences in such a way as to permit expression of the proteins when the appropriate molecules are bound to the regulatory sequences. Such operably linked sequences may be contained in vectors or expression constructs which can be transfected into host cells or delivered to a subject for expression.
[0077] The term recombinant means that something has been recombined. When used with reference to a nucleic acid construct the term refers to a molecule that comprises nucleic acid sequences that are joined together or produced by means of molecular biological techniques. The term recombinant when used in reference to a protein or a polypeptide refers to a protein or polypeptide molecule which is expressed from a recombinant nucleic acid construct created by means of molecular biological techniques. Recombinant nucleic acid constructs may include a nucleotide sequence which is ligated to, or is manipulated to become ligated to, a nucleic acid sequence to which it is not ligated in nature, or to which it is ligated at a different location in nature. Accordingly, a recombinant nucleic acid construct indicates that the nucleic acid molecule has been manipulated using genetic engineering, i.e. by human intervention. Recombinant nucleic acid constructs may be introduced into a host cell by transformation or delivered to a subject using delivery mechanisms known in the art. Such recombinant nucleic acid constructs may include sequences derived from the same host cell species or from different host cell species.
[0078] The term vector refers to a means by which polynucleotides or gene sequences can be introduced into a cell. In particular, the vector of the present invention is derived from BFDV and is a self-replicating DNA vector.
[0079] In some embodiments, the self-replicating DNA vector of the invention may include, without limitation, at least one BFDV LIR element (SEQ ID NO:1) which comprises an origin of replication (Ori) to which Rep protein is capable of binding to initiate replication, a rep gene (SEQ ID NO:2) encoding Rep protein (SEQ ID NO:3), a mammalian promoter, such as a SV40 promoter (SEQ ID NO:4), or sequences substantially identical thereto. The sequence of the gene encoding the Rep protein may be codon-optimised for expression in a mammalian cell. The vector may further include one or more restriction sites to facilitate the addition of a gene encoding a polypeptide of interest. In a further embodiment, at least one restriction site includes a partial Kozak sequence of SEQ ID NO:5 to maximise expression levels as described herein.
[0080] Generally, polynucleotides or gene sequences are introduced into a vector by means of a cassette. The term cassette refers to a polynucleotide or gene sequence that is expressed from a vector, for example, the polynucleotide or gene sequences encoding the Rep protein and/or heterologous polypeptides of interest. A cassette generally comprises a gene sequence inserted into a vector, which in some embodiments, provides regulatory sequences for expressing the polynucleotide or gene sequences. In other embodiments, the vector provides the regulatory sequences for the expression of the Rep protein and/or heterologous polypeptides of interest. In further embodiments, the vector provides some regulatory sequences and the nucleotide or gene sequence provides other regulatory sequences. Regulatory sequences include but are not limited to promoters, transcription termination sequences, enhancers, splice acceptors, donor sequences, introns, ribosome binding sequences, poly(A) addition sequences, and/or origins of replication.
[0081] The term promoter refers to a DNA sequence that is capable of controlling the expression of a nucleic acid coding sequence or functional RNA. A promoter may be based entirely on a native gene or it may be comprised of different elements from different promoters found in nature. Different promoters are capable of directing the expression of a gene in different cell types, or at different stages of development, or in response to different environmental or physiological conditions. A constitutive promoter is a promoter that direct the expression of a gene of interest in most host cell types most of the time.
[0082] As used herein a pharmaceutically acceptable carrier or excipient includes any and all antibacterial and antifungal agents, coatings, dispersion media, solvents, isotonic and absorption delaying agents, and the like that are physiologically compatible. A pharmaceutically acceptable carrier may include a solid or liquid filler, diluent or encapsulating substance which may be safely used for the administration of the self-replicating DNA vectors and/or vaccine compositions of the invention to a subject. The pharmaceutically acceptable carrier can be suitable for intramuscular, intraperitoneal, intravenous, subcutaneous, oral or sublingual administration. Pharmaceutically acceptable carriers further include sterile aqueous solutions, dispersions and sterile powders for the preparation of sterile solutions. The use of media and agents for the preparation of pharmaceutically active substances is well known in the art. Where any conventional media or agent is incompatible with the active compound, use thereof in the pharmaceutical compositions of the invention is not contemplated. Supplementary active compounds can also be incorporated into the compositions.
