HIGH EFFICIENCY PRODUCTION OF CANNABIDIOLIC ACID
20240344093 ยท 2024-10-17
Inventors
- John E. HUNG (Emeryville, CA, US)
- William E. DRAPER (Emeryville, CA, US)
- Victor Holmes (Emeryville, CA, US)
Cpc classification
International classification
Abstract
The present disclosure features compositions and methods for producing one or more cannabinoids, such as cannabidiolic acid (CBDa), in a host cell, such as a yeast cell, that is genetically modified to express the enzymes of a cannabinoid biosynthetic pathway. Using the compositions and methods of the present invention, the host cell may be genetically modified to express one or more enzymes of a cannabinoid biosynthetic pathway, such as an enzyme having CBDa synthase (CBDaS) activity.
Claims
1. A genetically modified host cell capable of producing CBDa or CBD, wherein the genetically modified host cell comprises one or more heterologous nucleic acids that each, independently, encodes an enzyme having CBDaS activity.
2. The genetically modified host cell of claim 1, wherein the enzyme having CBDaS activity is a fusion protein.
3. The genetically modified host cell of claim 2, wherein the fusion protein comprises an amino acid sequence of a CBDaS or a portion thereof.
4. The genetically modified host cell of claim 2, wherein the fusion protein comprises an amino acid sequence that is at least 80% identical to the amino acid sequence of SEQ ID NOS: 1, 4, 7, 8, 9, 10, 11, 13, 15, 17, 19, 21, 4, 7, 8, 9, 10, 11, 13, 15, 17, 19, 21, 134, 135, 136, 137, 147, 148, 149, 150, or 151.
5. The genetically modified host cell of claim 2, wherein the fusion protein comprises an amino acid sequence of a carrier protein or a portion thereof, an amino acid sequence of a signal sequence or a portion thereof, or an amino acid sequence of a linker or a portion thereof.
6. The genetically modified host cell of claim 2, wherein the fusion protein comprises an amino acid sequence that is at least 80% identical to the amino acid sequence of SEQ ID NOS: 34, 36, 73, 77, 81, 87, 89, 90, 91, 103, 104, 105, 106, 107, 108, 109, 110, 111, or 112.
7. (canceled)
8. The genetically modified host cell of claim 2, wherein the fusion protein comprises an amino acid sequence that is at least 80% identical to the amino acid sequence of SEQ ID NOS: 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, or 54.
9. (canceled)
10. The genetically modified host cell of claim 2, wherein the fusion protein comprises an amino acid sequence that is at least 80% identical to the amino acid sequence of SEQ ID NOS: 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 152, or 172.
11. The genetically modified host cell of claim 2, wherein the fusion protein comprises an amino acid sequence of a protease recognition site.
12. The genetically modified host cell of claim 11, wherein the protease recognition site is selected from the group of amino acid sequences consisting of RR, KR, RRK, RRQ, RRW, RRE, LDKR, LDKREAEA, and KREAEA.
13. The genetically modified host cell of claim 2, wherein the fusion protein comprises an amino acid sequence of a mating factor alpha (MF?) or a portion thereof.
14. The genetically modified host cell of claim 2, wherein the fusion protein comprises an amino acid sequence that is at least 80% identical to the amino acid sequence of SEQ ID NOS: 153, 154, 155, 156, or 157.
15. The genetically modified host cell of claim 2, wherein the fusion protein comprises two or more of: a) an amino acid sequence of a CBDaS or a portion thereof; b) an amino acid sequence that is at least 80% identical to the amino acid sequence of SEQ ID NOS: 1, 4, 7, 8, 9, 10, 11, 13, 15, 17, 19, 21, 4, 7, 8, 9, 10, 11, 13, 15, 17, 19, 21, 134, 135, 136, 137, 147, 148, 149, 150, or 151; c) an amino acid sequence of a carrier protein or a portion thereof; d) an amino acid sequence that is at least 80% identical to the amino acid sequence of SEQ ID NOS: 34, 36, 73, 77, 81, 87, 89, 90, 91, 103, 104, 105, 106, 107, 108, 109, 110, 111, or 112; e) an amino acid sequence of a signal sequence or a portion thereof; f) an amino acid sequence that is at least 80% identical to the amino acid sequence of SEQ ID NOS: 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, or 54; g) an amino acid sequence of a linker or a portion thereof; h) an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NOS: 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 152, or 172; i) an amino acid sequence of a protease recognition site; j) a protease recognition site selected from the group of amino acid sequences consisting of RR, KR, RRK, RRQ, RRW, RRE, LDKR, LDKREAEA, and KREAEA; k) an amino acid sequence of a mating factor alpha (MF) or a portion thereof; or l) an amino acid sequence that is at least 80% identical to the amino acid sequence of SEQ ID NOS: 153, 154, 155, 156, or 157.
16. The genetically modified host cell of claim 1, wherein the enzyme having CBDaS activity or the amino acid sequence of a CBDaS or a portion thereof comprises one or more of the following mutations when aligned with and in reference to SEQ ID NO: 136: N45Q, N65Q, S168N, N296Q, N304Q, N328Q, N498Q, T47S, T67S, S170T, T298S, T306S, S330T, or T500S.
17. The genetically modified host cell of claim 1, wherein the enzyme having CBDaS activity or the amino acid sequence of a CBDaS or a portion thereof comprises one or more amino acid substitutions occurring at position(s) 29, 31, 43, 49, 53, 56, 57, 65, 71, 78, 79, 93, 95, 103, 117, 125, 129, 143, 147, 151, 161, 183, 213, 235, 241, 263, 264, 285, 286, 303, 314, 325, 336, 339, 396, 436, 518, or 540 when aligned with and in reference to SEQ ID NO: 137.
18. (canceled)
19. The genetically modified host cell of claim 1, wherein the enzyme having CBDaS activity or the amino acid sequence of a CBDaS or a portion thereof comprises one or more amino acid substitutions selected from the group consisting of: a) R53T, N78D, V147D, H235D, I263V, K325N, V540C; b) R53T, P65D, L71D, N79D, L93D, V147D, W183N, H235D, S336C; c) L71D, N78D, G117A, V147D, W183N, I263V, K325N, S336C, V540C; d) R53T, P65D, L71D, N78D, N79D, L93D, V147D, W183N, H235D, K325N, S336C, V540C; e) L71D, L93D, V147D, H235D, I263V; f) R53T, V147D, 1151L, W183N, H235D, S336C, V540C; g) R53T, N78D, N79D, G117A, V147D, S336C; h) R53T, P65D, L71D, N79D, L93D, V147D, W183N, H235D, S336C; i) R53T, L71D, N78D, G117A, V147D, H235D, S336C, V540C; j) R53T, P65D, N78D, G117A, V147D, H235D, K325N, S336C, V540C; k) R53T, P65D, N78D, L93D, V147D, W183N, H235D, V540C; 1, R53T, N78D, V147D, W183N, H235D, I263V, S336C; m) R53T, N79D, V147D, W183N, H235D, I263V, K325N, S336C; n) R53T, P65D, L71D, N78D, V147D, H235D, I263V, S336C, V540C; 0, R53T, L71D, G117A, V147D, H235D, I263V, V540C; p) R53T, L71D, N78D, G117A, V147D, H235D, 1263V, K325N, S336C, V540C; q) R53T, P65D, N78D, N79D, V147D, S336C, V540C; r) R53T, N78D, N79D, V147D, W183N, H235D, I263V, K325N; s) R53T, 1151L, H235D, K325N, S336C; and t) R53T, P65D, L71D, N79D, L93D, V147D, W183N, H235D, S336C, when aligned with and in reference to SEQ ID NO: 137.
20. A genetically modified host cell comprising an enzyme having at least 80% sequence identity to the amino acid sequence of any of the enzymes having CBDaS activity or to the amino acid sequence of a CBDaS or a portion thereof in claim 19.
21-22. (canceled)
23. A method for producing CBDa or CBD, comprising: a) culturing the genetically modified host cell of claim 1 in a medium with a carbon source under conditions suitable for making CBDa or CBD; and b) recovering CBDa or CBD from the genetically modified host cell or the medium.
24. A fermentation composition comprising CBDa or CBD, comprising: a) the genetically modified host cell of claim 1; and b) CBDa or CBD produced by the genetically modified host cell.
25. (canceled)
26. A non-naturally occurring enzyme having CBDaS activity, comprising an amino acid sequence that is at least 80% identical to the amino acid sequence of SEQ ID NO: 4, 7, 8, 9, 10, 11, 13, 15, 17, 19, 21, 134, 135, 136, 137, 147, 148, 149, 150, or 151.
27-51. (canceled)
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
DETAILED DESCRIPTION OF THE INVENTION
Definitions
[0035] As used herein the singular forms a, an, and, the include plural reference unless the context clearly dictates otherwise.
[0036] The term about when modifying a numerical value or range herein includes normal variation encountered in the field, and includes plus or minus 1-10% (e.g., 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9% or 10%) of the numerical value or end points of the numerical range. Thus, a value of 10 includes all numerical values from 9 to 11. All numerical ranges described herein include the endpoints of the range unless otherwise noted, and all numerical values in-between the end points, to the first significant digit.
[0037] As used herein, the term cannabinoid refers to a chemical substance that binds or interacts with a cannabinoid receptor (for example, a human cannabinoid receptor) and includes, without limitation, chemical compounds such endocannabinoids, phytocannabinoids, and synthetic cannabinoids. Synthetic compounds are chemicals made to mimic phytocannabinoids which are naturally found in the cannabis plant (e.g., Cannabis sativa), including but not limited to cannabigerols (CBG), cannabichromene (CBC), cannabidiol (CBD), tetrahydrocannabinol (THC), cannabinol (CBN), cannabinodiol (CBDL), cannabicyclol (CBL), cannabielsoin (CBE), and cannabitriol (CBT).
[0038] As used herein, the term capable of producing refers to a host cell which is genetically modified to include the enzymes necessary for the production of a given compound in accordance with a biochemical pathway that produces the compound. For example, a cell (e.g., a yeast cell) capable of producing a cannabinoid is one that contains the enzymes necessary for production of the cannabinoid according to the cannabinoid biosynthetic pathway.
[0039] As used herein, the term exogenous refers to a substance or compound that originated outside an organism or cell. The exogenous substance or compound can retain its normal function or activity when introduced into an organism or host cell described herein.
[0040] As used herein, the term fermentation composition refers to a composition which contains genetically modified host cells and products or metabolites produced by the genetically modified host cells. An example of a fermentation composition is a whole cell broth, which may be the entire contents of a vessel, including cells, aqueous phase, and compounds produced from the genetically modified host cells.
[0041] As used herein, the term gene refers to the segment of DNA involved in producing or encoding a polypeptide chain. It may include regions preceding and following the coding region (leader and trailer) as well as intervening sequences (introns) between individual coding segments (exons). Alternatively, the term gene can refer to the segment of DNA involved in producing or encoding a non-translated RNA, such as an IRNA, tRNA, gRNA, or micro RNA.
[0042] A genetic pathway or biosynthetic pathway as used herein refer to a set of at least two different coding sequences, where the coding sequences encode enzymes that catalyze different parts of a synthetic pathway to form a desired product (e.g., a cannabinoid). In a genetic pathway a first encoded enzyme uses a substrate to make a first product which in turn is used as a substrate for a second encoded enzyme to make a second product. In some embodiments, the genetic pathway includes 3 or more members (e.g., 3, 4, 5, 6, 7, 8, 9, etc.), wherein the product of one encoded enzyme is the substrate for the next enzyme in the synthetic pathway.
[0043] As used herein, the term genetic switch refers to one or more genetic elements that allow controlled expression of enzymes, e.g., enzymes that catalyze the reactions of cannabinoid biosynthesis pathways. For example, a genetic switch can include one or more promoters operably linked to one or more genes encoding a biosynthetic enzyme, or one or more promoters operably linked to a transcriptional regulator which regulates expression one or more biosynthetic enzymes.
[0044] As used herein, the term genetically modified denotes a host cell that contains a heterologous nucleotide sequence. The genetically modified host cells described herein typically do not exist in nature.
[0045] As used herein, the term heterologous refers to what is not normally found in nature. The term heterologous compound refers to the production of a compound by a cell that does not normally produce the compound, or to the production of a compound at a level not normally produced by the cell. For example, a cannabinoid can be a heterologous compound.
[0046] A heterologous genetic pathway or a heterologous biosynthetic pathway as used herein refer to a genetic pathway that does not normally or naturally exist in an organism or cell.
[0047] The term host cell as used in the context of this invention refers to a microorganism, such as yeast, and includes an individual cell or cell culture contains a heterologous vector or heterologous polynucleotide as described herein. Host cells include progeny of a single host cell, and the progeny may not necessarily be completely identical (in morphology or in total DNA complement) to the original parent cell due to natural, accidental, or deliberate mutation and/or change. A host cell includes cells into which a recombinant vector or a heterologous polynucleotide of the invention has been introduced, including by transformation, transfection, and the like.
[0048] As used herein, the term medium refers to culture medium and/or fermentation medium.
[0049] The terms modified, recombinant and engineered, when used to describe a host cell described herein, refer to host cells or organisms that do not exist in nature, or express compounds, nucleic acids or proteins at levels that are not expressed by naturally occurring cells or organisms.
[0050] As used herein, the phrase operably linked refers to a functional linkage between nucleic acid sequences such that the linked promoter and/or regulatory region functionally controls expression of the coding sequence.
[0051] Percent (%) sequence identity with respect to a reference polynucleotide or polypeptide sequence is defined as the percentage of nucleic acids or amino acids in a candidate sequence that are identical to the nucleic acids or amino acids in the reference polynucleotide or polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity. Alignment for purposes of determining percent nucleic acid or amino acid sequence identity can be achieved in various ways that are within the capabilities of one of skill in the art, for example, using publicly available computer software such as CLUSTAL, BLAST, BLAST-2, or Megalign software. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared. For example, percent sequence identity values may be generated using the sequence comparison computer program BLAST. As an illustration, the percent sequence identity of a given nucleic acid or amino acid sequence, A, to, with, or against a given nucleic acid or amino acid sequence, B, (which can alternatively be phrased as a given nucleic acid or amino acid sequence, A that has a certain percent sequence identity to, with, or against a given nucleic acid or amino acid sequence, B) is calculated as follows:
100multiplied by(the fraction X/Y)
where X is the number of nucleotides or amino acids scored as identical matches by a sequence alignment program (e.g., BLAST) in that program's alignment of A and B, and where Y is the total number of nucleic acids in B. It will be appreciated that where the length of nucleic acid or amino acid sequence A is not equal to the length of nucleic acid or amino acid.
[0052] The terms polynucleotide and nucleic acid are used interchangeably and refer to a single or double-stranded polymer of deoxyribonucleotide or ribonucleotide bases read from the 5 to the 3 end. A nucleic acid as used in the present invention will generally contain phosphodiester bonds, although in some cases, nucleic acid analogs may be used that may have alternate backbones, comprising, e.g., phosphoramidate, phosphorothioate, phosphorodithioate, or O-methylphosphoroamidite linkages (see Eckstein, Oligonucleotides and Analogues: A Practical Approach, Oxford University Press); positive backbones; non-ionic backbones, and non-ribose backbones. Nucleic acids or polynucleotides may also include modified nucleotides that permit correct read-through by a polymerase. Polynucleotide sequence or nucleic acid sequence includes both the sense and antisense strands of a nucleic acid as either individual single strands or in a duplex. As will be appreciated by those in the art, the depiction of a single strand also defines the sequence of the complementary strand; thus, the sequences described herein also provide the complement of the sequence. Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses variants thereof (e.g., degenerate codon substitutions) and complementary sequences, as well as the sequence explicitly indicated. The nucleic acid may be DNA, both genomic and cDNA, RNA or a hybrid, where the nucleic acid may contain combinations of deoxyriboand ribo-nucleotides, and combinations of bases, including uracil, adenine, thymine, cytosine, guanine, inosine, xanthine hypoxanthine, isocytosine, isoguanine, etc. Nucleic acid sequences are presented in the 5 to 3 direction unless otherwise specified.
[0053] As used herein, the terms polypeptide, peptide, and protein are used interchangeably to refer to a polymer of amino acid residues. The terms encompass amino acid chains of any length, including full-length proteins, wherein the amino acid residues are linked by covalent peptide bonds.
[0054] As used herein, the term production generally refers to an amount of compound produced by a genetically modified host cell provided herein. In some embodiments, production is expressed as a yield of the compound by the host cell. In other embodiments, production is expressed as a productivity of the host cell in producing the compound.
[0055] As used herein, the term productivity refers to production of a compound by a host cell, expressed as the amount of non-catabolic compound produced (by weight) per amount of fermentation broth in which the host cell is cultured (by volume) over time (per hour).
[0056] As used herein, the term promoter refers to a synthetic or naturally derived nucleic acid that is capable of activating, increasing or enhancing expression of a DNA coding sequence, or inactivating, decreasing, or inhibiting expression of a DNA coding sequence. A promoter may contain one or more specific transcriptional regulatory sequences to further enhance or repress expression and/or to alter the spatial expression and/or temporal expression of the coding sequence. A promoter may be positioned 5 (upstream) of the coding sequence under its control. A promoter may also initiate transcription in the downstream (3) direction, the upstream (5) direction, or be designed to initiate transcription in both the downstream (3) and upstream (5) directions. The distance between the promoter and a coding sequence to be expressed may be approximately the same as the distance between that promoter and the native nucleic acid sequence it controls. As is known in the art, variation in this distance may be accommodated without loss of promoter function. The term also includes a regulated promoter, which generally allows transcription of the nucleic acid sequence while in a permissive environment (e.g., microaerobic fermentation conditions, or the presence of maltose), but ceases transcription of the nucleic acid sequence while in a non-permissive environment (e.g., aerobic fermentation conditions, or in the absence of maltose). Promoters used herein can be constitutive, inducible, or repressible.
[0057] The term yield refers to production of a compound by a host cell, expressed as the amount of compound produced per amount of carbon source consumed by the host cell, by weight.
High Efficiency Production of CBDa
[0058] In some embodiments, the disclosure features a host cell capable of producing CBDa or CBD. In some embodiments, the host cell contains one or more heterologous nucleic acids that each, independently, encodes an enzyme having CBDaS activity. In some embodiments, the enzyme having CBDaS activity is a fusion protein.
[0059] In some embodiments, the fusion protein comprises an amino acid sequence of a CBDas or a portion thereof. In some embodiments, the amino acid sequence of a CBDaS or a portion thereof comprises an amino acid sequence that is at least 80% identical to the amino acid sequence of SEQ ID NOS: 1, 4, 7, 8, 9, 10, 11, 13, 15, 17, 19, 21, 134, 135, 136, 137, 147, 148, 149, 150, or 151. In some embodiments, the fusion protein comprises an amino acid sequence that is at least 85% identical to the amino acid sequence of SEQ ID NOS: 1, 4, 7, 8, 9, 10, 11, 13, 15, 17, 19, 21, 134, 135, 136, 137, 147, 148, 149, 150, or 151. In some embodiments, the fusion protein comprises an amino acid sequence that is at least 90% identical to the amino acid sequence of SEQ ID NOS: 1, 4, 7, 8, 9, 10, 11, 13, 15, 17, 19, 21, 134, 135, 136, 137, 147, 148, 149, 150, or 151. In some embodiments, the fusion protein comprises an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NOS: 1, 4, 7, 8, 9, 10, 11, 13, 15, 17, 19, 21, 134, 135, 136, 137, 147, 148, 149, 150, or 151. In some embodiments, the fusion protein comprises an amino acid sequence that is 100% identical to the amino acid sequence of SEQ ID NOS: 1, 4, 7, 8, 9, 10, 11, 13, 15, 17, 19, 21, 134, 135, 136, 137, 147, 148, 149, 150, or 151.