[0083] Suitable formulations or compositions to administer the self-replicating DNA vectors and/or vaccine compositions to subjects who are to be prophylactically treated for an infection or disease, who are suffering from an infection or disease or subjects which are presymptomatic for a condition associated with infection and/or disease fall within the scope of the invention. Any appropriate route of administration may be employed, such as, parenteral, intravenous, subcutaneous, intramuscular, intracranial, intraorbital, ophthalmic, intraventricular, intracapsular, intraspinal, intrathecal, intracistemal, intraperitoneal, intranasal, aerosol, topical, or oral administration.
[0084] As used herein the term subject includes mammals. In one embodiment the subject may be a human. In an alternative embodiment the subject may be an animal, including livestock. In some embodiments, the term subject may exclude reference to the native host for BFDV, in particular psittacines (parrots).
[0085] For vaccine formulations and pharmaceutical compositions, an effective amount of the self-replicating DNA vectors and/or vaccine compositions of the invention can be provided, either alone or in combination with other compounds, with immunological adjuvants, for example, aluminium hydroxide dimethyldioctadecylammonium hydroxide or Freund's incomplete adjuvant. The self-replicating DNA vectors and/or vaccine compositions of the invention may also be linked with suitable carriers and/or other molecules, such as bovine serum albumin or keyhole limpet hemocyanin in order to enhance immunogenicity. The self-replicating DNA vectors and/or vaccine compositions of the present invention can be provided either alone or in combination with other compounds in a composition (for example, nucleic acid molecules, small molecules, peptides, or peptide analogues), in the presence of a liposome, an adjuvant, or any carrier, such as a pharmaceutically acceptable carrier and in a form suitable for administration to mammals, for example, humans, or other animals, including cattle, sheep, etc.
[0086] In some embodiments, the self-replicating DNA vectors and/or vaccine compositions produced according to the method of the invention may be provided in a kit, optionally with a carrier and/or an adjuvant, together with instructions for use.
[0087] An effective amount of a self-replicating DNA vectors and/or vaccine compositions according to the invention includes a therapeutically effective amount, immunologically effective amount, or a prophylactically effective amount. A therapeutically effective amount refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic result, such as treatment of a disease or infection, including a viral infection, or a condition associated with such disease or infection. The outcome of the treatment may for example be measured by a decrease in viremia, inhibition of viral gene expression, delay in development of a pathology associated with the infection or disease, stimulation of the immune system, or any other method of determining a therapeutic benefit. A therapeutically effective amount of a compound may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the compound to elicit a desired response in the individual. Dosage regimens may be adjusted to provide the optimum therapeutic response. A therapeutically effective amount is also one in which any toxic or detrimental effects of the compound are outweighed by the therapeutically beneficial effects.
[0088] The dosage of any of the self-replicating DNA vectors and/or vaccine compositions of the present invention will vary depending on the symptoms, age and body weight of the subject, the nature and severity of the disorder to be treated or prevented, the route of administration, the disease and/or infection being treated and the form of the composition. Any of the compositions of the invention may be administered in a single dose or in multiple doses. The dosages of the self-replicating DNA vectors and/or vaccine compositions of the invention may be readily determined by techniques known to those of skill in the art or as taught herein.
[0089] By immunogenically effective amount is meant an amount effective, at dosages and for periods of time necessary, to achieve a desired immune response. The desired immune response may include stimulation or elicitation of an immune response, for instance a T or B cell response.
[0090] A prophylactically effective amount refers to an amount effective, at dosages and for periods of time necessary, to achieve a desired prophylactic result, such as prevention of onset of a condition associated with a disease and/or infection. Typically, a prophylactic dose is used in subjects prior to or at an earlier stage of disease and/or infection, so that a prophylactically effective amount may be less than a therapeutically effective amount.
[0091] Dosage values may vary with the severity of the condition to be alleviated. For any particular subject, specific dosage regimens may be adjusted over time according to the individual need and the judgment of the person administering or supervising the administration of the self-replicating DNA vectors and/or vaccine compositions of the invention. Dosage ranges set forth herein are exemplary only and do not limit the dosage ranges that may be selected. It may be advantageous to formulate the compositions in dosage unit forms for ease of administration and uniformity of dosage.
[0092] The term preventing, when used in relation to an infectious disease, or other medical disease or condition, is well understood in the art, and includes administration of a composition which reduces the frequency of or delays the onset of symptoms of a condition in a subject relative to a subject which does not receive the composition. Prevention of a disease includes, for example, reducing the number of diagnoses of the infection in a treated population versus an untreated control population, and/or delaying the onset of symptoms of the infection in a treated population versus an untreated control population.
[0093] The term prophylactic or therapeutic treatment is well known to those of skill in the art and includes administration to a subject of one or more of the compositions of the invention. If the composition is administered prior to clinical manifestation of the unwanted condition (e.g., disease or other unwanted state of the subject) then the treatment is prophylactic, i.e., it protects the host against developing the unwanted condition, whereas if it is administered after manifestation of the unwanted condition, the treatment is therapeutic (i.e., it is intended to diminish, ameliorate, or stabilize the existing unwanted condition or side effects thereof).
[0094] Toxicity and therapeutic efficacy of compositions of the invention may be determined by standard pharmaceutical procedures in cell culture or using experimental animals, such as by determining the LD.sub.50 and the ED.sub.50. Data obtained from the cell cultures and/or animal studies may be used to formulating a dosage range for use in a subject. The dosage of any composition of the invention lies preferably within a range of circulating concentrations that include the ED.sub.50 but which has little or no toxicity. The dosage may vary within this range depending upon the dosage form employed and the route of administration utilized. For self-replicating DNA vectors and/or vaccine compositions of the present invention, the therapeutically effective dose may be estimated initially from cell culture assays.
[0095] The invention also relates in part to a method of eliciting an immune response in a subject comprising administering to a subject in need thereof a prophylactically effective amount of the self-replicating DNA vectors and/or vaccine compositions of the present invention.