[0060] In some embodiments, the fusion protein comprises an amino acid sequence of a carrier protein or a portion thereof. In some embodiments, the amino acid sequence of a carrier protein or a portion thereof is at least 80% identical to the amino acid sequence of SEQ ID NO: 34, 36, 73, 77, 81, 87, 89, 90, 91, 103, 104, 105, 106, 107, 108, 109, 110, 111, or 112. In some embodiments, the amino acid sequence of a carrier protein or a portion thereof is at least 85% identical to the amino acid sequence of SEQ ID NO: 34, 36, 73, 77, 81, 87, 89, 90, 91, 103, 104, 105, 106, 107, 108, 109, 110, 111, or 112. In some embodiments, the amino acid sequence of a carrier protein or a portion thereof is at least 90% identical to the amino acid sequence of SEQ ID NO: 34, 36, 73, 77, 81, 87, 89, 90, 91, 103, 104, 105, 106, 107, 108, 109, 110, 111, or 112. In some embodiments, the amino acid sequence of a carrier protein or a portion thereof is at least 95% identical to the amino acid sequence of SEQ ID NO: 34, 36, 73, 77, 81, 87, 89, 90, 91, 103, 104, 105, 106, 107, 108, 109, 110, 111, or 112. In some embodiments, the amino acid sequence of a carrier protein or a portion thereof is 100% identical to the amino acid sequence of SEQ ID NO: 34, 36, 73, 77, 81, 87, 89, 90, 91, 103, 104, 105, 106, 107, 108, 109, 110, 111, or 112.
[0061] In some embodiments, the fusion protein comprises an amino acid sequence of a signal sequence or a portion thereof. In some embodiments, the amino acid sequence of a signal sequence or a portion thereof is at least 80% identical to the amino acid sequence of SEQ ID NOS: 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, or 54. In some embodiments, the amino acid sequence of a signal sequence or a portion thereof is at least 85% identical to the amino acid sequence of SEQ ID NOS: 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, or 54. In some embodiments, the amino acid sequence of a signal sequence or a portion thereof is at least 90% identical to the amino acid sequence of SEQ ID NOS: 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, or 54. In some embodiments, the amino acid sequence of a signal sequence or a portion thereof is at least 95% identical to the amino acid sequence of SEQ ID NOS: 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, or 54. In some embodiments, the amino acid sequence of a signal sequence or a portion thereof is 100% identical to the amino acid sequence of SEQ ID NOS: 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, or 54.
[0062] In some embodiments, the fusion protein comprises an amino acid sequence of a linker or a portion thereof. In some embodiments, the amino acid sequence of a linker or a portion thereof is at least 80% identical to the amino acid sequence of SEQ ID NOS: 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 152, or 172. In some embodiments, the amino acid sequence of a linker or a portion thereof is at least 85% identical to the amino acid sequence of SEQ ID NOS: 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 152, or 172. In some embodiments, the amino acid sequence of a linker or a portion thereof is at least 90% identical to the amino acid sequence of SEQ ID NOS: 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 152, or 172. In some embodiments, the amino acid sequence of a linker or a portion thereof is at least 95% identical to the amino acid sequence of SEQ ID NOS: 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 152, or 172. In some embodiments, the amino acid sequence of a linker or a portion thereof is 100% identical to the amino acid sequence of SEQ ID NOS: 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 152, or 172.
[0063] In some embodiments, the fusion protein comprises an amino acid sequence of a linker and an amino acid sequence of a carrier protein or a portion thereof. In some embodiments, the amino acid sequence of a linker or a portion thereof is at least 80%, at least 85%, at least 90%, at least 95%, or is 100% identical to the amino acid sequence of SEQ ID NOS: 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 152, or 172, and the amino acid sequence of a carrier protein or a portion thereof is at least 80%, at least 85%, at least 90%, at least 95%, or is 100% identical to the amino acid sequence of SEQ ID NOS: 34, 36, 73, 77, 81, 87, 89, 90, 91, 103, 104, 105, 106, 107, 108, 109, 110, 111, or 112.
[0064] In some embodiments, the fusion protein comprises an amino acid sequence of a protease recognition site. In some embodiments, the protease recognition site is selected from the group of amino acid sequences consisting of RR, KR, RRK, RRQ, RRW, RRE, LDKR, LDKREAEA, and KREAEA.
[0065] In some embodiments, the fusion protein comprises an amino acid sequence of a mating factor alpha (MF?) or a portion thereof. In some embodiments, the amino acid sequence of a MF? or a portion thereof is at least 80% identical to the amino acid sequence of SEQ ID NOS: 153, 154, or 155. In some embodiments, the amino acid sequence of a MF? or a portion thereof is at least 85% identical to the amino acid sequence of SEQ ID NOS: 153, 154, or 155. In some embodiments, the amino acid sequence of a MF? or a portion thereof is at least 90% identical to the amino acid sequence of SEQ ID NOS: 153, 154, or 155. In some embodiments, the amino acid sequence of a MF? or a portion thereof is at least 95% identical to the amino acid sequence of SEQ ID NOS: 153, 154, or 155. In some embodiments, the amino acid sequence of a MF? or a portion thereof is 100% identical to the amino acid sequence of SEQ ID NOS: 153, 154, or 155.
[0066] In some embodiments, the fusion protein comprises an amino acid sequence that is at least 80% identical to the amino acid sequence of SEQ ID NOS: 156, or 157. In some embodiments, the fusion protein comprises an amino acid sequence that is at least 85% identical to the amino acid sequence of SEQ ID NOS: 156, or 157. In some embodiments, the fusion protein comprises an amino acid sequence that is at least 90% identical to the amino acid sequence of SEQ ID NOS: 156, or 157. In some embodiments, the fusion protein comprises an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NOS: 156, or 157. In some embodiments, the fusion protein comprises an amino acid sequence that is 100% identical to the amino acid sequence of SEQ ID NOS: 156, or 157.
[0067] In some embodiments, the fusion protein comprises two or more of (a) an amino acid sequence of a CBDaS or a portion thereof, (b) an amino acid sequence that is at least 80% identical to the amino acid sequence of SEQ ID NOS: 1, 4, 7, 8, 9, 10, 11, 13, 15, 17, 19, 21, 4, 7, 8, 9, 10, 11, 13, 15, 17, 19, 21, 134, 135, 136, 137, 147, 148, 149, 150, or 151, (c) an amino acid sequence of a carrier protein or a portion thereof, (d) an amino acid sequence that is at least 80% identical to the amino acid sequence of SEQ ID NOS: 34, 36, 73, 77, 81, 87, 89, 90, 91, 103, 104, 105, 106, 107, 108, 109, 110, 111, or 112, (e) an amino acid sequence of a signal sequence or a portion thereof, (f) an amino acid sequence that is at least 80% identical to the amino acid sequence of SEQ ID NOS: 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, or 54, (g) an amino acid sequence of a linker or a portion thereof, (h) an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NOS: 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 152, or 172, (i) an amino acid sequence of a protease recognition site, (j) a protease recognition site selected from the group of amino acid sequences consisting of RR, KR, RRK, RRQ, RRW, RRE, LDKR, LDKREAEA, and KREAEA, (k) an amino acid sequence of a mating factor alpha (MF?) or a portion thereof, or (1) an amino acid sequence that is at least 80% identical to the amino acid sequence of SEQ ID NOS: 153, 154, 155, 156, or 157.
[0068] In some embodiments, the enzyme having CBDaS activity or the amino acid sequence of a CBDaS or a portion thereof comprises one or more of the following mutations when aligned with and in reference to SEQ ID NO: 136: N45Q, N65Q, S168N, N296Q, N304Q, N328Q, N498Q, T47S, T67S, S170T, T298S, T306S, S330T, or T500S.
[0069] In some embodiments, the enzyme having CBDaS activity or the amino acid sequence of a CBDaS or a portion thereof comprises one or more amino acid substitutions occurring at position(s) 29, 31, 43, 49, 53, 56, 57, 65, 71, 78, 79, 93, 95, 103, 117, 125, 129, 143, 147, 151, 161, 183, 213, 235, 241, 263, 264, 285, 286, 303, 314, 325, 336, 339, 396, 436, 518, or 540 when aligned with and in reference to SEQ ID NO: 137. In some embodiments, the one or more amino acid substitutions is: N29G, R31T, P43D, L49D, R53T, N56D, N57D, P65D, L71D, L71S, N78D, N79D, L93D, G95A, V103Y, G117A, V125D, 1129L, H143A, V147D, 1151L, W161R, W161A, W161N, W161S, W161T, W161D, W161H, W183N, H213D, H213N, H235D, I241V, I263V, E264P, D285N, K303N, S314C, K325N, S336C, T339S, F396L, A436G, V518C, and/or V540C, when aligned with and in reference to SEQ ID NO: 137.
[0070] In some embodiments, the enzyme having CBDaS activity or the amino acid sequence of a CBDaS or a portion thereof comprises one or more amino acid substitutions selected from the group consisting of: [0071] a) R53T, N78D, V147D, H235D, 1263V, K325N, and V540C; [0072] b) R53T, P65D, L71D, N79D, L93D, V147D, W183N, H235D, and S336C; [0073] c) L71D, N78D, G117A, V147D, W183N, 1263V, K325N, S336C, and V540C; [0074] d) R53T, P65D, L71D, N78D, N79D, L93D, V147D, W183N, H235D, K325N, S336C, and V540C; [0075] e) L71D, L93D, V147D, H235D, and I263V; [0076] f) R53T, V147D, 1151L, W183N, H235D, S336C, and V540C; [0077] g) R53T, N78D, N79D, G117A, V147D, and S336C; [0078] h) R53T, P65D, L71D, N79D, L93D, V147D, W183N, H235D, and S336C; [0079] i) R53T, L71D, N78D, G117A, V147D, H235D, S336C, and V540C; [0080] j) R53T, P65D, N78D, G117A, V147D, H235D, K325N, S336C, and V540C; [0081] k) R53T, P65D, N78D, L93D, V147D, W183N, H235D, and V540C; [0082] 1) R53T, N78D, V147D, W183N, H235D, 1263V, and S336C; [0083] m) R53T, N79D, V147D, W183N, H235D, I263V, K325N, and S336C; [0084] n) R53T, P65D, L71D, N78D, V147D, H235D, 1263V, S336C, and V540C; [0085] 0) R53T, L71D, G117A, V147D, H235D, 1263V, and V540C; [0086] p) R53T, L71D, N78D, G117A, V147D, H235D, 1263V, K325N, S336C, and V540C; [0087] q) R53T, P65D, N78D, N79D, V147D, S336C, and V540C; [0088] r) R53T, N78D, N79D, V147D, W183N, H235D, 1263V, and K325N; [0089] s) R53T, 1151L, H235D, K325N, and S336C; and [0090] t) R53T, P65D, L71D, N79D, L93D, V147D, W183N, H235D, and S336C, when aligned with and in reference to SEQ ID NO: 137.
[0091] In some embodiments, the genetically modified host cell comprises an enzyme having at least 80% sequence identity to the amino acid sequence of any of the preceding enzymes having CBDaS activity or to the amino acid sequence of a CBDaS or a portion thereof.
[0092] In some embodiments, the host cell is a yeast cell or a yeast strain. In some embodiments, the yeast cell or the yeast strain is Saccharomyces cerevisiae.
[0093] In some embodiments, the disclosure features a method for producing CBDa or CBD, comprising culturing a genetically modified host cell capable of producing CBDa or CBD in a medium with a carbon source under conditions suitable for making CBDa or CBD, and recovering CBDa or CBD from the genetically modified host cell or the medium.
[0094] In some embodiments, the disclosure features a fermentation composition comprising a genetically modified host cell capable of producing CBDa or CBD, and CBDa or CBD produced by the genetically modified host cell. In some embodiments, the CBDa or CBD produced by the genetically modified host cell is within the genetically modified host cell.
[0095] In some embodiments, the disclosure features a non-naturally occurring enzyme having CBDaS activity, comprising an amino acid sequence that is at least 80% identical to the amino acid sequence of SEQ ID NO: 4, 7, 8, 9, 10, 11, 13, 15, 17, 19, 21, 134, 135, 136, 137, 147, 148, 149, 150, or 151.
[0096] In some embodiments, the non-naturally occurring enzyme having CBDaS activity comprises one or more of the following mutations when aligned with and in reference to SEQ ID NO: 136: N45Q, N65Q, S168N, N296Q, N304Q, N328Q, N498Q, T47S, T67S, S170T, T298S, T306S, S330T, or T500S.
[0097] In some embodiments, the non-naturally occurring enzyme having CBDaS activity comprises one or more amino acid substitutions occurring at position(s) 29, 31, 43, 49, 53, 56, 57, 65, 71, 78, 79, 93, 95, 103, 117, 125, 129, 143, 147, 151, 161, 183, 213, 235, 241, 263, 264, 285, 286, 303, 314, 325, 336, 339, 396, 436, 518, or 540 when aligned with and in reference to SEQ ID NO: 137. In some embodiments, the one or more amino acid substitutions is selected from the group consisting of: N29G, R31T, P43D, L49D, R53T, N56D, N57D, P65D, L71D, L71S, N78D, N79D, L93D, G95A, V103Y, G117A, V125D, 1129L, H143A, V147D, 1151L, W161R, W161A, W16IN, W161S, W16IT, W161D, W161H, W183N, H213D, H213N, H235D, I241V, I263V, E264P, D285N, K303N, S314C, K325N, S336C, T339S, F396L, A436G, V518C, and V540C when aligned with and in reference to SEQ ID NO: 137.
[0098] In some embodiments, the non-naturally occurring enzyme having CBDaS activity comprises one or more amino acid substitutions selected from the group consisting of: [0099] a) R53T, N78D, V147D, H235D, 1263V, K325N, and V540C; [0100] b) R53T, P65D, L71D, N79D, L93D, V147D, W183N, H235D, and S336C; [0101] c) L71D, N78D, G117A, V147D, W183N, I263V, K325N, S336C, and V540C; [0102] d) R53T, P65D, L71D, N78D, N79D, L93D, V147D, W183N, H235D, K325N, S336C, and V540C; [0103] e) L71D, L93D, V147D, H235D, and I263V; [0104] f) R53T, V147D, 1151L, W183N, H235D, S336C, and V540C; [0105] g) R53T, N78D, N79D, G117A, V147D, and S336C; [0106] h) R53T, P65D, L71D, N79D, L93D, V147D, W183N, H235D, and S336C; [0107] i) R53T, L71D, N78D, G117A, V147D, H235D, S336C, and V540C; [0108] j) R53T, P65D, N78D, G117A, V147D, H235D, K325N, S336C, and V540C; [0109] k) R53T, P65D, N78D, L93D, V147D, W183N, H235D, and V540C; [0110] 1) R53T, N78D, V147D, W183N, H235D, 1263V, and S336C; [0111] m) R53T, N79D, V147D, W183N, H235D, I263V, K325N, and S336C; [0112] n) R53T, P65D, L71D, N78D, V147D, H235D, I263V, S336C, and V540C; [0113] 0) R53T, L71D, G117A, V147D, H235D, I263V, and V540C; [0114] p) R53T, L71D, N78D, G117A, V147D, H235D, I263V, K325N, S336C, and V540C; [0115] q) R53T, P65D, N78D, N79D, V147D, S336C, and V540C; [0116] I) R53T, N78D, N79D, V147D, W183N, H235D, I263V, and K325N; [0117] S) R53T, 1151L, H235D, K325N, and S336C; and [0118] t) R53T, P65D, L71D, N79D, L93D, V147D, W183N, H235D, and S336C, when aligned with and in reference to SEQ ID NO: 137.
[0119] In some embodiments, the non-naturally occurring enzyme comprises an amino acid sequence that is at least 80% identical to the amino acid sequence of any of the non-naturally occurring enzymes having CBDaS activity in the preceding paragraph.
[0120] In some embodiments, the non-naturally occurring enzyme having CBDaS activity is a fusion protein. In some embodiments, the fusion protein comprises an amino acid sequence of a CBDaS or a portion thereof. In some embodiments, the fusion protein comprises an amino acid sequence that is at least 80% identical to the amino acid sequence of SEQ ID NOS: 1, 4, 7, 8, 9, 10, 11, 13, 15, 17, 19, 21, 134, 135, 136, 137, 147, 148, 149, 150, or 151. In some embodiments, the fusion protein comprises an amino acid sequence that is at least 85% identical to the amino acid sequence of SEQ ID NOS: 1, 4, 7, 8, 9, 10, 11, 13, 15, 17, 19, 21, 134, 135, 136, 137, 147, 148, 149, 150, or 151. In some embodiments, the fusion protein comprises an amino acid sequence that is at least 90% identical to the amino acid sequence of SEQ ID NOS: 4, 7, 8, 9, 10, 11, 13, 15, 17, 19, 21, 134, 135, 136, 137, 147, 148, 149, 150, or 151. In some embodiments, the fusion protein comprises an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NOS: 4, 7, 8, 9, 10, 11, 13, 15, 17, 19, 21, 134, 135, 136, 137, 147, 148, 149, 150, or 151. In some embodiments, the fusion protein comprises an amino acid sequence that is 100% identical to the amino acid sequence of SEQ ID NOS: 4, 7, 8, 9, 10, 11, 13, 15, 17, 19, 21, 134, 135, 136, 137, 147, 148, 149, 150, or 151.
[0121] In some embodiments, the fusion protein comprises an amino acid sequence of a carrier protein or a portion thereof. In some embodiments, the fusion protein comprises an amino acid sequence that is at least 80% identical to the amino acid sequence of SEQ ID NO: 34, 36, 73, 77, 81, 87, 89, 90, 91, 103, 104, 105, 106, 107, 108, 109, 110, 111, or 112. In some embodiments, the fusion protein comprises an amino acid sequence that is at least 85% identical to the amino acid sequence of SEQ ID NO: 34, 36, 73, 77, 81, 87, 89, 90, 91, 103, 104, 105, 106, 107, 108, 109, 110, 111, or 112. In some embodiments, the fusion protein comprises an amino acid sequence that is at least 90% identical to the amino acid sequence of SEQ ID NO: 34, 36, 73, 77, 81, 87, 89, 90, 91, 103, 104, 105, 106, 107, 108, 109, 110, 111, or 112. In some embodiments, the fusion protein comprises an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO: 34, 36, 73, 77, 81, 87, 89, 90, 91, 103, 104, 105, 106, 107, 108, 109, 110, 111, or 112. In some embodiments, the fusion protein comprises an amino acid sequence that is 100% identical to the amino acid sequence of SEQ ID NO: 34, 36, 73, 77, 81, 87, 89, 90, 91, 103, 104, 105, 106, 107, 108, 109, 110, 111, or 112.
[0122] In some embodiments, the fusion protein comprises an amino acid sequence of a signal sequence or a portion thereof. In some embodiments, the fusion protein comprises an amino acid sequence that is at least 80% identical to the amino acid sequence of SEQ ID NOS: 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, or 54. In some embodiments, the fusion protein comprises an amino acid sequence that is at least 85% identical to the amino acid sequence of SEQ ID NOS: 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, or 54. In some embodiments, the fusion protein comprises an amino acid sequence that is at least 90% identical to the amino acid sequence of SEQ ID NOS: 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, or 54. In some embodiments, the fusion protein comprises an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NOS: 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, or 54. In some embodiments, the fusion protein comprises an amino acid sequence that is 100% identical to the amino acid sequence of SEQ ID NOS: 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, or 54.
[0123] In some embodiments, the fusion protein comprises an amino acid sequence of a linker or a portion thereof. In some embodiments, the fusion protein comprises an amino acid sequence that is at least 80% identical to the amino acid sequence of SEQ ID NOS: 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 152, or 172. In some embodiments, the fusion protein comprises an amino acid sequence that is at least 85% identical to the amino acid sequence of SEQ ID NOS: 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 152, or 172. In some embodiments, the fusion protein comprises an amino acid sequence that is at least 90% identical to the amino acid sequence of SEQ ID NOS: 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 152, or 172. In some embodiments, the fusion protein comprises an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NOS: 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 152, or 172. In some embodiments, the fusion protein comprises an amino acid sequence that is 100% identical to the amino acid sequence of SEQ ID NOS: 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 152, or 172.