[0096] The sequences used in the construction of the self-replicating DNA vectors of the present invention are provided in Table 1 below. The sequence of the Rep protein is also provided in Table 1.
TABLE-US-00001 TABLE1 Sequencesusedinconstructionoftheself-replicatingDNAvector. SEQIDNOand Description Sequence SEQIDNO:1- AGAGGTGCCCCACAGGCGGCGGTTAGTATTACCCGCCGCCTGGG nucleotide GCACCGGGGCACCGCAGCCATTGGCTGCCGTGCCGAGGTGCCC sequenceofBFDV CGCCTTAGGGAGGAGTAAATGGCGCCGTTAAACGGTGCCGTAAT LIRelement(Ori) TTCCGGAGGATCACAGTCGCCCGGGAACA SEQIDNO:2- ATGCCGTCCAAGGAGGGCTCTGGCTGTCGCCGTTGGTGTTTCAC nucleotide CCTTAACAACCCTACAGACGGCGAGATCGAATTCGTCCGTACTCT sequence CGGGCCTGACGAATTCTACTATGCCATCGTTGGACGGGAAAAGG ofrepgene GCGAGCAAGGTACCCCCCATTTGCAAGGCTACTTTCATTTCAAAA ATAAGAAGCGACTGAGCGCGCTTAATAAAATGCTGCCGCGAGCTC ATTTTGAGCGCGCTAAAGGGAGTGATGCAGATAATGAGAAGTATT GCAGTAAAGAGGGGGACGTTATACTTACCCTGGGCATTGTGGCG AGAGATGGTCACCGCGCTTTCGACGGAGCTGTTGCTGCCGTGAT GTCCGGACGCAAAATGAAGGAAGTCGCGCGAGAGTTCCCAGATA TCTACGTCAGGCATGGGGGGGGCTTGCATAACCTCTCTCTATTGG TCGGTTCCCGCCCACGTGATTTCAAGACAGAAGTTGACGTCATCT ACGGGCCTCCTGGGTGTGGCAAGAGTAAATGGGCCAATGAGCAG CCTGGGACTAAATATTATAAAATGCGCGGTGAATGGTGGGATGGA TATGATGGGGAAGATGTTGTCATATTGGACGACTTTTATGGGTGG CTACCTTATTGTGAGATGCTCCGCCTTTGCGACCGTTATCCACATA AAGTGCCAGTTAAGGGCGCTTTTGTGGAGTTTACCAGCAAGAGGA TCATTATCACGAGCAATAAGTCCCCCGAGACCTGGTACAAGGAGG ACTGTGACCCGAAGCCACTGTTCCGGAGATTCACTCGTGTTTGGT GGTACACTGACAAGTTGGAACAAGTCCGGCCTGATTTCCTTGCCC ACCCCATCAATTTTTGA SEQIDNO:3- MPSKEGSGCRRWCFTLNNPTDGEIEFVRTLGPDEFYYAIVGREKGE aminoacid QGTPHLQGYFHFKNKKRLSALNKMLPRAHFERAKGSDADNEKYCSK sequenceofRep EGDVILTLGIVARDGHRAFDGAVAAVMSGRKMKEVAREFPDIYVRHG protein RGLHNLSLLVGSRPRDFKTEVDVIYGPPGCGKSKWANEQPGTKYYK MRGEWWDGYDGEDVVILDDFYGWLPYCEMLRLCDRYPHKVPVKGA FVEFTSKRIIITSNKSPETWYKEDCDPKPLFRRFTRVWWYTDKLEQV RPDFLAHPINF* SEQIDNO:4- CTGAGGCGGAAAGAACCAGCTGTGGAATGTGTGTCAGTTAGGGT nucleotide GTGGAAAGTCCCCAGGCTCCCCAGCAGGCAGAAGTATGCAAAGC sequenceofSV40 ATGCATCTCAATTAGTCAGCAACCAGGTGTGGAAAGTCCCCAGGC promoter TCCCCAGCAGGCAGAAGTATGCAAAGCATGCATCTCAATTAGTCA GCAACCATAGTCCCGCCCCTAACTCCGCCCATCCCGCCCCTAACT CCGCCCAGTTCCGCCCATTCTCCGCCCCATGGCTGACTAATTTTT TTTATTTATGCAGAGGCCGAGGCCGCCTCGGCCTCTGAGCTATTC CAGAAGTAGTGAGGAGGCTTTTTTGGAGGCCTAGGCTTTTGCAAA
[0097] The following examples are offered by way of illustration and not by way of limitation.
Example 1
Cloning and Transfection
[0098] The vectors used in this study (
[0099] Replicating (RCR+) and non-replicating (RCR?) vectors with luciferase and enhanced green fluorescent protein (eGFP) as reporter genes were constructed using standard cloning techniques. Primers used for cloning are provided in Table 2 below. The sequence of the gene encoding the eGFP was codon-optimized for expression in mammalian cells. A vector diagram of RCR+ eGFP is provided in
[0100] Luciferase expression was evaluated with luc on both the sense; forward (F) and antisense; reverse (R) DNA strands with respect to rep. All vector constructs were made in overnight E. coli DH5a cultures, and high-quality plasmid DNA was isolated using a ZymoPURE? II DNA maxiprep kit.
[0101] DNA used for transfections was >95% supercoiled, endotoxin-free and supplied by Aldevron (USA) or prepared using a ZymoPURE? II Plasmid Maxiprep Kit (Zymogen) as per manufacturer's instructions and evaluated by agarose gel electrophoresis. Cell lines were obtained from the American Type Culture Collection (ATCC, USA); these included HEK-293 (ATCC? CRL-1573?), HEK-293T (ATCC? CRL-3216?) and HeLa S3 (ATCC? CCL-2.2?). All cell lines were maintained at 37? C. in a 5% CO2 with 80-95% humidity incubator. The nutrient medium was exchanged every 2-3 days with DMEM (high glucose, GlutaMAX?) supplemented with 10% Gibco? Fetal Bovine Serum (Thermo Fisher Scientific, USA) and 1% penicillin/streptomycin (100?; Sigma-Aldrich).
[0102] Cells were transfected with DNA plasmids by seeding 6, 12, or 24 well plates at a 30-50% confluency and cultured to ? 60-80% confluency. The transfection reagent used was X-tremeGENE? HP DNA (Roche) and was optimised per cell line as per manufacturer's instructions. Luciferase assays were repeated multiple times using six replicates. Where comparisons of luminescence from different vectors were performed the vectors were transfected in equal copy number, calculated as pMoles and overall transfection concentration maintained by adding empty pUk19 vector as filler DNA. Where limited DNA transfection was desired, DNA transfection was terminated after 4 h by aspirating the growth media containing the transfection mix, washing 3? with PBS, and adding fresh growth media.
TABLE-US-00002 TABLE2 PrimersusedforcloningBFDVrepandegfp. SensePrimer AntisensePrimer Product Size Sequence Cloning Sequence Cloning Description (bp) (5-3) site (5-3) site BFDVrep 1053 GGTGGTGCGG NotI GGTGGTCTCG XhoI CCGCAGAGGT AGTCAAAAATT GCCCCACAGGC GATGGGGTG(SEQ (SEQIDNO:6) IDNO:7) egfp 744 GTGGTAAGCTT HindIII GGTGGTGGAT BamHI ATGGTGAGCAA CCTTACTTGTA GGGCGAG CAGCTCGTCCATGC (SEQIDNO:8) (SEQIDNO:9)
Analysis of Reporter Gene Expression
[0103] Total DNA was extracted using a DNeasy Blood & Tissue kit (Qiagen) as per manufacturer's instructions for cultured cells. To enrich for circular DNA, a rolling circle amplification (RCA) method was used as described by Shepherd et al (2005) with a TempliPhi amplification kit (GE Healthcare).
[0104] The luciferase assays were performed using the Luciferase Assay System (Promega) as per manufacturer's instructions. Luminescence was measured at 48 hours (h) post-transfection (pt) unless otherwise stated.
[0105] Transfections in tissue culture using fluorescent vectors were regularly inspected and imaged using a conventional Axio Vert.A1 inverted microscope (ZEISS, Germany) with 5?, 10?, 20? and 56? objective lenses, a HBO 50 halogen lighting system and a Axiocam ICm1 camera. The exposure was adjusted such that the brightest fluorescent cells were within the camera's sensitivity range.
[0106] Confocal microscopy was performed using pre-treated (0.03% poly-L-lysine in PBS for 5 minutes) four-well chamber slides. Transfections were performed using standard protocols. At 24 h or 48 h post-transfection (pt) the media was carefully aspirated with a 1 mL pipette. Cells were fixed using 100 ?L of a 4% paraformaldehyde solution for 5 minutes. After fixation, cells were washed three times with PBS and stained for 30 seconds with Hoechst 33342 (Sigma, 10 mg/mL) in PBS at a ratio of 1:5000. The slides were again washed three times and thereafter treated with 20 ?L Mowiol (Sigma) combined with 20 mg/mL n-propyl gallate, a cover slide was applied, and slides were dried overnight at room temperature then stored at 4? C. A LSM 880 with Airyscan inverted confocal microscope (ZEISS), equipped with an argon laser, providing light at 488 nm for eGFP fluorescence and 405 nm for Hoechst stains was used. The system used a high sensitivity photomultiplier tube imager that was calibrated against the brightest positive fluorescent sample to prevent sensor overexposure. Images were captured as a series of Z-stacks and merged into a maximum intensity projection. This allowed for the quantification of fluorescence intensity using the Zen Blue 2.5 software suite (ZEISS). Cells positive for fluorescence were identified, and the mean level of eGFP fluorescence and total surface area determined.