[0124] In some embodiments, the fusion protein comprises an amino acid sequence of a linker and an amino acid sequence of a carrier protein or a portion thereof. In some embodiments, the fusion protein comprises an amino acid sequence that is at least 80%, at least 85%, at least 90%, at least 95%, or is 100% identical to the amino acid sequence of SEQ ID NOS: 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 152, or 172, and an amino acid sequence that is at least 80%, at least 85%, at least 90%, at least 95%, or is 100% identical to the amino acid sequence of SEQ ID NOS: 34, 36, 73, 77, 81, 87, 89, 90, 91, 103, 104, 105, 106, 107, 108, 109, 110, 111, or 112.
[0125] In some embodiments, the fusion protein comprises an amino acid sequence of a protease recognition site. In some embodiments, the protease recognition site is selected from the group of amino acid sequences consisting of RR, KR, RRK, RRQ, RRW, RRE, LDKR, LDKREAEA, and KREAEA.
[0126] In some embodiments, the fusion protein comprises an amino acid sequence of a mating factor alpha (MF?) or a portion thereof. In some embodiments, the fusion protein comprises an amino acid sequence that is at least 80% identical to the amino acid sequence of SEQ ID NOS: 153, 154, or 155. In some embodiments, the fusion protein comprises an amino acid sequence that is at least 85% identical to the amino acid sequence of SEQ ID NOS: 153, 154, or 155. In some embodiments, the fusion protein comprises an amino acid sequence that is at least 90% identical to the amino acid sequence of SEQ ID NOS: 153, 154, or 155. In some embodiments, the fusion protein comprises an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NOS: 153, 154, or 155. In some embodiments, the fusion protein comprises an amino acid sequence that is 100% identical to the amino acid sequence of SEQ ID NOS: 153, 154, or 155.
[0127] In some embodiments, the fusion protein comprises an amino acid sequence that is at least 80% identical to the amino acid sequence of SEQ ID NOS: 156, or 157. In some embodiments, the fusion protein comprises an amino acid sequence that is at least 85% identical to the amino acid sequence of SEQ ID NOS: 156, or 157. In some embodiments, the fusion protein comprises an amino acid sequence that is at least 90% identical to the amino acid sequence of SEQ ID NOS: 156, or 157. In some embodiments, the fusion protein comprises an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NOS: 156, or 157. In some embodiments, the fusion protein comprises an amino acid sequence that is 100% identical to the amino acid sequence of SEQ ID NOS: 156, or 157.
[0128] In some embodiments, the fusion protein comprises two or more of (a) an amino acid sequence of a CBDaS or a portion thereof, (b) an amino acid sequence that is at least 80% identical to the amino acid sequence of SEQ ID NOS: 1, 4, 7, 8, 9, 10, 11, 13, 15, 17, 19, 21, 4, 7, 8, 9, 10, 11, 13, 15, 17, 19, 21, 134, 135, 136, 137, 147, 148, 149, 150, or 151, (c) an amino acid sequence of a carrier protein or a portion thereof, (d) an amino acid sequence that is at least 80% identical to the amino acid sequence of SEQ ID NOS: 34, 36, 73, 77, 81, 87, 89, 90, 91, 103, 104, 105, 106, 107, 108, 109, 110, 111, or 112, (e) an amino acid sequence of a signal sequence or a portion thereof, (f) an amino acid sequence that is at least 80% identical to the amino acid sequence of SEQ ID NOS: 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, or 54, (g) an amino acid sequence of a linker or a portion thereof, (h) an amino acid sequence at least 80% identical to the amino acid sequence of SEQ ID NOS: 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 152, or 172, (i) an amino acid sequence of a protease recognition site, (j) a protease recognition site selected from the group of amino acid sequences consisting of RR, KR, RRK, RRQ, RRW, RRE, LDKR, LDKREAEA, and KREAEA, (k) an amino acid sequence of a mating factor alpha (MF?) or a portion thereof, or (1) an amino acid sequence that is at least 80% identical to the amino acid sequence of SEQ ID NOS: 153, 154, 155, 156, or 157.
[0129] In some embodiments, the non-naturally occurring enzyme having CBDaS activity or the amino acid sequence of a CBDaS or a portion thereof comprises one or more of the following mutations when aligned with and in reference to SEQ ID NO: 136: N45Q, N65Q, S168N, N296Q, N304Q, N328Q, N498Q, T47S, T67S, S170T, T298S, T306S, S330T, or T500S.
[0130] In some embodiments, the non-naturally occurring enzyme having CBDaS activity or the amino acid sequence of a CBDaS or a portion thereof comprises one or more amino acid substitutions occurring at position(s) 29, 31, 43, 49, 53, 56, 57, 65, 71, 78, 79, 93, 95, 103, 117, 125, 129, 143, 147, 151, 161, 183, 213, 235, 241, 263, 264, 285, 286, 303, 314, 325, 336, 339, 396, 436, 518, or 540 when aligned with and in reference to SEQ ID NO: 137. In some embodiments, the one or more amino acid substitutions is selected from the group consisting of: N29G, R31T, P43D, L49D, R53T, N56D, N57D, P65D, L71D, L71S, N78D, N79D, L93D, G95A, V103Y, G117A, V125D, I129L, H143A, V147D, 1151L, W161R, W161A, W161N, W161S, W16IT, W161D, W161H, W183N, H213D, H213N, H235D, 1241V, 1263V, E264P, D285N, K303N, S314C, K325N, S336C, T339S, F396L, A436G, V518C, and V540C.
[0131] In some embodiments, the non-naturally occurring enzyme having CBDaS activity or the amino acid sequence of a CBDaS or a portion thereof comprises one or more amino acid substitutions selected from the group consisting of: [0132] a) R53T, N78D, V147D, H235D, I263V, K325N, and V540C; [0133] b) R53T, P65D, L71D, N79D, L93D, V147D, W183N, H235D, and S336C; [0134] c) L71D, N78D, G117A, V147D, W183N, I263V, K325N, S336C, and V540C; [0135] d) R53T, P65D, L71D, N78D, N79D, L93D, V147D, W183N, H235D, K325N, S336C, and V540C; [0136] e) L71D, L93D, V147D, H235D, and I263V; [0137] f) R53T, V147D, I151L, W183N, H235D, S336C, and V540C; [0138] g) R53T, N78D, N79D, G117A, V147D, and S336C; [0139] h) R53T, P65D, L71D, N79D, L93D, V147D, W183N, H235D, and S336C; [0140] i) R53T, L71D, N78D, G117A, V147D, H235D, S336C, and V540C; [0141] j) R53T, P65D, N78D, G117A, V147D, H235D, K325N, S336C, and V540C; [0142] k) R53T, P65D, N78D, L93D, V147D, W183N, H235D, and V540C; [0143] 1) R53T, N78D, V147D, W183N, H235D, 1263V, and S336C; [0144] m) R53T, N79D, V147D, W183N, H235D, I263V, K325N, and S336C; [0145] n) R53T, P65D, L71D, N78D, V147D, H235D, 1263V, S336C, and V540C; [0146] O) R53T, L71D, G117A, V147D, H235D, I263V, and V540C; [0147] p) R53T, L71D, N78D, G117A, V147D, H235D, 1263V, K325N, S336C, and V540C; [0148] q) R53T, P65D, N78D, N79D, V147D, S336C, and V540C; [0149] r) R53T, N78D, N79D, V147D, W183N, H235D, I263V, and K325N; [0150] S) R53T, I151L, H235D, K325N, and S336C; and [0151] t) R53T, P65D, L71D, N79D, L93D, V147D, W183N, H235D, and S336C, when aligned with and in reference to SEQ ID NO: 137.
[0152] In some embodiments, the non-naturally occurring enzyme comprises an amino acid sequence that is at least 80% identical to the amino acid sequence of any of the non-naturally occurring enzymes having CBDaS activity or to the amino acid sequence of a CBDaS or a portion thereof in the preceding paragraph.
[0153] In some embodiments, the disclosure features a non-naturally occurring nucleic acid encoding the non-naturally occurring enzyme having CBDaS activity of the preceding paragraphs.
Cannabinoid Biosynthetic Pathway
[0154] In an aspect, a host cell described herein includes one or more nucleic acids encoding one or more enzymes of a heterologous genetic pathway that produces a cannabinoid or a precursor of a cannabinoid. The cannabinoid biosynthetic pathway may begin with hexanoic acid as the substrate for an acyl activating enzyme (AAE) to produce hexanoyl-CoA, which is used by a tetraketide synthase (TKS) to produce tetraketide-CoA, which is used by an olivetolic acid cyclase (OAC) to produce olivetolic acid, which is used by a geranyl pyrophosphate (GPP) synthase and a cannabigerolic acid synthase (CBGaS) to produce a cannabigerolic acid (CBGa), which is used by a cannabidiolic acid synthase (CBDaS) to produce a cannabidiolic acid (CBDa). In some embodiments, CBGa or CBDa spontaneously decarboxylate, including upon heating, to form CBG and CBD, respectively. In some embodiments, the cannabinoid precursor that is produced is a substrate in the cannabinoid pathway (e.g., hexanoate or olivetolic acid). In some embodiments, the precursor is a substrate for an AAE, a TKS, an OAC, a CBGaS, a GPP synthase, a CBGaS, or a CBDaS. In some embodiments, the precursor, substrate, or intermediate in the cannabinoid pathway is hexanoate, olivetol, olivetolic acid, or CBGa. In some embodiments, the host cell does not contain the precursor, substrate or intermediate in an amount sufficient to produce the cannabinoid or a precursor of the cannabinoid. In some embodiments, the host cell does not contain hexanoate at a level or in an amount sufficient to produce the cannabinoid in an amount over 10 mg/L. In some embodiments, the heterologous genetic pathway encodes at least one enzyme selected from the group consisting of an AAE, a TKS, an OAC, a GPP synthase, a CBGaS, and a CBDaS. In some embodiments, the genetically modified host cell includes an AAE, TKS, OAC, a GPP synthase, a CBGaS, and a CBDaS.
[0155] The cannabinoid pathway, including the enzymes discussed in the following paragraphs, is described in U.S. Pat. No. 10,563,211, the disclosure of which is incorporated herein by reference.
[0156] In some embodiments, a host cell includes a heterologous acyl activating enzyme (AAE) such that the host cell is capable of producing a cannabinoid. The AAE may be from Cannabis sativa or may be an enzyme from another plant or fungal source which has been shown to have AAE activity in the cannabinoid biosynthetic pathway, resulting in the production of the cannabinoid precursor hexanoyl-CoA.
[0157] In some embodiments, a host cell includes a heterologous tetraketide synthase (TKS) such that the host cell is capable of producing a cannabinoid. A TKS uses the hexanoyl-CoA precursor to generate tetraketide-CoA. The TKS may be from Cannabis sativa or may be an enzyme from another plant, fungal, or bacterial source which has been shown to have TKS activity in the cannabinoid biosynthetic pathway, resulting in the production of the cannabinoid precursor tetraketide-CoA.
[0158] In some embodiments, a host cell includes a heterologous cannabigerolic acid synthase (CBGaS) such that the host cell is capable of producing a cannabinoid. A CBGaS uses the olivetolic acid precursor and geranyl pyrophosphate (GPP) precursor to generate cannabigerolic acid (CBGa). The CBGaS may be from Cannabis sativa or may be an enzyme from another plant, fungal, or bacterial source which has been shown to have CBGaS activity in the cannabinoid biosynthetic pathway, resulting in the production of the cannabinoid CBGa.
[0159] In some embodiments, a host cell includes a heterologous GPP synthase such that the host cell is capable of producing a cannabinoid. A GPP synthase uses the product of the isoprenoid biosynthesis pathway precursor to generate CBGa together with a prenyltransferase enzyme. The GPP synthase may be from Cannabis sativa or may be an enzyme from another plant, fungal, or bacterial source which has been shown to have GPP synthase activity in the cannabinoid biosynthetic pathway, resulting in the production of the cannabinoid CBGa.
[0160] In some embodiments, a host cell includes a heterologous CBDaS such that the host cell is capable of producing a cannabinoid. A CBDaS uses the CBGa precursor to generate CBDa. The CBDaS may be from Cannabis sativa or may be an enzyme from another plant, fungal, or bacterial source which has been shown to have CBDaS activity in the cannabinoid biosynthetic pathway, resulting in the production of the cannabinoid CBDa.
[0161] The host cell may further express other heterologous enzymes in addition to AAE, TKS, GPP synthase, CBGaS, and/or CBDaS. For example, in some embodiments, a host cell includes a heterologous olivetolic acid cyclase (OAC) such that the host cell is capable of producing a cannabinoid. An OAC uses the tetraketide-CoA precursor to generate olivetolic acid. The OAC may be from Cannabis sativa or may be an enzyme from another plant or fungal source which has been shown to have OAC activity in the cannabinoid biosynthetic pathway, resulting in the production of the cannabinoid precursor olivetolic acid. In some embodiments, the host cell may include a heterologous nucleic acid that encodes at least one enzyme from the mevalonate biosynthetic pathway. Enzymes which make up the mevalonate biosynthetic pathway may include but are not limited to an acetyl-CoA thiolase, a HMG-COA synthase, a HMG-COA reductase, a mevalonate kinase, a phosphomevalonate kinase, a mevalonate pyrophosphate decarboxylase, and an IPP: DMAPP isomerase. In some embodiments, the host cell includes a heterologous nucleic acid that encodes the acetyl-CoA thiolase, the HMG-COA synthase, the HMG-COA reductase, the mevalonate kinase, the phosphomevalonate kinase, the mevalonate pyrophosphate decarboxylase, and the IPP: DMAPP isomerase of the mevalonate biosynthesis pathway.
[0162] In some embodiments, the host cell may express heterologous enzymes of the central carbon metabolism. Enzymes of the central carbon metabolism may include an acetyl-CoA synthase, an aldehyde dehydrogenase, and a pyruvate decarboxylase. In some embodiments, the host cell includes heterologous nucleic acids that independently encode an acetyl-CoA synthase, and/or an aldehyde dehydrogenase, and/or a pyruvate decarboxylase. In some embodiments, the acetyl-CoA synthase and the aldehyde dehydrogenase from Saccharomyces cerevisiae, and the pyruvate decarboxylase from Zymomonas mobilis.
[0163] Due to the inherent degeneracy of the genetic code, other polynucleotides which encode substantially the same or functionally equivalent polypeptides can also be used to clone and express the polynucleotides encoding the protein components of the heterologous genetic pathway described herein.
[0164] As will be understood by those of skill in the art, it can be advantageous to modify a coding sequence to enhance its expression in a particular host. The genetic code is redundant with 64 possible codons, but most organisms typically use a subset of these codons more frequently. The codons that are utilized most often in a species are called optimal codons, and those not utilized very often are classified as rare or low-usage codons. Codons can be substituted to reflect the preferred codon usage of the host, in a process sometimes called codon optimization or controlling for species codon bias.
[0165] Optimized coding sequences containing codons preferred by a particular prokaryotic or eukaryotic host (Murray et al., 1989, Nucl Acids Res. 17:477-508) can be prepared, for example, to increase the rate of translation or to produce recombinant RNA transcripts having desirable properties, such as a longer half-life, as compared with transcripts produced from a non-optimized sequence. Translation stop codons can also be modified to reflect host preference. For example, typical stop codons for S. cerevisiae and mammals are UAA and UGA, respectively. The typical stop codon for monocotyledonous plants is UGA, whereas insects and E. coli commonly use UAA as the stop codon (Dalphin et al., 1996, Nucl Acids Res. 24:216-8).
[0166] Those of skill in the art will recognize that, due to the degenerate nature of the genetic code, a variety of DNA molecules differing in their nucleotide sequences can be used to encode a given enzyme of the disclosure. Any one of the polypeptide sequences disclosed herein may be encoded by DNA molecules of any sequence that encode the amino acid sequences of the polypeptides and proteins of the enzymes utilized in the methods of the disclosure. In a similar fashion, a polypeptide can typically tolerate one or more amino acid substitutions, deletions, and insertions in its amino acid sequence without loss or significant loss of a desired activity. The disclosure includes such polypeptides with different amino acid sequences than the specific proteins described herein so long as the modified or variant polypeptides have the enzymatic anabolic or catabolic activity of the reference polypeptide. Furthermore, the amino acid sequences encoded by the DNA sequences shown herein merely illustrate embodiments of the disclosure.
[0167] In addition, homologs of enzymes useful for the compositions and methods provided herein are encompassed by the disclosure. In some embodiments, two proteins (or a region of the proteins) can be considered homologous when the amino acid sequences have at least about 30%, 40%, 50% 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity. To determine the percent identity of two amino acid sequences, or of two nucleic acid sequences, the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second amino acid or nucleic acid sequence for optimal alignment and non-homologous sequences can be disregarded for comparison purposes). In one embodiment, the length of a reference sequence aligned for comparison purposes is at least 30%, typically at least 40%, more typically at least 50%, even more typically at least 60%, and even more typically at least 70%, 80%, 90%, 100% of the length of the reference sequence. The amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared. When a position in the first sequence is occupied by the same amino acid residue or nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position (as used herein amino acid or nucleic acid identity is equivalent to amino acid or nucleic acid homology). The percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences.
[0168] When homologous is used in reference to proteins or peptides, it is recognized that residue positions that are not identical often differ by conservative amino acid substitutions. A conservative amino acid substitution is one in which an amino acid residue is substituted by another amino acid residue having a side chain (R group) with similar chemical properties (e.g., charge or hydrophobicity). In general, a conservative amino acid substitution will not substantially change the functional properties of a protein. In cases where two or more amino acid sequences differ from each other by conservative substitutions, the percent sequence identity or degree of homology may be adjusted upwards to correct for the conservative nature of the substitution. Means for making this adjustment are well known to those of skill in the art (e.g., Pearson W. R., 1994, Methods in Mol Biol 25:365-89).
[0169] The following six groups each contain amino acids that are conservative substitutions for one another: 1) Serine(S), Threonine (T); 2) Aspartic Acid (D), Glutamic Acid (E); 3) Asparagine (N), Glutamine (Q); 4) Arginine (R), Lysine (K); 5) Isoleucine (I), Leucine (L), Alanine (A), Valine (V), and 6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W).
[0170] Sequence homology for polypeptides, which is also referred to as percent sequence identity, is typically measured using sequence analysis software. A typical algorithm used for comparing a molecule sequence to a database containing a large number of sequences from different organisms is the computer algorithm BLAST. When searching a database containing sequences from a large number of different organisms, it is typical to compare amino acid sequences.
[0171] Furthermore, any of the genes encoding the foregoing enzymes (or any others mentioned herein (or any of the regulatory elements that control or modulate expression thereof)) may be optimized by genetic/protein engineering techniques, such as directed evolution or rational mutagenesis, which are known to those of ordinary skill in the art. Such action allows those of ordinary skill in the art to optimize the enzymes for expression and activity in a host cell, for example, a yeast.
[0172] In addition, genes encoding these enzymes can be identified from other fungal and bacterial species and can be expressed in the host cell. A variety of organisms could serve as sources for these enzymes, including, but not limited to, Saccharomyces spp., including S. cerevisiae and S. uvarum, Kluyveromyces spp., including K. thermotolerans, K. lactis, and K. marxianus, Pichia spp., Hansenula spp., including H. polymorphs, Candida spp., Trichosporon spp., Yamadazyma spp., including Y. stipitis, Torulaspora pretoriensis, Issatchenkia orientalis, Schizosaccharomyces spp., including S. pombe, Cryptococcus spp., Aspergillus spp., Neurospora spp., or Ustilago spp. Sources of genes from anaerobic fungi include, but are not limited to, Piromyces spp., Orpinomyces spp., or Neocallimastix spp. Sources of prokaryotic enzymes that are useful include, but are not limited to, Escherichia coli, Zymomonas mobilis, Staphylococcus aureus, Bacillus spp., Clostridium spp., Corynebacterium spp., Pseudomonas spp., Lactococcus spp., Enterobacter spp., and Salmonella spp.