Example 2
The Effect of BFDV Rep Expressed in Trans and Provided in Cis with its Native Promoter on Recombinant Protein Expression
[0107] To investigate the effect of Rep expressed in trans on recombinant protein expression, a luciferase reporter gene assay was performed comparing pGL4.13 in the presence or absence of co-transfected Rep (
[0108] Luminescence was used to investigate the effect of the BFDV ori on recombinant protein expression. The pGL4.13 luc expression cassette was placed on the sense strand (F) between two ori sequences and, in the process, created a truncated rep that had previously had the ATG disrupted (RCR? LucF vector;
[0109] RCA assays demonstrated that in the presence of Rep the RCR? LucF vector (5.4 kb) formed an RCR? produced amplicon at the predicted size of 2.8 kb. This result was similar to RCR? BFDV control which also generated an RCR amplicon when Rep was added in trans (
[0110] To further investigate the effect of rep on luminescence when co-transfected with RCR? LucF, a series of dilutions were set up to titrate out expressed Rep (
[0111] Similar inhibitory effects have been observed in other related circoviruses such as PCV, where it has been suggested that the inhibitory effect is also linked to the ability of PCV Rep to interact/recruit the activity of transcription inhibitors and other host proteins. As a DNA binding protein, and one that is capable of recruiting transcription inhibitors, Rep may have the ability to disruptively affect host cell gene expression as well. This ability might constitute a form of viral defence, whereby disruptive inhibition of host genes, particularly antiviral response genes, may occur if Rep recognises any transcriptionally active host cell DNA sequences. Preliminary work done assessing antiviral response genes indicated that Caspase 10 might be one such gene as it was strongly downregulated compared to a pUK19 control in cells where Rep was overexpressed.
Example 3
Evaluation of Strength of the Native Rep Promoter within the Ori
[0112] To evaluate the strength of the native rep promoter within the ori, the SV40 promoter was removed from RCR? LucF to create the vector RCR? LucF ?SV40. Luminescence from both vectors was compared in the presence and absence of Rep (
[0113] To evaluate the effect of Rep provided in cis with its native promoter, the luc cassette was placed downstream of the viral ori rep sequence to create the RCR+ LucF vector. Two fully self-replicating vector pairs (RCR+ LucF/R) and an additional non-replicating control (RCR? LucR) were developed for this purpose. These new vectors expressed Rep under its native viral promoter. In addition to this, the luciferase expression cassette was tested downstream of Rep on the same sense strand in a forward orientation (F) or on Reps antisense strand in a reverse orientation (R), truncating the majority of the BFDV capsid gene (
[0114] Luminescence was compared with RCR? LucF in HEK293T and HeLa S3 cells. Luminescence readings from RCR+ LucF improved in both HEK293T and HeLa S3 cells yet were still well below the levels obtained by the non-replicating RCR? LucF control (
[0115] To determine whether the interaction of Rep with the upstream ori was responsible for observed decreases in luminescence, the luc expression cassette was placed on the antisense strand to create the RCR? LucR and RCR+ LucR vectors. Luminescence was then compared between these two vectors in HEK293T and HeLa S3 mammalian cells. A comparison in HEK293T mammalian cells demonstrated a limited improvement when compared to the luc cassette placed on the sense strand. Surprisingly, when the luc expression cassette was placed antisense to Rep, luminescence was significantly (p<0.001) improved in HEK293T cells and almost fully restored to the level obtained from the non-replicating RCR? LucR control in HeLa S3 cells (
[0116] The observed differences in luminescence between HEK293T and HeLa S3 cells (
Example 4
Comparison of Replication-Competent BFDV Expression Vector with Non-Replicating Vectors
[0117] A comparison was made over time between the RCR? LucR, RCR+ LucR (containing the luc cassette on the antisense strand) and the positive control. Less luminescence was observed over time for non-replicating luciferase expression vectors RCR? LucR and positive control. No difference in luminescence was observed between RCR? LucR and RCR+ LucR at 48 hours post-transfection; however, at 96 hours post-transfection (including 1 passage) luciferase luminescence from the replicating RCR+LucR surpassed the levels from both the RCR? LucR and positive control vectors (P<0.05) with luminescence among HeLa S3 cells transfected replicative RCR+ LucR approximately 2-fold higher compared to non-replicative RCR? LucR transfected cells. At 120 hours post-transfection, these differences increased further (P<0.05) (
[0118] To further investigate the differences between the replicating and non-replicating vectors and to quantify gene expression at the cellular level, the luc reporter was replaced with egfp to create RCR? eGFPR and RCR+ eGFPR (
[0119] To quantify the amplification of fluorescence and cell size changes, replicating and non-replicating eGFP vectors were transfected into HeLa S3 cells using an optimised transfection protocol. This was designed to minimise DNA vector uptake to mirror DNA vaccine uptake observed in live animal models. Fluorescence and cell size were quantified using confocal microscopy, 24 hours post-transfection (
[0120] These size changes suggest complex internal cellular biochemistry and alterations in internal homeostasis are occurring. Literature on RCR indicates that the process is prominent when a host cell enters S-Phase. Seemingly, when the host cellular machinery necessary for RCR, such as DNA polymerase, is most readily available. This idea is supported by the observed increase in cellular granularity, which is known to correlate with changes in DNA conformation and concentration, that was seen among RCR+ eGFP transfected cells during FACS. Whether RCR or Rep can induce entry into S-Phase and maintain or halt it in this state are intriguing questions worthy of further investigation. Regardless, a robust innate cellular and antiviral gene response are expected from RCR because of the stimulation that active, pathogenic genomic replication can have on known viral PRRs. Recent research has indicated that pathogen viability and threat level is at least in part determined by quantifiable detection of foreign genomic replication and gene expression. These signals can be used by the immune system to inform the magnitude and type of immune response required to address the threat resulting in the generation of a unique PAMP. The potential for RCR amplified gene expression vectors to directly trigger known innate PRRs and activate antiviral cellular responses would be a beneficial research and vaccine design tool.
Example 5
Expression in Mouse Animal Experimental Model
[0121] Confocal microscopy was used to quantify eGFP expression in mouse muscle cross sections following inoculation to demonstrate the expression of the self-replicating vectors within a mouse animal experimental model. Tissue sections of negative control mouse samples indicated a uniform level of eGFP fluorescence from all muscle fibre bundles as expected. This was recorded and used to define the cut-off threshold for positive fluorescence detection. The fluorescence of the RCR+ eGFP transfected muscle samples and that of the RCR+ eGFP and pTHRep boosted sample both exhibited brighter eGFP fluorescence than the RCR? eGFP samples 28 days post inoculation. The presence of a few exceptionally bright muscle fibre bundles was noted only in the RCR+ eGFP with pTHRep boosted samples (
[0122] To capture as much image data as possible from each anterior tibialis muscle cross section, tile scan images of up to 8?8 Z-stack captures were taken and merged. These images gave a good overview over the whole muscle cross section: these merged images are depicted in
[0123] To quantify gene expression in the mouse muscle tissues, confocal microscopy was used to evaluate the relative mean eGFP fluorescence of individual muscle fibre bundles from the different inoculation groups of mice (
REFERENCES
[0124] Bai, H., Lester, G. M. S., Petishnok, L. C. & Dean, D. A. Cytoplasmic transport and nuclear import of 516 plasmid DNA. Biosci Rep 37 (2017). [0125] Regnard, G. L., de Moor, W. R. J., Hitzeroth, II, Williamson, A. L. & Rybicki, E. P. Xenogenic rolling-circle replication of a synthetic beak and feather disease virus genomic clone in 293TT mammalian cells and Nicotiana benthamiana. J Gen Virol 98, 2329-2338 (2017).