[0173] Techniques known to those skilled in the art may be suitable to identify additional homologous genes and homologous enzymes. Generally, analogous genes and/or analogous enzymes can be identified by functional analysis and will have functional similarities. Techniques known to those skilled in the art may be suitable to identify analogous genes and analogous enzymes. For example, to identify homologous or analogous kinase genes, proteins, or enzymes, techniques may include, but are not limited to, cloning a gene by PCR using primers based on a published sequence of a kinase gene/enzyme or by degenerate PCR using degenerate primers designed to amplify a conserved region among kinase genes. Further, one skilled in the art can use techniques to identify homologous or analogous genes, proteins, or enzymes with functional homology or similarity. Techniques include examining a cell or cell culture for the catalytic activity of an enzyme through in vitro enzyme assays for said activity (e.g. as described herein or in Kiritani, K., Branched-Chain Amino Acids Methods Enzymology, 1970), then isolating the enzyme with said activity through purification, determining the protein sequence of the enzyme through techniques such as Edman degradation, design of PCR primers to the likely nucleic acid sequence, amplification of said DNA sequence through PCR, and cloning of said nucleic acid sequence. To identify homologous or similar genes and/or homologous or similar enzymes, analogous genes and/or analogous enzymes or proteins, techniques also include comparison of data concerning a candidate gene or enzyme with databases such as BRENDA, KEGG, JGI Phyzome v12.1, BLAST, NCBI RefSeq, UniProt KB, or MetaCYC Protein annotations in the UniProt Knowledgebase may also be used to identify enzymes which have a similar function in addition to the National Center for Biotechnology Information RefSeq database. The candidate gene or enzyme may be identified within the above-mentioned databases in accordance with the teachings herein.
Modified Host Cells
[0174] In one aspect, provided herein are host cells comprising at least one enzyme of the cannabinoid biosynthetic pathway. In some embodiments, the cannabinoid biosynthetic pathway contains a genetic regulatory element, such as a nucleic acid sequence, that is regulated by an exogenous agent. In some embodiments, the exogenous agent acts to regulate expression of the heterologous genetic pathway. Thus, in some embodiments, the exogenous agent can be a regulator of gene expression.
[0175] In some embodiments, the exogenous agent can be used as a carbon source by the host cell. For example, the same exogenous agent can both regulate production of a cannabinoid and provide a carbon source for growth of the host cell. In some embodiments, the exogenous agent is galactose. In some embodiments, the exogenous agent is maltose.
[0176] In some embodiments, the genetic regulatory element is a nucleic acid sequence, such as a promoter.
[0177] In some embodiments, the genetic regulatory element is a galactose-responsive promoter. In some embodiments, galactose positively regulates expression of the cannabinoid biosynthetic pathway, thereby increasing production of the cannabinoid. In some embodiments, the galactose-responsive promoter is a GAL1 promoter. In some embodiments, the galactose-responsive promoter is a GAL10 promoter. In some embodiments, the galactose-responsive promoter is a GAL2, GAL3, or GAL7 promoter. In some embodiments, heterologous genetic pathway contains the galactose-responsive regulatory elements described in Westfall et al. (PNAS (2012) vol. 109: E111-118). In some embodiments, the host cell lacks the gall gene and is unable to metabolize galactose, but galactose can still induce galactose-regulated genes.
TABLE-US-00001 TABLE A Exemplary GAL Promoter Sequences Promoter Sequence pGAL1 SEQ ID NO: 158 pGAL10 SEQ ID NO: 159 pGAL2 SEQ ID NO: 160 pGAL3 SEQ ID NO: 161 pGAL7 SEQ ID NO: 162 pGAL4 SEQ ID NO: 163
[0178] In some embodiments, the galactose regulation system used to control expression of one or more enzymes of the cannabinoid biosynthetic pathway is re-configured such that it is no longer induced by the presence of galactose. Instead, the gene of interest will be expressed unless repressors, which may be maltose in some strains, are present in the medium.
[0179] In some embodiments, the genetic regulatory element is a maltose-responsive promoter. In some embodiments, maltose negatively regulates expression of the cannabinoid biosynthetic pathway, thereby decreasing production of the cannabinoid. In some embodiments, the maltose-responsive promoter is selected from the group consisting of pMAL1, pMAL2, pMAL11, pMAL12, pMAL31 and pMAL32. The maltose genetic regulatory element can be designed to both activate expression of some genes and repress expression of others, depending on whether maltose is present or absent in the medium. Maltose regulation of gene expression and maltose-responsive promoters are described in U.S. Pat. No. 10,563,229, which is hereby incorporated by reference. Genetic regulation of maltose metabolism is described in Novak et al., Maltose Transport and Metabolism in S. cerevisiae, Food Technol. Biotechnol. 42 (3) 213-218 (2004).
TABLE-US-00002 TABLE B Exemplary MAL Promoter Sequences Promoter Sequence pMAL1 SEQ ID NO: 164 pMAL2 SEQ ID NO: 165 pMAL11 SEQ ID NO: 166 pMAL12 SEQ ID NO: 167 pMAL31 SEQ ID NO: 168 pMAL32 SEQ ID NO: 169
[0180] In some embodiments, the heterologous genetic pathway is regulated by a combination of the maltose and galactose regulons.
[0181] In some embodiments, the recombinant host cell does not contain, or expresses a very low level of (for example, an undetectable amount), a precursor (e.g., hexanoate) required to make the cannabinoid. In some embodiments, the precursor (e.g., hexanoate) is a substrate of an enzyme in the cannabinoid biosynthetic pathway.
Yeast Strains
[0182] In some embodiments, yeast strains useful in the present methods include yeasts that have been deposited with microorganism depositories (e.g. IFO, ATCC, etc.) and belong to the genera Aciculoconidium, Ambrosiozyma, Arthroascus, Arxiozyma, Ashbya, Babjevia, Bensingtonia, Botryoascus, Botryozyma, Brettanomyces, Bullera, Bulleromyces, Candida, Citeromyces, Clavispora, Cryptococcus, Cystofilobasidium, Debaryomyces, Dekkara, Dipodascopsis, Dipodascus, Eeniella, Endomycopsella, Eremascus, Eremothecium, Erythrobasidium, Fellomyces, Filobasidium, Galactomyces, Geotrichum, Guilliermondella, Hanseniaspora, Hansenula, Hasegawaea, Holtermannia, Hormoascus, Hyphopichia, Issatchenkia, Kloeckera, Kloeckeraspora, Kluyveromyces, Kondoa, Kuraishia, Kurtzmanomyces, Leucosporidium, Lipomyces, Lodderomyces, Malassezia, Metschnikowia, Mrakia, Myxozyma, Nadsonia, Nakazawaea, Nematospora, Ogataea, Oosporidium, Pachysolen, Phachytichospora, Phaffia, Pichia, Rhodosporidium, Rhodotorula, Saccharomyces, Saccharomycodes, Saccharomycopsis, Saitoella, Sakaguchia, Saturnospora, Schizoblastosporion, chizosaccharomyces, Schwanniomyces, Sporidiobolus, Sporobolomyces, Sporopachydermia, Stephanoascus, Sterigmatomyces, Sterigmatosporidium, Symbiotaphrina, Sympodiomyces, Sympodiomycopsis, Torulaspora, Trichosporiella, Trichosporon, Trigonopsis, Tsuchiyaea, Udeniomyces, Waltomyces, Wickerhamia, Wickerhamiella, Williopsis, Yamadazyma, Yarrowia, Zygoascus, Zygosaccharomyces, Zygowilliopsis, and Zygozyma, among others.
[0183] In some embodiments, the strain is Saccharomyces cerevisiae, Pichia pastoris, Schizosaccharomyces pombe, Dekkera bruxellensis, Kluyveromyces lactis (previously called Saccharomyces lactis), Kluveromyces marxianus, Arxula adeninivorans, or Hansenula polymorphs (now known as Pichia angusta). In some embodiments, the host microbe is a strain of the genus Candida, such as Candida lipolytica, Candida guilliermondii, Candida krusei, Candida pseudotropicalis, or Candida utilis.
[0184] In a particular embodiment, the strain is Saccharomyces cerevisiae. In some embodiments, the host is a strain of Saccharomyces cerevisiae selected from the group consisting of Baker's yeast, CEN.PK, CEN.PK2, CBS 7959, CBS 7960, CBS 7961, CBS 7962, CBS 7963, CBS 7964, IZ-1904, TA, BG-1, CR-1, SA-1, M-26, Y-904, PE-2, PE-5, VR-1, BR-1, BR-2, ME-2, VR-2, MA-3, MA-4, CAT-1, CB-1, NR-1, BT-1, and AL-1. In some embodiments, the strain of Saccharomyces cerevisiae is CEN.PK.
[0185] In some embodiments, the strain is a microbe that is suitable for industrial fermentation. In particular embodiments, the microbe is conditioned to subsist under high solvent concentration, high temperature, expanded substrate utilization, nutrient limitation, osmotic stress due to sugar and salts, acidity, sulfite and bacterial contamination, or combinations thereof, which are recognized stress conditions of the industrial fermentation environment.
Methods of Making the Host Cells
[0186] In another aspect, provided are methods of making the modified host cells described herein. In some embodiments, the methods include transforming a host cell with the heterologous nucleic acid constructs described herein which encode the proteins expressed by a heterologous genetic pathway described herein. Methods for transforming host cells are described in Laboratory Methods in Enzymology: DNA, edited by Jon Lorsch, Volume 529, (2013); and U.S. Pat. No. 9,200,270 to Hsieh, Chung-Ming, et al., and references cited therein.
Methods for Producing a Cannabinoid
[0187] In another aspect, methods are provided for producing a cannabinoid are described herein. In some embodiments, the method decreases expression of the cannabinoid. In some embodiments, the method includes culturing a host cell comprising at least one enzyme of the cannabinoid biosynthetic pathway described herein in a medium comprising an exogenous agent, wherein the exogenous agent decreases the expression of the cannabinoid. In some embodiments, the exogenous agent is maltose. In some embodiments, the exogenous agent is maltose. In some embodiments, the method results in less than 0.001 mg/L of cannabinoid or a precursor thereof.
[0188] In some embodiments, the method is for decreasing expression of a cannabinoid or precursor thereof. In some embodiments, the method includes culturing a host cell comprising an AAE, and/or a TKS, and/or a CBGaS, and/or a GPP synthase, and/or CBDaS described herein in a medium comprising an exogenous agent, wherein the exogenous agent decreases the expression of the cannabinoid. In some embodiments, the exogenous agent is maltose. In some embodiments, the exogenous agent is maltose. In some embodiments, the method results in the production of less than 0.001 mg/L of a cannabinoid or a precursor thereof.
[0189] In some embodiments, the method increases the expression of a cannabinoid. In some embodiments, the method includes culturing a host cell comprising an AAE, and/or a TKS, and/or a CBGaS, and/or a GPP synthase, and/or CBDaS described herein in a medium comprising the exogenous agent, wherein the exogenous agent increases expression of the cannabinoid. In some embodiments, the exogenous agent is galactose. In some embodiments, the method further includes culturing the host cell with the precursor or substrate required to make the cannabinoid.
[0190] In some embodiments, the method increases the expression of a cannabinoid product or precursor thereof. In some embodiments, the method includes culturing a host cell comprising a heterologous cannabinoid pathway described herein in a medium comprising an exogenous agent, wherein the exogenous agent increases the expression of the cannabinoid or a precursor thereof. In some embodiments, the exogenous agent is galactose. In some embodiments, the method further includes culturing the host cell with a precursor or substrate required to make the cannabinoid or precursor thereof. In some embodiments, the precursor required to make the cannabinoid or precursor thereof is hexanoate. In some embodiments, the combination of the exogenous agent and the precursor or substrate required to make the cannabinoid or precursor thereof produces a higher yield of cannabinoid than the exogenous agent alone.
[0191] In some embodiments, the cannabinoid or a precursor thereof is cannabidiolic acid (CBDa), cannabidiol (CBD), cannabigerolic acid (CBGa), or cannabigerol (CBG).
Culture and Fermentation Methods
[0192] Materials and methods for the maintenance and growth of microbial cultures are well known to those skilled in the art of microbiology or fermentation science (see, for example, Bailey et al., Biochemical Engineering Fundamentals, second edition, McGraw Hill, New York, 1986). Consideration must be given to appropriate culture medium, pH, temperature, and requirements for aerobic, microaerobic, or anaerobic conditions, depending on the specific requirements of the host cell, the fermentation, and the process.
[0193] The methods of producing cannabinoids provided herein may be performed in a suitable culture medium in a suitable container, including but not limited to a cell culture plate, a flask, or a fermentor. Further, the methods can be performed at any scale of fermentation known in the art to support industrial production of microbial products. Any suitable fermentor may be used including a stirred tank fermentor, an airlift fermentor, a bubble fermentor, or any combination thereof. In particular embodiments utilizing Saccharomyces cerevisiae as the host cell, strains can be grown in a fermentor as described in detail by Kosaric, et al, in Ullmann's Encyclopedia of Industrial Chemistry, Sixth Edition, Volume 12, pages 398-473, Wiley-VCH Verlag GmbH & Co. KDaA, Weinheim, Germany.
[0194] In some embodiments, the culture medium is any culture medium in which a genetically modified microorganism capable of producing a heterologous product can subsist, i.e., maintain growth and viability. In some embodiments, the culture medium is an aqueous medium comprising assimilable carbon, nitrogen and phosphate sources. Such a medium can also include appropriate salts, minerals, metals, and other nutrients. In some embodiments, the carbon source and each of the essential cell nutrients are added incrementally or continuously to the fermentation medium, and each required nutrient is maintained at essentially the minimum level needed for efficient assimilation by growing cells, for example, in accordance with a predetermined cell growth curve based on the metabolic or respiratory function of the cells which convert the carbon source to a biomass.
[0195] Suitable conditions and suitable medium for culturing microorganisms are well known in the art. In some embodiments, the suitable medium is supplemented with one or more additional agents, such as, for example, an inducer (e.g., when one or more nucleotide sequences encoding a gene product are under the control of an inducible promoter), a repressor (e.g., when one or more nucleotide sequences encoding a gene product are under the control of a repressible promoter), or a selection agent (e.g., an antibiotic to select for microorganisms comprising the genetic modifications).
[0196] In some embodiments, the carbon source is a monosaccharide (simple sugar), a disaccharide, a polysaccharide, a non-fermentable carbon source, or one or more combinations thereof. Non-limiting examples of suitable monosaccharides include glucose, galactose, mannose, fructose, ribose, and combinations thereof. Non-limiting examples of suitable disaccharides include sucrose, lactose, maltose, trehalose, cellobiose, and combinations thereof. Non-limiting examples of suitable polysaccharides include starch, glycogen, cellulose, chitin, and combinations thereof. Non-limiting examples of suitable non-fermentable carbon sources include acetate and glycerol.
[0197] The concentration of a carbon source, such as glucose or sucrose, in the culture medium should promote cell growth, but not be so high as to repress growth of the microorganism used. Typically, cultures are run with a carbon source, such as glucose or sucrose, being added at levels to achieve the desired level of growth and biomass. Production of cannabinoids may also occur in these culture conditions, but at undetectable levels (with detection limits being about <0.1 g/l). In other embodiments, the concentration of a carbon source, such as glucose or sucrose, in the culture medium is greater than about 1 g/L, preferably greater than about 2 g/L, and more preferably greater than about 5 g/L. In addition, the concentration of a carbon source, such as glucose or sucrose, in the culture medium is typically less than about 100 g/L, preferably less than about 50 g/L, and more preferably less than about 20 g/L. It should be noted that references to culture component concentrations can refer to both initial and/or ongoing component concentrations. In some cases, it may be desirable to allow the culture medium to become depleted of a carbon source during culture.
[0198] Sources of assimilable nitrogen that can be used in a suitable culture medium include, but are not limited to, simple nitrogen sources, organic nitrogen sources and complex nitrogen sources. Such nitrogen sources include anhydrous ammonia, ammonium salts and substances of animal, vegetable and/or microbial origin. Suitable nitrogen sources include, but are not limited to, protein hydrolysates, microbial biomass hydrolysates, peptone, yeast extract, ammonium sulfate, urea, and amino acids. Typically, the concentration of the nitrogen sources, in the culture medium is greater than about 0.1 g/L, preferably greater than about 0.25 g/L, and more preferably greater than about 1.0 g/L. Beyond certain concentrations, however, the addition of a nitrogen source to the culture medium is not advantageous for the growth of the microorganisms. As a result, the concentration of the nitrogen sources, in the culture medium is less than about 20 g/L, preferably less than about 10 g/L and more preferably less than about 5 g/L. Further, in some instances it may be desirable to allow the culture medium to become depleted of the nitrogen sources during culture.
[0199] The effective culture medium can contain other compounds such as inorganic salts, vitamins, trace metals, or growth promoters. Such other compounds can also be present in carbon, nitrogen, or mineral sources in the effective medium or can be added specifically to the medium.
[0200] The culture medium can also contain a suitable phosphate source. Such phosphate sources include both inorganic and organic phosphate sources. Preferred phosphate sources include, but are not limited to, phosphate salts such as mono or dibasic sodium and potassium phosphates, ammonium phosphate, and mixtures thereof. Typically, the concentration of phosphate in the culture medium is greater than about 1.0 g/L, preferably greater than about 2.0 g/L, and more preferably greater than about 5.0 g/L. Beyond certain concentrations, however, the addition of phosphate to the culture medium is not advantageous for the growth of the microorganisms. Accordingly, the concentration of phosphate in the culture medium is typically less than about 20 g/L, preferably less than about 15 g/L, and more preferably less than about 10 g/L.
[0201] A suitable culture medium can also include a source of magnesium, preferably in the form of a physiologically acceptable salt, such as magnesium sulfate heptahydrate, although other magnesium sources in concentrations that contribute similar amounts of magnesium can be used. Typically, the concentration of magnesium in the culture medium is greater than about 0.5 g/L, preferably greater than about 1.0 g/L, and more preferably greater than about 2.0 g/L. Beyond certain concentrations, however, the addition of magnesium to the culture medium is not advantageous for the growth of the microorganisms. Accordingly, the concentration of magnesium in the culture medium is typically less than about 10 g/L, preferably less than about 5 g/L, and more preferably less than about 3 g/L. Further, in some instances, it may be desirable to allow the culture medium to become depleted of a magnesium source during culture.
[0202] In some embodiments, the culture medium can also include a biologically acceptable chelating agent, such as the dihydrate of trisodium citrate. In such instance, the concentration of a chelating agent in the culture medium is greater than about 0.2 g/L, preferably greater than about 0.5 g/L, and more preferably greater than about 1 g/L. Beyond certain concentrations, however, the addition of a chelating agent to the culture medium is not advantageous for the growth of the microorganisms. Accordingly, the concentration of a chelating agent in the culture medium is typically less than about 10 g/L, preferably less than about 5 g/L, and more preferably less than about 2 g/L.
[0203] The culture medium can also initially include a biologically acceptable acid or base to maintain the desired pH of the culture medium. Biologically acceptable acids include, but are not limited to, hydrochloric acid, sulfuric acid, nitric acid, phosphoric acid, and mixtures thereof. Biologically acceptable bases include, but are not limited to, ammonium hydroxide, sodium hydroxide, potassium hydroxide, and mixtures thereof. In some embodiments, the base used is ammonium hydroxide.
[0204] The culture medium can also include a biologically acceptable calcium source, including, but not limited to, calcium chloride. Typically, the concentration of the calcium source, such as calcium chloride, dihydrate, in the culture medium is within the range of from about 5 mg/L to about 2000 mg/L, preferably within the range of from about 20 mg/L to about 1000 mg/L, and more preferably in the range of from about 50 mg/L to about 500 mg/L.
[0205] The culture medium can also include sodium chloride. Typically, the concentration of sodium chloride in the culture medium is within the range of from about 0.1 g/L to about 5 g/L, preferably within the range of from about 1 g/L to about 4 g/L, and more preferably in the range of from about 2 g/L to about 4 g/L.
[0206] In some embodiments, the culture medium can also include trace metals. Such trace metals can be added to the culture medium as a stock solution that, for convenience, can be prepared separately from the rest of the culture medium. Typically, the amount of such a trace metals solution added to the culture medium is greater than about 1 mL/L, preferably greater than about 5 mL/L, and more preferably greater than about 10 mL/L. Beyond certain concentrations, however, the addition of a trace metals to the culture medium is not advantageous for the growth of the microorganisms. Accordingly, the amount of such a trace metals solution added to the culture medium is typically less than about 100 mL/L, preferably less than about 50 mL/L, and more preferably less than about 30 mL/L. It should be noted that, in addition to adding trace metals in a stock solution, the individual components can be added separately, each within ranges corresponding independently to the amounts of the components dictated by the above ranges of the trace metals solution.
[0207] The culture medium can include other vitamins, such as pantothenate, biotin, calcium, pantothenate, inositol, pyridoxine-HCl, and thiamine-HCl. Such vitamins can be added to the culture medium as a stock solution that, for convenience, can be prepared separately from the rest of the culture medium. Beyond certain concentrations, however, the addition of vitamins to the culture medium is not advantageous for the growth of the microorganisms.
[0208] The culture medium may be supplemented with hexanoic acid or hexanoate as a precursor for the cannabinoid biosynthetic pathway. The hexanoic acid may have a concentration of less than 3 mM hexanoic acid (e.g., from 1 nM to 2.9 mM hexanoic acid, from 10 nM to 2.9 mM hexanoic acid, from 100 nM to 2.9 mM hexanoic acid, or from 1 ?M to 2.9 mM hexanoic acid) hexanoic acid.
[0209] The fermentation methods described herein can be performed in conventional culture modes, which include, but are not limited to, batch, fed-batch, cell recycle, continuous and semi-continuous. In some embodiments, the fermentation is carried out in fed-batch mode. In such a case, some of the components of the medium are depleted during culture, including pantothenate during the production stage of the fermentation. In some embodiments, the culture may be supplemented with relatively high concentrations of such components at the outset, for example, of the production stage, so that growth and/or production is supported for a period of time before additions are required. The preferred ranges of these components are maintained throughout the culture by making additions as levels are depleted by culture. Levels of components in the culture medium can be monitored by, for example, sampling the culture medium periodically and assaying for concentrations. Alternatively, once a standard culture procedure is developed, additions can be made at timed intervals corresponding to known levels at particular times throughout the culture. As will be recognized by those in the art, the rate of consumption of nutrient increases during culture as the cell density of the medium increases. Moreover, to avoid introduction of foreign microorganisms into the culture medium, addition is performed using aseptic addition methods, as are known in the art. In addition, a small amount of anti-foaming agent may be added during the culture.
[0210] The temperature of the culture medium can be any temperature suitable for growth of the genetically modified cells and/or production of compounds of interest. For example, prior to inoculation of the culture medium with an inoculum, the culture medium can be brought to and maintained at a temperature in the range of from about 20? C. to about 45? C., preferably to a temperature in the range of from about 25? C. to about 40? C. and more preferably in the range of from about 28? C. to about 32? C.
[0211] The pH of the culture medium can be controlled by the addition of acid or base to the culture medium. In such cases when ammonia is used to control pH, it also conveniently serves as a nitrogen source in the culture medium. Preferably, the pH is maintained from about 3.0 to about 8.0, more preferably from about 3.5 to about 7.0, and most preferably from about 4.0 to about 6.5.
[0212] In some embodiments, the carbon source concentration, such as the glucose concentration, of the culture medium is monitored during culture. Glucose or sucrose concentration of the culture medium can be monitored using known techniques, such as, for example, use of the glucose oxidase enzyme test or high pressure liquid chromatography, which can be used to monitor glucose concentration in the supernatant, e.g., a cell-free component of the culture medium. As stated previously, the carbon source concentration should be kept below the level at which cell growth inhibition occurs. Although such concentration may vary from organism to organism, for glucose as a carbon source, cell growth inhibition occurs at glucose concentrations greater than at about 60 g/L and can be determined readily by trial. Accordingly, when glucose is used as a carbon source the glucose is preferably fed to the fermenter and maintained in the range of from about 1 g/L to about 100 g/L, more preferably in the range of from about 2 g/L to about 50 g/L, and yet more preferably in the range of from about 5 g/L to about 20 g/L. Alternatively, the glucose concentration in the culture medium is maintained below detection limits. Although the carbon source concentration can be maintained within desired levels by addition of, for example, a substantially pure glucose solution, it is acceptable, and may be preferred, to maintain the carbon source concentration of the culture medium by addition of aliquots of the original culture medium. The use of aliquots of the original culture medium may be desirable because the concentrations of other nutrients in the medium (e.g. the nitrogen and phosphate sources) can be maintained simultaneously. Likewise, the trace metals concentrations can be maintained in the culture medium by addition of aliquots of the trace metals solution.
Examples
[0213] The following examples are put forth to provide those of ordinary skill in the art with a description of how the compositions and methods described herein may be used, made, and evaluated, and are intended to be purely exemplary of the invention and are not intended to limit the scope of what the inventors regard as their invention.
Example 1: Transformation of Heterologous Nucleic Acids into Yeast Cells
[0214] Each DNA construct was integrated into Saccharomyces cerevisiae (CEN.PK113-7D) using standard molecular biology techniques in an optimized lithium acetate transformation. Briefly, cells were grown overnight in yeast extract peptone dextrose (YPD) medium at 30? C. with shaking (200 rpm), diluted to an OD600 of 0.1 in 100 mL YPD, and grown to an OD600 of 0.6-0.8. For each transformation, 5 mL of culture were harvested by centrifugation, washed in 5 mL of sterile water, spun down again, resuspended in 1 mL of 100 mM lithium acetate, and transferred to a microcentrifuge tube. Cells were spun down (13,000? g) for 30 s, the supernatant was removed, and the cells were resuspended in a transformation mix consisting of 240 ?L 50% PEG, 36 ?L 1 M lithium acetate, 10 ?L boiled salmon sperm DNA, and 74 ?L of donor DNA. For transformations that required expression of the endonuclease F-Cph1, the donor DNA included a plasmid carrying the F-CphI gene expressed under the yeast TDH3 promoter. F-CphI endonuclease expressed in such a manner cuts a specific recognition site engineered in a host strain to facilitate integration of the target gene of interest. Following a heat shock at 42? C. for 40 min, cells were recovered overnight in YPD medium before plating on selective medium. When applicable, DNA integration was confirmed by colony PCR with primers specific to the integrations.
Example 2: Culturing of Yeast
[0215] For routine strain characterization in a 96-well-plate format, yeast colonies were picked into a 1.1-mL-per-well capacity 96-well Pre-Culture plate filled with 360 ?L per well of pre-culture medium. Pre-culture medium consisted of Bird Seed Media (BSM, originally described by van Hoek et al., Biotech. and Bioengin., 68, 2000, 517-23) at pH 5.05 with 14 g/L sucrose, 7 g/L maltose, 3.75 g/L ammonium sulfate, and 1 g/L lysine. Cells were cultured at 28? C. in a high capacity microtiter plate incubator shaking at 1000 rpm and 80% humidity for 3 days until the cultures reached carbon exhaustion.
[0216] The growth-saturated cultures were sub-cultured by taking 14.4 ?L from the saturated cultures and diluting into a 2.2 mL per well capacity 96-well production plate filled with 360 ?L per well of production medium. Production medium consisted of BSM at pH 5.05 with 40 g/L sucrose, 3.75 g/L ammonium sulfate, and 2 mM hexanoic acid. Cells in the production medium were cultured at 30? C. in a high capacity microtiter plate shaker at 1000 rpm and 80% humidity for an additional 3 days prior to extraction and analysis.
Example 3: Analytical Methods for Product Extraction and Titer Determination
[0217] Samples for olivetolic acid and cannabinoid measurements were initially analyzed in high-throughput by mass spectrometer (Agilent 6470-QQQ) with a RapidFire 365 system autosampler with C4 cartridge.
TABLE-US-00003 TABLE 1 RapidFire 365 System Configuration Pump 1: 0.1% acetic acid in water 0.8 mL/min Pump 2: 0.1% formic acid in acetonitrile 1.5 mL/min Pump 3: 0.1% formic acid in 40% acetone in water 0.8 mL/min State 1: Aspirate 600 ms State 2: Load/Wash 2000 m State 3: Extra wash 500 ms State 4: Elute 6000 ms State 5: Reequilibrate 1000 ms
TABLE-US-00004 TABLE 2 6470-QQQ MS Method Configuration Ion Source AJS ESI Time Filtering peak width 0.02 min Stop Time No limit/as pump Scan Type MRM Diverter Valve To MS Delta EMV (+)0/(?)0 Ion Mode (polarity) Negative Gas Temp 300? C. Gas Flow 13 L/min Nebulizer 30 psi Sheath Gas Temp 30? C. Sheath Gas Flow 12 L/min Negative Capillary V 3500 V
[0218] The peak areas from a chromatogram from a mass spectrometer were used to generate the calibration curve using authentic standards. The amount in moles of each compound were generated through external calibration using an authentic standard.
[0219] Hit samples from the initial screen were then analyzed for HTAL, PDAL, olivetol, olivetolic acid, CBGa, and CBDa on a weight per volume basis, by the method below. All measurements were performed by reverse phase ultra-high pressure liquid chromatography and ultraviolet detection (UPLC-UV) using Thermo Vanquish Flex Binary UHPLC System with a Vanquish Diode Array Detector HL.
TABLE-US-00005 TABLE 3 Mobile Phases and Column Information Mobile Phase A: 99.9% water + 0.1% Formic Acid, 5 mM ammonium formate Mobile Phase B: 99.9% acetonitrile + 0.1% Formic acid Column Thermo Scientific Accucore Polar Premium C18 100 mm ? 2.1 mm ? 2.6 um, Thermo P/N 28026-103030 Guard Column Thermo Scientific Guard Cartridge, 4 PK, P/N 28103014001 Guard Column holder Uniguard Holder, ThermoFisher, 4.0-4.6 mm, P/N 850-00
TABLE-US-00006 TABLE 4 Gradient Method Time Flow [mL/min] % A % B Curve 0.00 1.2 70 30 5 1.00 1.2 20 80 5 1.75 1.2 12.5 87.5 5 1.80 1.2 70 30 5 2.1 1.2 70 30 5
TABLE-US-00007 TABLE 5 Autosampler Parameters Draw speed 2.00 ul/s Dispense speed 5.00 ul/s Injection wash mode Both (before and after draw) Injection wash time 5.0 s Injection wash speed 10.0 ul/s Sample puncture - puncture offset 0 um Temperature control 8 C.
TABLE-US-00008 TABLE 6 Column Compartment Settings Temperature control On Temperature 50.0 C. Ready temp delta 0.50 C. Equilibration time 1.0 min Thermostatting mode Still air Fan Speed 5
TABLE-US-00009 TABLE 7 Detector Settings UV-Vis Channel 1 Wavelength 270 nm Data collection rate 50.0 Hz Response time 0.010 s Peak width 0.100 min
[0220] Analytes were identified by retention time compared to an authentic standard. The peak areas were used to generate the linear calibration curve for each analyte. At the conclusion of the incubation of the production plate, methanol was added to each well such that the final concentration was 67% (v/v) methanol. An impermeable seal was added, and the plate was shaken at 1000 rpm for 30 seconds to lyse the cells and extract cannabinoids. The plate was centrifuged for 30 seconds at 200? g to pellet cell debris. 300 ?L of the clarified sample was moved to an empty 1.1-mL-capacity 96-well plate and sealed with a foil seal. The sample plate was stored at ?20? C. until analysis.
Example 4: Generation of a CBGa-Production Base Strain for CBDaS Screening
[0221] To screen for cannabidiolic acid (CBDa) production, a cannabigerolic acid (CBGa) production strain was constructed, as CBGa and molecular oxygen are the two substrates necessary for CBDa production. CBDa synthase (CBDaS) test constructs were then integrated into the CBGa production strain in a high-throughput fashion and screened for CBDa production.
[0222] A CBGa production strain was created from the maltose-switchable Saccharomyces cerevisiae strain mentioned above by expressing the genes of the mevalonate pathway under the control of native GAL promoters. This strain comprised the following chromosomally integrated mevalonate pathway genes from S. cerevisiae: acetyl-CoA thiolase (ERG10), HMG-COA synthase (ERG13), HMG-COA reductase (HMGR), mevalonate kinase (ERG12), phosphomevalonate kinase (ERG8), mevalonate pyrophosphate decarboxylase (MVD1), and IPP: DMAPP isomerase (IDI1). In addition, the strain contained copies of five heterologous enzymes involved in the cannabinoid biosynthetic pathway (
[0223] In order to screen the library of candidate genes for CBDaS activity, a landing pad approach was utilized (
Example 5: Identification of High-Performing CBDaS Natural Diversity Variants
[0224] CBDaS enzymes (SEQ ID NO: 1) was used as the reference sequence. The PEP4 signal sequence from Komagataella pastoris (SEQ ID NO: 2) was fused to twelve versions of the CBDaS reference, each having different N-terminal truncations that removed the native Cannibis signal sequence (
TABLE-US-00010 TABLE 8 Reference CBDaS Truncation Series Fused with Komagataella pastoris PEP4 Signal Sequence CBDa titer Truncation relative to N-terminal ID Trunc. 8 truncation (#aa) CBDaS SeqID Trunc. 1 0.00 ?1-20 SEQ ID NO: 3 Trunc. 2 0.33 ?1-21 SEQ ID NO: 4 Trunc. 3 0.00 ?1-22 SEQ ID NO: 5 Trunc. 4 0.00 ?1-23 SEQ ID NO: 6 Trunc. 5 0.98 ?1-25 SEQ ID NO: 7 Trunc. 6 0.92 ?1-26 SEQ ID NO: 8 Trunc. 7 0.72 ?1-27 SEQ ID NO: 9 Trunc. 8 1.00 ?1-28 SEQ ID NO: 10 Trunc. 9 0.67 ?1-29 SEQ ID NO: 11 Trunc. 10 0.00 ?1-30 SEQ ID NO: 12 Trunc. 11 0.97 ?1-31 SEQ ID NO: 13 Trunc. 12 0.00 ?1-32 SEQ ID NO: 14
[0225] The reference CBDaS was used as a BLAST query for UniParc. Nine additional naturally occurring CBDaS variants were identified from UniParc with >98% amino acid identity. All nine variants were screened using the A1-28aa truncation (Trunc. 8) fused to the PEP4 signal sequence from Komagataella pastoris (SEQ ID NO: 2) (
TABLE-US-00011 TABLE 9 CBDaS Natural Diversity Variants CBDa titer Diversity relative to Mutations relative variant ID Div. ID 1 UniProt ID to Div. ID 1 SEQ ID NO Div. ID 1 1.00 A6P6V9 (reference enzyme) SEQ ID NO: 10 Div. ID 2 0.48 A0A0E3TJM6 L539Q SEQ ID NO: 15 Div. ID 3 0.00 A0A0E3TIL5 P476S SEQ ID NO: 16 Div. ID 4 0.66 A0A0E3XJ72 H143R SEQ ID NO: 17 Div. ID 5 0.00 A0A0E3TJM8 P476S, L539Q SEQ ID NO: 18 Div. ID 6 2.97 A0A0E3XIC7 T74S, N168S, N196S, K474Q SEQ ID NO: 19 Div. ID 7 0.00 A0A0E3TIM7 T74S, N168S, N196S, K474Q, SEQ ID NO: 20 G489R Div. ID 8 1.19 A0A0E3XHS4 T74S, N168S, N196S, G375R, SEQ ID NO: 21 K474Q Div. ID 9 0.00 A0A3G5EA56 Y471H, K474Q, P476S, L481I SEQ ID NO: 22 Div. ID 10 0.00 A0A3G5EBM5 T74S, N168S, N196S, K474Q, SEQ ID NO: 23 N495H, Y499P, Q501H, W505R, G506A, E507Q, G511R, K512Q, R516K
Example 6: Basic Yeast Surface Display with CBDaS
[0226] CBDaS requires low pH for activity (Zirpel et al., 2018, J. Biotechnol. 284:17-26). The cytoplasm is neutral pH and so not suitable for CBDa production, however yeast fermentation media is low pH. Yeast surface display is a method for covalently attaching proteins of interest to the outside of the yeast cell wall by fusion to native cell wall proteins (
[0227] CBDaS was fused to a variety of native yeast cell wall proteins, called carrier proteins (
TABLE-US-00012 TABLE 10 Surface Display Carrier Protein Screen Fushion CBDa type Carrier relative to Carrier (to carrier protein Construct Gene protein N or C Construct ID 8 name Uniprot truncation terminus) ID Carrier ID 1 0.00 FLO1 P32768 ?1100-1537 C-terminus Construct 22 Carrier ID 2 0.00 PIR1 Q03178 C-terminus Construct 23 Carrier ID 3 0.00 PIR2 P32478 C-terminus Construct 24 Carrier ID 4 0.00 PIR3 Q03180 C-terminus Construct 25 Carrier ID 5 0.00 PIR4 P47001 C-terminus Construct 26 Carrier ID 6 0.00 AGA1 P32323 ?1-150 N-terminus Construct 27 Carrier ID 7 0.00 CCW12 Q12127 ?1-60 N-terminus Construct 28 Carrier ID 8 0.00 CWP1 P28319 ?1-26 N-terminus Construct 29 Carrier ID 9 0.00 CWP2 P43497 ?1-25 N-terminus Construct 30 Carrier ID 10 0.00 DAN4 P47179 ?1-760 N-terminus Construct 31 Carrier ID 11 0.14 FLO5 P38894 ?1-658 N-terminus Construct 32 (S1002N, M1015K, S1040Y) Carrier ID 12 0.00 PIR1 Q03178 N-terminus Construct 33 Carrier ID 13 0.00 PIR2 P32478 N-terminus Construct 34 Carrier ID 14 0.00 PIR3 Q03180 N-terminus Construct 35 Carrier ID 15 0.00 PIR4 P47001 N-terminus Construct 36 Carrier ID 16 0.00 PRY3 P47033 ?1-800 N-terminus Construct 37 Carrier ID 17 0.10 SAG1 P20840 ?1-330 N-terminus Construct 38 Carrier ID 18 0.00 SED1 Q01589 ?1-109 N-terminus Construct 39 Carrier ID 19 0.00 SRP2 P33890 ?1-155 N-terminus Construct 40 Carrier ID 20 0.00 TIP1 P27654 ?1-66 N-terminus Construct 41 Carrier ID 21 0.00 TIR1 P10863 ?1-42 N-terminus Construct 42 Carrier ID 22 0.00 TOS6 P48560 ?1-37 N-terminus Construct 43 Construct 8 1.00 Construct 8 (reference)
[0228] Alternate yeast signal sequences were tested in place of the AGA2 signal sequence in the SAG1 surface display construct (Construct 38). Twelve additional signal sequences showed activity, up to ?2.5-fold more activity than AGA2 (
TABLE-US-00013 TABLE 11 Surface Display Signal Sequence Screen Using SAG1 as a Carrier Protein Signal CBDa titer Source Source Signal sequence relative to gene gene sequence Construct ID Construct 8 name UniProt ID SeqID ID Sig. seq 2 0.07 AGA1 P32323 SeqID 43 Construct 44 Sig. seq 3 0.10 AGA2 P32781 SeqID 42 Construct 38 (used previously) Sig. seq 4 0.16 CWP2 P43497 SeqID 44 Construct 46 Sig. seq 5 0.07 CCW12 Q12127 SeqID 45 Construct 47 Sig. seq 6 0.05 PIR1 Q03178 SeqID 46 Construct 48 Sig. seq 7 0.05 PIR3 Q03180 SeqID 47 Construct 49 Sig. seq 8 0.06 SRP2 P33890 SeqID 48 Construct 50 Sig. seq 9 0.17 K28 Q7LZU3 SeqID 49 Construct 51 Sig. seq 10 0.26 BAR1 P12630 SeqID 50 Construct 52 Sig. seq 11 0.07 DAN4 P47179 SeqID 51 Construct 53 Sig. seq 12 0.10 OST1 P41543 SeqID 52 Construct 54 Sig. seq 13 0.22 SUC2 P00724 SeqID 53 Construct 55 Sig. seq 14 0.15 PEP4 P07267 SeqID 54 Construct 56 Sig. seq 15 0.00 CWP1 P28319 SeqID 55 Construct 57 Sig. seq 16 0.00 PIR2 P32478 SeqID 57 Construct 58 Sig. seq 17 0.00 PIR4 P47001 SeqID 58 Construct 59 Sig. seq 18 0.00 TIP1 P27654 SeqID 59 Construct 60 Sig. seq 19 0.00 SED1 Q01589 SeqID 60 Construct 61 Sig. seq 20 0.00 TIR1 P10863 SeqID 61 Construct 62 Sig. seq 21 0.00 PRY3 P47033 SeqID 62 Construct 63 Sig. seq 22 0.00 TOS6 P48560 SeqID 63 Construct 64 Sig. seq 23 0.00 K1 A0A076FME7 SeqID 64 Construct 65 Sig. seq 24 0.00 DAN1 P47178 SeqID 65 Construct 66 Sig. seq 25 0.00 MF(ALPHA)1 P01149 SeqID 66 Construct 67 Sig. seq 26 0.00 PRC1 P00729 SeqID 67 Construct 68 Sig. seq 27 0.00 HPF1 Q05164 SeqID 68 Construct 69 Sig. seq 28 0.00 SCW10 Q04951 SeqID 69 Construct 70 Sig. seq 29 0.00 PGU1 P47180 SeqID 70 Construct 71 Sig. seq 30 0.00 SAG1 P20840 SeqID 71 Construct 72 Construct 8 1.00 (reference)
[0229] Alternate truncations of both SAG1 and FLO5 were tested with the AGA2 signal sequence (SEQ ID NO: 42) and short 6 aa flexible linker (SEQ ID NO: 113), using the reference CBDaS (SEQ ID NO: 1) for SAG1, and the alternate CBDaS natural diversity variant for FLO5 (SEQ ID NO: 136) (
TABLE-US-00014 TABLE 12 Surface Display Carrier Protein Truncation Series CBDa titer N Carrier Carrier Truncation relative to terminal protein protein Construct ID reference truncation name SeqID ID Trunc. 13 0.00 ?1-321 SAG1 SeqID 72 Construct 73 Trunc. 14 0.00 ?1-329 SAG1 SeqID 73 Construct 74 Trunc. 15 0.10 ?1-330 SAG1 SeqID 36 Construct 38 (original SAG1) Trunc. 16 0.00 ?1-338 SAG1 SeqID 75 Construct 76 Trunc. 17 0.00 ?1-349 SAG1 SeqID 76 Construct 77 Trunc. 18 0.34 ?1-359 SAG1 SeqID 77 Construct 78 Trunc. 19 0.00 ?1-369 SAG1 SeqID 78 Construct 79 Trunc. 20 0.00 ?1-383 SAG1 SeqID 79 Construct 80 Trunc. 21 0.00 ?1-389 SAG1 SeqID 80 Construct 81 Trunc. 22 0.40 ?1-399 SAG1 SeqID 81 Construct 82 Trunc. 23 0.00 ?1-409 SAG1 SeqID 82 Construct 83 Trunc. 24 0.00 ?1-419 SAG1 SeqID 83 Construct 84 Trunc. 25 0.00 ?1-429 SAG1 SeqID 84 Construct 85 Trunc. 26 0.00 ?1-439 SAG1 SeqID 85 Construct 86 Trunc. 27 0.00 ?1-449 SAG1 SeqID 86 Construct 87 Trunc. 28 0.24 ?1-459 SAG1 SeqID 87 Construct 88 Trunc. 29 0.00 ?1-469 SAG1 SeqID 88 Construct 89 Trunc. 30 0.19 ?1-479 SAG1 SeqID 89 Construct 90 Trunc. 31 0.13 ?1-489 SAG1 SeqID 90 Construct 91 Trunc. 32 0.11 ?1-499 SAG1 SeqID 91 Construct 92 Trunc. 33 0.00 ?1-509 SAG1 SeqID 92 Construct 93 Trunc. 34 0.00 ?1-519 SAG1 SeqID 93 Construct 94 Trunc. 35 0.00 ?1-529 SAG1 SeqID 94 Construct 95 Trunc. 36 0.00 ?1-539 SAG1 SeqID 95 Construct 96 Trunc. 37 0.00 ?1-549 SAG1 SeqID 96 Construct 97 Trunc. 38 0.00 ?1-559 SAG1 SeqID 97 Construct 98 Trunc. 39 0.00 ?1-569 SAG1 SeqID 98 Construct 99 Trunc. 40 0.00 ?1-579 SAG1 SeqID 99 Construct 100 Trunc. 41 0.00 ?1-589 SAG1 SeqID 100 Construct 101 Trunc. 42 0.00 ?1-599 SAG1 SeqID 101 Construct 102 SAG1 1.00 none Construct 8 experimental control Trunc. 43 0.30 ?1-658 FLO5 SeqID 34 Construct 103 (original FLO5) Trunc. 44 0.23 ?1-659 FLO5 SeqID 103 Construct 104 Trunc. 45 0.26 ?1-660 FLO5 SeqID 104 Construct 105 Trunc. 46 0.34 ?1-661 FLO5 SeqID 105 Construct 106 Trunc. 47 0.36 ?1-662 FLO5 SeqID 106 Construct 107 Trunc. 48 0.09 ?1-671 FLO5 SeqID 107 Construct 108 Trunc. 49 0.09 ?1-681 FLO5 SeqID 108 Construct 109 Trunc. 50 0.22 ?1-691 FLO5 SeqID 109 Construct 110 Trunc. 51 0.16 ?1-701 FLO5 SeqID 110 Construct 111 Trunc. 52 0.11 ?1-711 FLO5 SeqID 111 Construct 112 Trunc. 53 0.11 ?1-711 FLO5 SeqID 112 Construct 113 FLO5 1.00 none Construct 17 experimental control
Example 7: Optimized Yeast Surface Display Constructs
[0230] The SAG1 and FLO5 yeast surface display CBDaS expression constructs were further optimized. Twelve additional linkers were tested in both SAG1 and FLO5 CBDaS expression constructs. (Table 13). All the linker carrier protein combinations were functional except for a no-linker control (
TABLE-US-00015 TABLE13 Linkers Linker Linker length Linker LinkerID Linkeraaseq. type (aa) SEQIDNO LinkerID1 GSGGSG flexible 6 SEQIDNO:113 (original) LinkerID2 GSGSGS flexible 6 SEQIDNO:114 LinkerID3 HHHHGSGGSG flexible 10 SEQIDNO:115 LinkerID4 GSGAGGVSGAGG flexible 12 SEQIDNO:116 LinkerID5 GSGGSGGSGGSG flexible 12 SEQIDNO:117 LinkerID6 HHHHHHGSGGSG flexible 12 SEQIDNO:118 LinkerID7 GSGGSGGSGGSGGSGGSG flexible 18 SEQIDNO:119 LinkerID8 AEAAAKEAAAKA rigid 12 SEQIDNO:120 LinkerID9 APAPAPAPAPAPAPA rigid 15 SEQIDNO:121 LinkerID10 EPEPEPEPEPEPEPE rigid 15 SEQIDNO:122 LinkerID11 KPKPKPKPKPKPKP rigid 14 SEQIDNO:123 LinkerID12 AEAAAKEAAAKEAAAKA rigid 17 SEQIDNO:124 LinkerID13 AEAAAKEAAAKEAAAKEAAAKA rigid 22 SEQIDNO:125
TABLE-US-00016 TABLE 14 Surface Display CBDaS to Carrier Protein Linker Screen CBDa relative to Linker Linker Construct Linker ID construct 17 type length Carrier ID None 0.00 SAG1 Construct 114 Linker ID 1 0.15 flexible 6 SAG1 Construct 38 Linker ID 2 0.07 flexible 6 SAG1 Construct 115 Linker ID 3 0.07 flexible 10 SAG1 Construct 116 Linker ID 4 0.12 flexible 12 SAG1 Construct 117 Linker ID 5 0.10 flexible 12 SAG1 Construct 118 Linker ID 6 0.12 flexible 12 SAG1 Construct 119 Linker ID 7 0.13 flexible 18 SAG1 Construct 120 Linker ID 8 0.29 rigid 12 SAG1 Construct 121 Linker ID 9 0.10 rigid 15 SAG1 Construct 122 Linker ID 10 0.27 rigid 15 SAG1 Construct 123 Linker ID 11 0.13 rigid 15 SAG1 Construct 124 Linker ID 12 0.15 rigid 17 SAG1 Construct 125 Linker ID 13 0.10 rigid 22 SAG1 Construct 126 Linker ID 1 0.13 flexible 6 FLO5 Construct 127 Linker ID 4 0.17 flexible 12 FLO5 Construct 128 Linker ID 7 0.25 flexible 18 FLO5 Construct 129 Linker ID 8 0.26 rigid 12 FLO5 Construct 130 Linker ID 9 0.18 rigid 15 FLO5 Construct 131 Linker ID 10 0.28 rigid 15 FLO5 Construct 132 Linker ID 11 0.14 rigid 15 FLO5 Construct 133 Linker ID 12 0.13 rigid 17 FLO5 Construct 134 Linker ID 13 0.23 rigid 22 FLO5 Construct 135 Construct 17 1.00 none Construct 17
[0231] KEX2 protease recognition sites were introduced between the signal sequence and the N-terminus of CBDaS in surface display expression constructs to force removal of the signal sequence. KEX2 (UniProt P13134) is a native S. cerevisiae processing protease that resides in the Golgi, and has a specific amino acid recognition sequence of (Lys/Arg)-Arg. Multiple variants of the KEX2 recognition sequence were tested (
TABLE-US-00017 TABLE15 KEX2ProteaseRecognitionSequencesTested KEX2proteaserecognitionsequences RR KR RRK RRQ RRW RRE LDKR LDKREAEA KREAEA
TABLE-US-00018 TABLE 16 Surface Display Signal Sequence KEX2 Protease Site Screen Signal CBDaS CBDa titer Signal KEX2 sequence N-terminal relative to sequence site SEQ ID truncation Construct ID construct 17 name (aa) NO SEQ ID NO Construct 136 0.11 AGA2 RR SEQ ID NO: 126 SEQ ID NO: 134 Construct 137 0.12 AGA2 SEQ ID NO: 42 SEQ ID NO: 134 Construct 138 0.06 BAR1 RR SEQ ID NO: 127 SEQ ID NO: 134 Construct 139 0.13 BAR1 SEQ ID NO: 50 SEQ ID NO: 134 Construct 140 0.81 OST1 RR SEQ ID NO: 128 SEQ ID NO: 134 Construct 141 0.47 OST1 SEQ ID NO: 52 SEQ ID NO: 134 Construct 142 0.82 PEP4 RR SEQ ID NO: 129 SEQ ID NO: 134 Construct 143 0.26 PEP4 SEQ ID NO: 54 SEQ ID NO: 134 Construct 144 0.25 PIR1 RR SEQ ID NO: 130 SEQ ID NO: 134 Construct 145 0.02 PIR1 SEQ ID NO: 46 SEQ ID NO: 134 Construct 146 0.41 PIR3 RR SEQ ID NO: 131 SEQ ID NO: 134 Construct 147 0.08 PIR3 SEQ ID NO: 47 SEQ ID NO: 134 Construct 148 0.10 SAG1 RR SEQ ID NO: 132 SEQ ID NO: 134 Construct 149 0.04 SAG1 SEQ ID NO: 71 SEQ ID NO: 134 Construct 150 0.50 SUC2 RR SEQ ID NO: 133 SEQ ID NO: 134 Construct 151 0.02 SUC2 SEQ ID NO: 53 SEQ ID NO: 134 Construct 152 0.23 AGA2 RR SEQ ID NO: 123 SEQ ID NO: 135 Construct 153 0.21 AGA2 SEQ ID NO: 42 SEQ ID NO: 135 Construct 154 0.06 BAR1 RR SEQ ID NO: 127 SEQ ID NO: 135 Construct 155 0.17 BAR1 SEQ ID NO: 50 SEQ ID NO: 135 Construct 156 0.73 OST1 RR SEQ ID NO: 128 SEQ ID NO: 135 Construct 157 0.42 OST1 SEQ ID NO: 52 SEQ ID NO: 135 Construct 158 0.80 PEP4 RR SEQ ID NO: 129 SEQ ID NO: 135 Construct 159 0.27 PEP4 SEQ ID NO: 54 SEQ ID NO: 135 Construct 160 0.67 PIR1 RR SEQ ID NO: 130 SEQ ID NO: 135 Construct 161 0.05 PIR1 SEQ ID NO: 46 SEQ ID NO: 135 Construct 162 0.29 PIR3 RR SEQ ID NO: 131 SEQ ID NO: 135 Construct 163 0.08 PIR3 SEQ ID NO: 47 SEQ ID NO: 135 Construct 164 0.67 SAG1 RR SEQ ID NO: 132 SEQ ID NO: 135 Construct 165 0.07 SAG1 SEQ ID NO: 71 SEQ ID NO: 135 Construct 166 0.51 SUC2 RR SEQ ID NO: 133 SEQ ID NO: 135 Construct 167 0.11 SUC2 SEQ ID NO: 53 SEQ ID NO: 135 Construct 168 1.74 CWP2 RR SEQ ID NO: 138 SEQ ID NO: 137 Construct 169 1.38 CWP2 KR SEQ ID NO: 139 SEQ ID NO: 137 Construct 170 1.77 CWP2 RRK SEQ ID NO: 140 SEQ ID NO: 137 Construct 171 1.74 CWP2 RRQ SEQ ID NO: 141 SEQ ID NO: 137 Construct 172 1.32 CWP2 RRW SEQ ID NO: 142 SEQ ID NO: 137 Construct 173 1.37 CWP2 RRE SEQ ID NO: 143 SEQ ID NO: 137 Construct 174 1.05 CWP2 LDKR SEQ ID NO: 144 SEQ ID NO: 137 Construct 175 1.05 CWP2 LDKREAEA SEQ ID NO: 145 SEQ ID NO: 137 Construct 175 1.16 CWP2 KREAEA SEQ ID NO: 146 SEQ ID NO: 137 Construct 17 1.00
[0232] A variety of the top SAG1 and FLOS carrier protein truncations, signal sequences, KEX2 protease sites, CBDaS N-terminal truncations, and linkers were combinatorially tested (
TABLE-US-00019 TABLE 17 Example Optimized Surface Display Constructs with Combinations of Linker, Signal Sequence, and Carrier Protein CBDa relative Carrier Carrier to Construct Signal protein protein Construct ID 17 sequence KEX2 Linker ID name truncation Construct 17 1.00 (reference) Construct 177 1.24 OST1 RR Linker ID 10 SAG1 ?1-329 Construct 178 1.20 CWP2 RR Linker ID 8 SAG1 ?1-329 Construct 179 1.06 CWP2 RR Linker ID 10 SAG1 ?1-359 Construct 180 1.05 OST1 RR Linker ID 10 SAG1 ?1-359 Construct 181 1.02 PEP4 Linker ID 10 SAG1 ?1-459 Construct 182 0.99 OST1 RR Linker ID 10 SAG1 ?1-459 Construct 183 0.99 AGA2 RR Linker ID 10 SAG1 ?1-359 Construct 184 0.98 PEP4 RR Linker ID 10 SAG1 ?1-359 Construct 185 0.98 PEP4 Linker ID 10 SAG1 ?1-359 Construct 186 0.91 CCW1 Linker ID 10 SAG1 ?1-399 Construct 187 0.89 CCW1 Linker ID 8 SAG1 ?1-399 Construct 188 0.89 SUC2 RR Linker ID 10 SAG1 ?1-359 Construct 189 0.87 AGA2 RR Linker ID 10 SAG1 ?1-329 Construct 190 0.87 CWP2 RR Linker ID 10 SAG1 ?1-329 Construct 191 0.85 CCW1 Linker ID 10 SAG1 ?1-459 Construct 192 0.84 AGA2 RR Linker ID 10 SAG1 ?1-399 Construct 193 0.83 CWP2 RR Linker ID 10 SAG1 ?1-399 Construct 194 0.82 CWP2 RR Linker ID 10 SAG1 ?1-459 Construct 195 0.82 OST1 RR Linker ID 10 SAG1 ?1-399 Construct 196 0.80 PEP4 Linker ID 10 SAG1 ?1-399 Construct 197 0.80 AGA2 RR Linker ID 8 SAG1 ?1-399 Construct 198 0.77 CWP2 RR Linker ID 8 SAG1 ?1-399 Construct 199 0.72 PEP4 RR Linker ID 10 SAG1 ?1-329 Construct 200 0.71 OST1 RR Linker ID 10 SAG1 ?1-359 Construct 201 0.68 OST1 RR Linker ID 10 SAG1 ?1-399 Construct 202 0.64 OST1 RR Linker ID 10 SAG1 ?1-329 Construct 203 0.62 OST1 RR Linker ID 10 SAG1 ?1-459 Construct 204 0.54 PEP4 Linker ID 10 SAG1 ?1-329 Construct 205 0.52 SUC2 RR Linker ID 10 SAG1 ?1-459 Construct 206 0.39 SUC2 RR Linker ID 10 SAG1 ?1-399 Construct 207 1.33 OST1 RR Linker ID 10 FLO5 ?1-671 Construct 208 1.18 PEP4 RR Linker ID 10 FLO5 ?1-691 Construct 209 1.13 OST1 Linker ID 10 FLO5 ?1-671 Construct 210 1.09 AGA2 RR Linker ID 8 FLO5 ?1-691 Construct 211 1.06 OST1 RR Linker ID 10 FLO5 ?1-691 Construct 212 1.02 OST1 Linker ID 10 FLO5 ?1-691 Construct 213 0.99 OST1 RR Linker ID 8 FLO5 ?1-658 Construct 214 0.99 OST1 RR Linker ID 10 FLO5 ?1-691 Construct 215 0.97 OST1 RR Linker ID 8 FLO5 ?1-691 Construct 216 0.97 OST1 RR Linker ID 10 FLO5 ?1-671 Construct 217 0.97 OST1 Linker ID 8 FLO5 ?1-691 Construct 218 0.95 OST1 RR Linker ID 8 FLO5 ?1-691 Construct 219 0.95 DAN4 Linker ID 10 FLO5 ?1-671 Construct 220 0.94 OST1 Linker ID 8 FLO5 ?1-658 Construct 221 0.94 DAN4 Linker ID 8 FLO5 ?1-691 Construct 222 0.92 DAN4 Linker ID 10 FLO5 ?1-691 Construct 223 0.92 AGA2 RR Linker ID 10 FLO5 ?1-691 Construct 224 0.90 AGA2 RR Linker ID 10 FLO5 ?1-671 Construct 225 0.90 OST1 RR Linker ID 8 FLO5 ?1-658 Construct 226 0.85 AGA2 RR Linker ID 8 FLO5 ?1-658 Construct 227 0.83 PEP4 RR Linker ID 8 FLO5 ?1-691 Construct 228 0.79 PEP4 RR Linker ID 10 FLO5 ?1-671 Construct 229 0.75 PEP4 RR Linker ID 8 FLO5 ?1-658 Construct 230 0.75 DAN4 Linker ID 8 FLO5 ?1-658
Example 8: CBDaS Secretion and Vacuolar Localization
[0233] An alternative to yeast surface display constructs for CBDaS activity in the extracellular environment (Example 6) is direct secretion into the media. A series of constructs were tested 5 using the native S. cerevisiae mating factor alpha (MF?) pre sequence (signal sequence) (
TABLE-US-00020 TABLE 18 CBDa Secretion and Vacuolar Constructs CBDa Signal CBDaS N CBDaS C CBDaS C- relative to Signal sequence terminal terminal terminal Construct ID Construct 178 sequence SeqID truncation truncation fusion Construct 231 0.19 MF(alpha)- SeqID 153 prepro Construct 232 1.65 MF(alpha)- SeqID 153 ?1-28 prepro Construct 233 1.65 MF(alpha)- SeqID 153 ?544 SeqID 152 prepro Construct 234 1.47 MF(alpha)- SeqID 153 ?1-28 ?544 SeqID 152 prepro Construct 235 0.08 MF(alpha)-pre, SeqID 154 ?544 SeqID 152 synthetic pro 1 Construct 236 2.21 MF(alpha)-pre, SeqID 154 ?1-28 ?544 SeqID 152 synthetic pro 1 Construct 237 0.34 MF(alpha)-pre, SeqID 155 ?544 SeqID 152 synthetic pro 2 Construct 238 1.60 MF(alpha)-pre, SeqID 155 ?1-28 ?544 SeqID 152 synthetic pro 2 Construct 239 1.30 PEP4-prepro SeqID 157 ?1-28 Construct 240 0.05 PEP4 whole SeqID 156 ?1-28 protein Construct 241 2.36 CWP2 + KEX2 SeqID 138 ?1-28 SeqID 120 (RR) Construct 242 1.91 CWP2 + KEX2 SeqID 138 ?1-28 (RR) Construct 243 1.65 CWP2 + KEX2 SeqID 138 ?544 SeqID 152 (RR) Construct 178 1.00 SeqID 138 (reference)
Example 9: CBDaS Glycosylation Site Mutations
[0234] The reference CBDaS (SEQ ID NO: 1) is predicted to be N-glycosylated at 7 positions in Cannabis. It is likely that glycosylation occurs at these sites in S. cerevisiae as well, as the Asn-(any aa except Pro)-(Thr or Ser)N-glycosylation recognition sequence is conserved between plants and fungi. However, the exact nature and extent of glycosylation is likely to be different between the two hosts, and over-glycosylation is a common problem for heterologous proteins expressed in S. cerevisiae.
[0235] The 7 predicted CBDas glycosylation sites were combinatorially mutagenized (
TABLE-US-00021 TABLE 19 CBDaS Glycosylation Site Locations Targeted for Random Mutagenesis (Amino Acid Positions are With Reference to SEQ ID NO: 1) CBDaS Alternate glycosylation site Glycosylation recognition position (aa) site knockout site N45 N45Q T47S N65 N65Q T67S N168 N168Q S170T N296 N296Q T298S N304 N304Q T306S N328 N328Q S330T N498 N498Q T500S
TABLE-US-00022 TABLE 20 CBDaS Glycosylation Site Combinatorial Mutants (All Variants were Expressed in a Construct Identical to Construct 17) CBDaS Average Mutations relative CBDaS variant ID CBDa to SeqID 136 truncation v11 1.54 T47S, S168N, S170T, N304Q ?1-28 v12 1.97 S168N, S170T, S330T ?1-28 (SeqID 137) v13 1.62 T47S, S168N, S170T, T500S ?1-28 v14 1.66 T67S, S168N, S170T, N296Q, ?1-28 S330T, T500S v15 1.90 T47S, T67S, S168N, S170T, ?1-28 N304Q, S330T, T500S Construct 17 1.00
Example 10: CBDaS Point Mutants
[0236] Site saturation mutagenesis was used to improve CBDaS activity (
TABLE-US-00023 TABLE 21 Example CBDaS Point Mutants (All Variants Were Expressed in a Construct Identical to Construct 244) CBDa relative to Mutant relative Target Variant ID Construct 244 to SeqID 137 position v11 0.10 N29G 29 v13 0.32 R31T 31 v15 0.10 P43D 43 v17 0.07 L49D 49 v20 0.14 N56D 56 v26 0.19 N57D 57 v9 0.38 L71D 71 v21 0.18 L71S 71 v32 0.09 G95A 95 v8 0.10 V103Y 103 v30 0.04 V125D 125 v33 0.13 I129L 129 v6 0.02 H143A 143 v12 0.12 W161R 16 v14 0.09 W161A 16 v29 0.08 W161H 161 v28 0.08 W161D 161 v24 0.05 W161S 161 v25 0.04 W161T 161 v23 0.04 W161N 161 v22 0.12 H213N 213 v19 0.08 H213D 213 v27 0.19 I241V 241 v31 0.05 K303N 303 v18 0.02 S314C 314 v7 0.11 T339S 339 v10 0.10 F396L 396 v16 0.10 V518C 518 SEQID 137 1.00
Example 11: CBDaS Combinatorial Library Mutants
[0237] The top individual CBDaS point mutants from Example 10 were consolidated together using a full factorial combinatorial library (Table 22) to produce variants with far higher activity than any single CBDaS point mutant. Mutations were introduced into SEQ ID NO: 137 using PCR, and variants were expressed in a top surface display expression construct (Construct 244). The majority of point mutant combinations led to improved CBDaS activity over the parent (
TABLE-US-00024 TABLE 22 CBDaS Positions Included in a Combinatorial Library CBDaS substitution (aa) R53T P65D L71D N78D N79D L93D G117A V147D I151L W183N H235D I263V K325N S336C V540C
TABLE-US-00025 TABLE 23 Example CBDaS Combinatorial Mutants (All Variants Were Expressed in a Construct Identical to Construct 244) CBDa relative Seq ID to SEQ Mutations relative to ID NO: 137 SEQ ID NO: 137 v34 3.96 R53T, N78D, V147D, H235D, I263V, K325N, V540C v35 3.98 R53T, P65D, L71D, N79D, L93D, V147D, W183N, H235D, S336C v36 3.98 L71D, N78D, G117A, V147D, W183N, I263V, K325N, S336C, V540C v37 4.05 R53T, P65D, L71D, N78D, N79D, L93D, V147D, W183N, H235D, K325N, S336C, V540C v38 4.11 L71D, L93D, V147D, H235D, I263V v39 4.11 R35T, V147D, I151L, W183N, H235D, S336C, V540C v40 4.14 R53T, N78D, N79D, G117A, V147D, S336C v41 4.14 R53T, P65D, L71D, N79D, L93D, V147D, W183N, H235D, S336C v42 4.17 R53T, L71D, N78D, G117A, V147D, H235D, S336C, V540C v43 4.18 R53T, P65D, N78D, G117A, V147D, H325D, K325N, S336C, V540C v44 4.21 R53T, P65D, N78D, L93D, V147D, W183N, H235D, V540C v45 4.26 R53T, N78D, V147D, W183N, H235D, I263V, S336C v46 4.29 R53T, N79D, V147D, W183N, H235D, I263V, K325N, S336C v47 4.29 R53T, P65D, L71D, N78D, V147D.H235D, I263V, S336C, V540C v48 4.32 R53T, L71D, G117A, V147D, H235D, I263V, V540C v49 4.33 R53T, L71D, N78D, G117A, V147D, H235D, I263V, K325N, S336C, V540C v50 4.33 R53T, P65D, N78D, N79D, V147D, S336C, V540C v51 4.36 R53T, N78D, N79D, V147D, W183N, H235D, I263V, K325N v52 4.38 R53T, I151L, H235D, K325N, S336C v53 4.41 R53T, P65D, L71D, N79D, L93D, V147D, W183N, H235D, S336C SeqID 1.00 137
TABLE-US-00026 TABLE 24 Construct Table SEQ IDs fused SEQ ID fused upstream of SEQ ID fused downstream of CBDaS (in downstream of CBDaS (carrier Construct ID order) CBDaS SeqID CBDaS (linker) protein) Construct 1 SeqID 2 SeqID 3 Construct 2 SeqID 2 SeqID 4 Construct 3 SeqID 2 SeqID 5 Construct 4 SeqID 2 SeqID 6 Construct 5 SeqID 2 SeqID 7 Construct 6 SeqID 2 SeqID 8 Construct 7 SeqID 2 SeqID 9 Construct 8 SeqID 2 SeqID 10 Construct 9 SeqID 2 SeqID 11 Construct 10 SeqID 2 SeqID 12 Construct 11 SeqID 2 SeqID 13 Construct 12 SeqID 2 SeqID 14 Construct 13 SeqID 2 SeqID 15 Construct 14 SeqID 2 SeqID 16 Construct 15 SeqID 2 SeqID 17 Construct 16 SeqID 2 SeqID 18 Construct 17 SeqID 2 SeqID 19 Construct 18 SeqID 2 SeqID 20 Construct 19 SeqID 2 SeqID 21 Construct 20 SeqID 2 SeqID 22 Construct 21 SeqID 2 SeqID 23 SeqID 24, Construct 22 SeqID 113 SeqID 1 SeqID 113 SeqID 25, Construct 23 SeqID 113 SeqID 1 SeqID 113 SeqID 26, Construct 24 SeqID 113 SeqID 1 SeqID 113 Construct 25 SeqID 27, SeqID 1 SeqID 113 SeqID 113 SeqID 28, Construct 26 SeqID 113 SeqID 1 SeqID 113 Construct 27 SeqID 42 SeqID 1 SeqID 113 SeqID 29 Construct 28 SeqID 42 SeqID 1 SeqID 113 SeqID 30 Construct 29 SeqID 42 SeqID 1 SeqID 113 SeqID 31 Construct 30 SeqID 42 SeqID 1 SeqID 113 SeqID 32 Construct 31 SeqID 42 SeqID 1 SeqID 113 SeqID 33 Construct 32 SeqID 42 SeqID 1 SeqID 113 SeqID 34 Construct 33 SeqID 42 SeqID 1 SeqID 113 SeqID 25 Construct 34 SeqID 42 SeqID 1 SeqID 113 SeqID 26 Construct 35 SeqID 42 SeqID 1 SeqID 113 SeqID 27 Construct 36 SeqID 42 SeqID 1 SeqID 113 SeqID 28 Construct 37 SeqID 42 SeqID 1 SeqID 113 SeqID 35 Construct 38 SeqID 42 SeqID 1 SeqID 113 SeqID 36 Construct 39 SeqID 42 SeqID 1 SeqID 113 SeqID 37 Construct 40 SeqID 42 SeqID 1 SeqID 113 SeqID 38 Construct 41 SeqID 42 SeqID 1 SeqID 113 SeqID 39 Construct 42 SeqID 42 SeqID 1 SeqID 113 SeqID 40 Construct 43 SeqID 42 SeqID 1 SeqID 113 SeqID 41 Construct 44 SeqID 43 SeqID 1 SeqID 113 SeqID 36 Construct 46 SeqID 44 SeqID 1 SeqID 113 SeqID 36 Construct 47 SeqID 45 SeqID 1 SeqID 113 SeqID 36 Construct 48 SeqID 46 SeqID 1 SeqID 113 SeqID 36 Construct 49 SeqID 47 SeqID 1 SeqID 113 SeqID 36 Construct 50 SeqID 48 SeqID 1 SeqID 113 SeqID 36 Construct 51 SeqID 49 SeqID 1 SeqID 113 SeqID 36 Construct 52 SeqID 50 SeqID 1 SeqID 113 SeqID 36 Construct 53 SeqID 51 SeqID 1 SeqID 113 SeqID 36 Construct 54 SeqID 52 SeqID 1 SeqID 113 SeqID 36 Construct 55 SeqID 53 SeqID 1 SeqID 113 SeqID 36 Construct 56 SeqID 54 SeqID 1 SeqID 113 SeqID 36 Construct 57 SeqID 55 SeqID 1 SeqID 113 SeqID 36 Construct 58 SeqID 57 SeqID 1 SeqID 113 SeqID 36 Construct 59 SeqID 58 SeqID 1 SeqID 113 SeqID 36 Construct 60 SeqID 59 SeqID 1 SeqID 113 SeqID 36 Construct 61 SeqID 60 SeqID 1 SeqID 113 SeqID 36 Construct 62 SeqID 61 SeqID 1 SeqID 113 SeqID 36 Construct 63 SeqID 62 SeqID 1 SeqID 113 SeqID 36 Construct 64 SeqID 63 SeqID 1 SeqID 113 SeqID 36 Construct 65 SeqID 64 SeqID 1 SeqID 113 SeqID 36 Construct 66 SeqID 65 SeqID 1 SeqID 113 SeqID 36 Construct 67 SeqID 66 SeqID 1 SeqID 113 SeqID 36 Construct 68 SeqID 67 SeqID 1 SeqID 113 SeqID 36 Construct 69 SeqID 68 SeqID 1 SeqID 113 SeqID 36 Construct 70 SeqID 69 SeqID 1 SeqID 113 SeqID 36 Construct 71 SeqID 70 SeqID 1 SeqID 113 SeqID 36 Construct 72 SeqID 71 SeqID 1 SeqID 113 SeqID 36 Construct 73 SeqID 42 SeqID 1 SeqID 113 SeqID 72 Construct 74 SeqID 42 SeqID 1 SeqID 113 SeqID 73 Construct 76 SeqID 42 SeqID 1 SeqID 113 SeqID 75 Construct 77 SeqID 42 SeqID 1 SeqID 113 SeqID 76 Construct 78 SeqID 42 SeqID 1 SeqID 113 SeqID 77 Construct 79 SeqID 42 SeqID 1 SeqID 113 SeqID 78 Construct 80 SeqID 42 SeqID 1 SeqID 113 SeqID 79 Construct 81 SeqID 42 SeqID 1 SeqID 113 SeqID 80 Construct 82 SeqID 42 SeqID 1 SeqID 113 SeqID 81 Construct 83 SeqID 42 SeqID 1 SeqID 113 SeqID 82 Construct 84 SeqID 42 SeqID 1 SeqID 113 SeqID 83 Construct 85 SeqID 42 SeqID 1 SeqID 113 SeqID 84 Construct 86 SeqID 42 SeqID 1 SeqID 113 SeqID 85 Construct 87 SeqID 42 SeqID 1 SeqID 113 SeqID 86 Construct 88 SeqID 42 SeqID 1 SeqID 113 SeqID 87 Construct 89 SeqID 42 SeqID 1 SeqID 113 SeqID 88 Construct 90 SeqID 42 SeqID 1 SeqID 113 SeqID 89 Construct 91 SeqID 42 SeqID 1 SeqID 113 SeqID 90 Construct 92 SeqID 42 SeqID 1 SeqID 113 SeqID 91 Construct 93 SeqID 42 SeqID 1 SeqID 113 SeqID 92 Construct 94 SeqID 42 SeqID 1 SeqID 113 SeqID 93 Construct 95 SeqID 42 SeqID 1 SeqID 113 SeqID 94 Construct 96 SeqID 42 SeqID 1 SeqID 113 SeqID 95 Construct 97 SeqID 42 SeqID 1 SeqID 113 SeqID 96 Construct 98 SeqID 42 SeqID 1 SeqID 113 SeqID 97 Construct 99 SeqID 42 SeqID 1 SeqID 113 SeqID 98 Construct 100 SeqID 42 SeqID 1 SeqID 113 SeqID 99 Construct 101 SeqID 42 SeqID 1 SeqID 113 SeqID 100 Construct 102 SeqID 42 SeqID 1 SeqID 113 SeqID 101 Construct 103 SeqID 42 SeqID 136 SeqID 113 SeqID 34 Construct 104 SeqID 42 SeqID 136 SeqID 113 SeqID 103 Construct 105 SeqID 42 SeqID 136 SeqID 113 SeqID 104 Construct 106 SeqID 42 SeqID 136 SeqID 113 SeqID 105 Construct 107 SeqID 42 SeqID 136 SeqID 113 SeqID 106 Construct 108 SeqID 42 SeqID 136 SeqID 113 SeqID 107 Construct 109 SeqID 42 SeqID 136 SeqID 113 SeqID 108 Construct 110 SeqID 42 SeqID 136 SeqID 113 SeqID 109 Construct 111 SeqID 42 SeqID 136 SeqID 113 SeqID 110 Construct 112 SeqID 42 SeqID 136 SeqID 113 SeqID 111 Construct 113 SeqID 42 SeqID 136 SeqID 113 SeqID 112 Construct 114 SeqID 42 SeqID 1 SeqID 36 Construct 115 SeqID 42 SeqID 1 SeqID 114 SeqID 36 Construct 116 SeqID 42 SeqID 1 SeqID 115 SeqID 36 Construct 117 SeqID 42 SeqID 1 SeqID 116 SeqID 36 Construct 118 SeqID 42 SeqID 1 SeqID 117 SeqID 36 Construct 119 SeqID 42 SeqID 1 SeqID 118 SeqID 36 Construct 120 SeqID 42 SeqID 1 SeqID 119 SeqID 36 Construct 121 SeqID 42 SeqID 1 SeqID 120 SeqID 36 Construct 122 SeqID 42 SeqID 1 SeqID 121 SeqID 36 Construct 123 SeqID 42 SeqID 1 SeqID 122 SeqID 36 Construct 124 SeqID 42 SeqID 1 SeqID 123 SeqID 36 Construct 125 SeqID 42 SeqID 1 SeqID 124 SeqID 36 Construct 126 SeqID 42 SeqID 1 SeqID 125 SeqID 36 Construct 127 SeqID 42 SeqID 1 SeqID 113 SeqID 34 Construct 128 SeqID 42 SeqID 1 SeqID 116 SeqID 34 Construct 129 SeqID 42 SeqID 1 SeqID 119 SeqID 34 Construct 130 SeqID 42 SeqID 1 SeqID 120 SeqID 34 Construct 131 SeqID 42 SeqID 1 SeqID 121 SeqID 34 Construct 132 SeqID 42 SeqID 1 SeqID 122 SeqID 34 Construct 133 SeqID 42 SeqID 1 SeqID 123 SeqID 34 Construct 134 SeqID 42 SeqID 1 SeqID 124 SeqID 34 Construct 135 SeqID 42 SeqID 1 SeqID 125 SeqID 34 Construct 136 SeqID 126 SeqID 134 SeqID 120 SeqID 36 Construct 137 SeqID 42 SeqID 134 SeqID 120 SeqID 36 Construct 138 SeqID 127 SeqID 134 SeqID 120 SeqID 36 Construct 139 SeqID 50 SeqID 134 SeqID 120 SeqID 36 Construct 140 SeqID 128 SeqID 134 SeqID 120 SeqID 36 Construct 141 SeqID 52 SeqID 134 SeqID 120 SeqID 36 Construct 142 SeqID 129 SeqID 134 SeqID 120 SeqID 36 Construct 143 SeqID 54 SeqID 134 SeqID 120 SeqID 36 Construct 144 SeqID 130 SeqID 134 SeqID 120 SeqID 36 Construct 145 SeqID 46 SeqID 134 SeqID 120 SeqID 36 Construct 146 SeqID 131 SeqID 134 SeqID 120 SeqID 36 Construct 147 SeqID 47 SeqID 134 SeqID 120 SeqID 36 Construct 148 SeqID 132 SeqID 134 SeqID 120 SeqID 36 Construct 149 SeqID 71 SeqID 134 SeqID 120 SeqID 36 Construct 150 SeqID 133 SeqID 134 SeqID 120 SeqID 36 Construct 151 SeqID 53 SeqID 134 SeqID 120 SeqID 36 Construct 152 SeqID 126 SeqID 135 SeqID 120 SeqID 36 Construct 153 SeqID 42 SeqID 135 SeqID 120 SeqID 36 Construct 154 SeqID 127 SeqID 135 SeqID 120 SeqID 36 Construct 155 SeqID 50 SeqID 135 SeqID 120 SeqID 36 Construct 156 SeqID 128 SeqID 135 SeqID 120 SeqID 36 Construct 157 SeqID 52 SeqID 135 SeqID 120 SeqID 36 Construct 158 SeqID 129 SeqID 135 SeqID 120 SeqID 36 Construct 159 SeqID 54 SeqID 135 SeqID 120 SeqID 36 Construct 160 SeqID 130 SeqID 135 SeqID 120 SeqID 36 Construct 161 SeqID 46 SeqID 135 SeqID 120 SeqID 36 Construct 162 SeqID 131 SeqID 135 SeqID 120 SeqID 36 Construct 163 SeqID 47 SeqID 135 SeqID 120 SeqID 36 Construct 164 SeqID 132 SeqID 135 SeqID 120 SeqID 36 Construct 165 SeqID 71 SeqID 135 SeqID 120 SeqID 36 Construct 166 SeqID 133 SeqID 135 SeqID 120 SeqID 36 Construct 167 SeqID 53 SeqID 135 SeqID 120 SeqID 36 Construct 168 SeqID 138 SeqID 137 SeqID 120 SeqID 36 Construct 169 SeqID 139 SeqID 137 SeqID 120 SeqID 36 Construct 170 SeqID 140 SeqID 137 SeqID 120 SeqID 36 Construct 171 SeqID 141 SeqID 137 SeqID 120 SeqID 36 Construct 172 SeqID 142 SeqID 137 SeqID 120 SeqID 36 Construct 173 SeqID 143 SeqID 137 SeqID 120 SeqID 36 Construct 174 SeqID 144 SeqID 137 SeqID 120 SeqID 36 Construct 175 SeqID 145 SeqID 137 SeqID 120 SeqID 36 Construct 176 SeqID 146 SeqID 137 SeqID 120 SeqID 36 Construct 177 SeqID 128 SeqID 136 SeqID 122 SeqID 73 Construct 178 SeqID 138 SeqID 136 SeqID 120 SeqID 73 Construct 179 SeqID 138 SeqID 136 SeqID 122 SeqID 77 Construct 180 SeqID 128 SeqID 136 SeqID 122 SeqID 77 Construct 181 SeqID 54 SeqID 147 SeqID 122 SeqID 87 Construct 182 SeqID 128 SeqID 136 SeqID 122 SeqID 87 Construct 183 SeqID 126 SeqID 136 SeqID 122 SeqID 77 Construct 184 SeqID 129 SeqID 136 SeqID 122 SeqID 77 Construct 185 SeqID 54 SeqID 147 SeqID 122 SeqID 77 Construct 186 SeqID 45 SeqID 147 SeqID 122 SeqID 81 Construct 187 SeqID 45 SeqID 147 SeqID 120 SeqID 81 Construct 188 SeqID 133 SeqID 136 SeqID 122 SeqID 77 Construct 189 SeqID 126 SeqID 136 SeqID 122 SeqID 73 Construct 190 SeqID 138 SeqID 136 SeqID 122 SeqID 73 Construct 191 SeqID 45 SeqID 147 SeqID 122 SeqID 87 Construct 192 SeqID 126 SeqID 136 SeqID 122 SeqID 81 Construct 193 SeqID 138 SeqID 136 SeqID 122 SeqID 81 Construct 194 SeqID 138 SeqID 136 SeqID 122 SeqID 87 Construct 195 SeqID 128 SeqID 136 SeqID 122 SeqID 81 Construct 196 SeqID 54 SeqID 147 SeqID 122 SeqID 81 Construct 197 SeqID 126 SeqID 136 SeqID 120 SeqID 81 Construct 198 SeqID 138 SeqID 136 SeqID 120 SeqID 81 Construct 199 SeqID 129 SeqID 136 SeqID 122 SeqID 73 Construct 200 SeqID 128 SeqID 147 SeqID 122 SeqID 77 Construct 201 SeqID 128 SeqID 147 SeqID 122 SeqID 81 Construct 202 SeqID 128 SeqID 147 SeqID 122 SeqID 73 Construct 203 SeqID 128 SeqID 147 SeqID 122 SeqID 87 Construct 204 SeqID 54 SeqID 147 SeqID 122 SeqID 73 Construct 205 SeqID 133 SeqID 136 SeqID 122 SeqID 87 Construct 206 SeqID 133 SeqID 136 SeqID 122 SeqID 81 Construct 207 SeqID 128 SeqID 136 SeqID 122 SeqID 107 Construct 208 SeqID 129 SeqID 136 SeqID 122 SeqID 109 Construct 209 SeqID 52 SeqID 147 SeqID 122 SeqID 107 Construct 210 SeqID 126 SeqID 136 SeqID 120 SeqID 109 Construct 211 SeqID 128 SeqID 147 SeqID 122 SeqID 109 Construct 212 SeqID 52 SeqID 147 SeqID 122 SeqID 109 Construct 213 SeqID 128 SeqID 147 SeqID 120 SeqID 34 Construct 214 SeqID 128 SeqID 136 SeqID 122 SeqID 109 Construct 215 SeqID 128 SeqID 136 SeqID 120 SeqID 109 Construct 216 SeqID 128 SeqID 147 SeqID 122 SeqID 107 Construct 217 SeqID 52 SeqID 147 SeqID 120 SeqID 109 Construct 218 SeqID 128 SeqID 147 SeqID 120 SeqID 109 Construct 219 SeqID 51 SeqID 147 SeqID 122 SeqID 107 Construct 220 SeqID 52 SeqID 147 SeqID 120 SeqID 34 Construct 221 SeqID 51 SeqID 147 SeqID 120 SeqID 109 Construct 222 SeqID 51 SeqID 147 SeqID 122 SeqID 109 Construct 223 SeqID 126 SeqID 136 SeqID 122 SeqID 109 Construct 224 SeqID 126 SeqID 136 SeqID 122 SeqID 107 Construct 225 SeqID 128 SeqID 136 SeqID 120 SeqID 34 Construct 226 SeqID 126 SeqID 136 SeqID 120 SeqID 34 Construct 227 SeqID 129 SeqID 136 SeqID 120 SeqID 109 Construct 228 SeqID 129 SeqID 136 SeqID 122 SeqID 107 Construct 229 SeqID 129 SeqID 136 SeqID 120 SeqID 34 Construct 230 SeqID 51 SeqID 147 SeqID 120 SeqID 34 Construct 231 SeqID 153 SeqID 148 Construct 232 SeqID 153 SeqID 149 Construct 233 SeqID 153 SeqID 150 SeqID 152 Construct 234 SeqID 153 SeqID 151 SeqID 152 Construct 235 SeqID 154 SeqID 150 SeqID 152 Construct 236 SeqID 154 SeqID 151 SeqID 152 Construct 237 SeqID 155 SeqID 150 SeqID 152 Construct 238 SeqID 155 SeqID 151 SeqID 152 Construct 239 SeqID 157 SeqID 149 Construct 240 SeqID 156 SeqID 149 Construct 241 SeqID 138 SeqID 149 SeqID 120 Construct 242 SeqID 138 SeqID 149 Construct 243 SeqID 138 SeqID 150 SeqID 152 Construct 244 SeqID 138 SeqID 137 SeqID 120 SeqID 73
OTHER EMBODIMENTS
[0238] While the invention has been described in connection with specific embodiments thereof, it will be understood that it is capable of further modifications and this application is intended to cover any variations, uses, or adaptations of the invention following, in general, the principles of the invention and including such departures from the invention that come within known or customary practice within the art to which the invention pertains and may be applied to the essential features hereinbefore set forth, and follows in the scope of the claims. Other embodiments are within the claims.
[0239] All publications, patents, and patent applications cited in this specification are herein incorporated by reference as if each individual publication or patent application were specifically and individually indicated to be incorporated by reference.
TABLE-US-00027 SEQUENCEAPPENDIX SEQIDNO:1-CBDaSfromCannabissativa MKCSTFSFWFVCKIIFFFFSFNIQTSIANPRENFLKCFSQYIPNNATNLKLVYTQNNPLYM SVLNSTIHNLRFTSDTTPKPLVIVTPSHVSHIQGTILCSKKVGLQIRTRSGGHDSEGMSYIS QVPFVIVDLRNMRSIKIDVHSQTAWVEAGATLGEVYYWVNEKNENLSLAAGYCPTVCA GGHFGGGGYGPLMRNYGLAADNIIDAHLVNVHGKVLDRKSMGEDLFWALRGGGAESF GIIVAWKIRLVAVPKSTMFSVKKIMEIHELVKLVNKWQNIAYKYDKDLLLMTHFITRNIT DNQGKNKTAIHTYFSSVFLGGVDSLVDLMNKSFPELGIKKTDCRQLSWIDTIIFYSGVVN YDTDNFNKEILLDRSAGQNGAFKIKLDYVKKPIPESVFVQILEKLYEEDIGAGMYALYPY GGIMDEISESAIPFPHRAGILYELWYICSWEKQEDNEKHLNWIRNIYNFMTPYVSKNPRL AYLNYRDLDIGINDPKNPNNYTQARIWGEKYFGKNFDRLVKVKTLVDPNNFFRNEQSIP PLPRHRH SEQIDNO:2-PEP4signalsequencefromKomagataellapastoris MIFDGTTMSIAIGLLSTLGIGAEA SEQIDNO:3-N-terminaltruncation(?1-20)CBDaSfromCannabissativa FNIQTSIANPRENFLKCFSQYIPNNATNLKLVYTQNNPLYMSVLNSTIHNLRFTSDTTPKP LVIVTPSHVSHIQGTILCSKKVGLQIRTRSGGHDSEGMSYISQVPFVIVDLRNMRSIKIDV HSQTAWVEAGATLGEVYYWVNEKNENLSLAAGYCPTVCAGGHFGGGGYGPLMRNYG LAADNIIDAHLVNVHGKVLDRKSMGEDLFWALRGGGAESFGIIVAWKIRLVAVPKSTM FSVKKIMEIHELVKLVNKWQNIAYKYDKDLLLMTHFITRNITDNQGKNKTAIHTYFSSVF LGGVDSLVDLMNKSFPELGIKKTDCRQLSWIDTIIFYSGVVNYDTDNFNKEILLDRSAGQ NGAFKIKLDYVKKPIPESVFVQILEKLYEEDIGAGMYALYPYGGIMDEISESAIPFPHRAG ILYELWYICSWEKQEDNEKHLNWIRNIYNFMTPYVSKNPRLAYLNYRDLDIGINDPKNP NNYTQARIWGEKYFGKNFDRLVKVKTLVDPNNFFRNEQSIPPLPRHRH SEQIDNO:4-N-terminaltruncation(?1-21)CBDaSfromCannabissativa NIQTSIANPRENFLKCFSQYIPNNATNLKLVYTQNNPLYMSVLNSTIHNLRFTSDTTPKPL VIVTPSHVSHIQGTILCSKKVGLQIRTRSGGHDSEGMSYISQVPFVIVDLRNMRSIKIDVHS QTAWVEAGATLGEVYYWVNEKNENLSLAAGYCPTVCAGGHFGGGGYGPLMRNYGLA ADNIIDAHLVNVHGKVLDRKSMGEDLFWALRGGGAESFGIIVAWKIRLVAVPKSTMFS VKKIMEIHELVKLVNKWQNIAYKYDKDLLLMTHFITRNITDNQGKNKTAIHTYFSSVFL GGVDSLVDLMNKSFPELGIKKTDCRQLSWIDTIIFYSGVVNYDTDNFNKEILLDRSAGQN GAFKIKLDYVKKPIPESVFVQILEKLYEEDIGAGMYALYPYGGIMDEISESAIPFPHRAGIL YELWYICSWEKQEDNEKHLNWIRNIYNFMTPYVSKNPRLAYLNYRDLDIGINDPKNPNN YTQARIWGEKYFGKNFDRLVKVKTLVDPNNFFRNEQSIPPLPRHRH SEQIDNO:5-N-terminaltruncation(?1-22)CBDaSfromCannabissativa IQTSIANPRENFLKCFSQYIPNNATNLKLVYTQNNPLYMSVLNSTIHNLRFTSDTTPKPLV IVTPSHVSHIQGTILCSKKVGLQIRTRSGGHDSEGMSYISQVPFVIVDLRNMRSIKIDVHSQ TAWVEAGATLGEVYYWVNEKNENLSLAAGYCPTVCAGGHFGGGGYGPLMRNYGLAA DNIIDAHLVNVHGKVLDRKSMGEDLFWALRGGGAESFGIIVAWKIRLVAVPKSTMFSV KKIMEIHELVKLVNKWQNIAYKYDKDLLLMTHFITRNITDNQGKNKTAIHTYFSSVFLG GVDSLVDLMNKSFPELGIKKTDCRQLSWIDTIIFYSGVVNYDTDNFNKEILLDRSAGQNG AFKIKLDYVKKPIPESVFVQILEKLYEEDIGAGMYALYPYGGIMDEISESAIPFPHRAGILY ELWYICSWEKQEDNEKHLNWIRNIYNFMTPYVSKNPRLAYLNYRDLDIGINDPKNPNNY TQARIWGEKYFGKNFDRLVKVKTLVDPNNFFRNEQSIPPLPRHRH SEQIDNO:6-N-terminaltruncation(?1-23)CBDaSfromCannabissativa QTSIANPRENFLKCFSQYIPNNATNLKLVYTQNNPLYMSVLNSTIHNLRFTSDTTPKPLVI VTPSHVSHIQGTILCSKKVGLQIRTRSGGHDSEGMSYISQVPFVIVDLRNMRSIKIDVHSQ TAWVEAGATLGEVYYWVNEKNENLSLAAGYCPTVCAGGHFGGGGYGPLMRNYGLAA DNIIDAHLVNVHGKVLDRKSMGEDLFWALRGGGAESFGIIVAWKIRLVAVPKSTMFSV KKIMEIHELVKLVNKWQNIAYKYDKDLLLMTHFITRNITDNQGKNKTAIHTYFSSVFLG GVDSLVDLMNKSFPELGIKKTDCRQLSWIDTIIFYSGVVNYDTDNFNKEILLDRSAGQNG AFKIKLDYVKKPIPESVFVQILEKLYEEDIGAGMYALYPYGGIMDEISESAIPFPHRAGILY ELWYICSWEKQEDNEKHLNWIRNIYNFMTPYVSKNPRLAYLNYRDLDIGINDPKNPNNY TQARIWGEKYFGKNFDRLVKVKTLVDPNNFFRNEQSIPPLPRHRH SEQIDNO:7-N-terminaltruncation(?1-25)CBDaSfromCannabissativa SIANPRENFLKCFSQYIPNNATNLKLVYTQNNPLYMSVLNSTIHNLRFTSDTTPKPLVIVT PSHVSHIQGTILCSKKVGLQIRTRSGGHDSEGMSYISQVPFVIVDLRNMRSIKIDVHSQTA WVEAGATLGEVYYWVNEKNENLSLAAGYCPTVCAGGHFGGGGYGPLMRNYGLAADN IIDAHLVNVHGKVLDRKSMGEDLFWALRGGGAESFGIIVAWKIRLVAVPKSTMFSVKKI MEIHELVKLVNKWQNIAYKYDKDLLLMTHFITRNITDNQGKNKTAIHTYFSSVFLGGVD SLVDLMNKSFPELGIKKTDCRQLSWIDTIIFYSGVVNYDTDNFNKEILLDRSAGQNGAFK IKLDYVKKPIPESVFVQILEKLYEEDIGAGMYALYPYGGIMDEISESAIPFPHRAGILYEL WYICSWEKQEDNEKHLNWIRNIYNFMTPYVSKNPRLAYLNYRDLDIGINDPKNPNNYT QARIWGEKYFGKNFDRLVKVKTLVDPNNFFRNEQSIPPLPRHRH SEQIDNO:8-N-terminaltruncation(?1-26)CBDaSfromCannabissativa IANPRENFLKCFSQYIPNNATNLKLVYTQNNPLYMSVLNSTIHNLRFTSDTTPKPLVIVTP SHVSHIQGTILCSKKVGLQIRTRSGGHDSEGMSYISQVPFVIVDLRNMRSIKIDVHSQTA WVEAGATLGEVYYWVNEKNENLSLAAGYCPTVCAGGHFGGGGYGPLMRNYGLAADN IIDAHLVNVHGKVLDRKSMGEDLFWALRGGGAESFGIIVAWKIRLVAVPKSTMFSVKKI MEIHELVKLVNKWQNIAYKYDKDLLLMTHFITRNITDNQGKNKTAIHTYFSSVFLGGVD SLVDLMNKSFPELGIKKTDCRQLSWIDTIIFYSGVVNYDTDNFNKEILLDRSAGQNGAFK IKLDYVKKPIPESVFVQILEKLYEEDIGAGMYALYPYGGIMDEISESAIPFPHRAGILYEL WYICSWEKQEDNEKHLNWIRNIYNFMTPYVSKNPRLAYLNYRDLDIGINDPKNPNNYT QARIWGEKYFGKNFDRLVKVKTLVDPNNFFRNEQSIPPLPRHRH SEQIDNO:9-N-terminaltruncation(?1-27)CBDaSfromCannabissativa ANPRENFLKCFSQYIPNNATNLKLVYTQNNPLYMSVLNSTIHNLRFTSDTTPKPLVIVTPS HVSHIQGTILCSKKVGLQIRTRSGGHDSEGMSYISQVPFVIVDLRNMRSIKIDVHSQTAW VEAGATLGEVYYWVNEKNENLSLAAGYCPTVCAGGHFGGGGYGPLMRNYGLAADNII DAHLVNVHGKVLDRKSMGEDLFWALRGGGAESFGIIVAWKIRLVAVPKSTMFSVKKIM EIHELVKLVNKWQNIAYKYDKDLLLMTHFITRNITDNQGKNKTAIHTYFSSVFLGGVDS LVDLMNKSFPELGIKKTDCRQLSWIDTIIFYSGVVNYDTDNFNKEILLDRSAGQNGAFKI KLDYVKKPIPESVFVQILEKLYEEDIGAGMYALYPYGGIMDEISESAIPFPHRAGILYELW YICSWEKQEDNEKHLNWIRNIYNFMTPYVSKNPRLAYLNYRDLDIGINDPKNPNNYTQA RIWGEKYFGKNFDRLVKVKTLVDPNNFFRNEQSIPPLPRHRH SEQIDNO:10-N-terminaltruncation(?1-28)CBDaSfromCannabissativa NPRENFLKCFSQYIPNNATNLKLVYTQNNPLYMSVLNSTIHNLRFTSDTTPKPLVIVTPSH VSHIQGTILCSKKVGLQIRTRSGGHDSEGMSYISQVPFVIVDLRNMRSIKIDVHSQTAWV EAGATLGEVYYWVNEKNENLSLAAGYCPTVCAGGHFGGGGYGPLMRNYGLAADNIID AHLVNVHGKVLDRKSMGEDLFWALRGGGAESFGIIVAWKIRLVAVPKSTMFSVKKIME IHELVKLVNKWQNIAYKYDKDLLLMTHFITRNITDNQGKNKTAIHTYFSSVFLGGVDSL VDLMNKSFPELGIKKTDCRQLSWIDTIIFYSGVVNYDTDNFNKEILLDRSAGQNGAFKIK LDYVKKPIPESVFVQILEKLYEEDIGAGMYALYPYGGIMDEISESAIPFPHRAGILYELWY ICSWEKQEDNEKHLNWIRNIYNFMTPYVSKNPRLAYLNYRDLDIGINDPKNPNNYTQAR IWGEKYFGKNFDRLVKVKTLVDPNNFFRNEQSIPPLPRHRH SEQIDNO:11-N-terminaltruncation(?1-29)CBDaSfromCannabissativa PRENFLKCFSQYIPNNATNLKLVYTQNNPLYMSVLNSTIHNLRFTSDTTPKPLVIVTPSHV SHIQGTILCSKKVGLQIRTRSGGHDSEGMSYISQVPFVIVDLRNMRSIKIDVHSQTAWVE AGATLGEVYYWVNEKNENLSLAAGYCPTVCAGGHFGGGGYGPLMRNYGLAADNIIDA HLVNVHGKVLDRKSMGEDLFWALRGGGAESFGIIVAWKIRLVAVPKSTMFSVKKIMEI HELVKLVNKWQNIAYKYDKDLLLMTHFITRNITDNQGKNKTAIHTYFSSVFLGGVDSLV DLMNKSFPELGIKKTDCRQLSWIDTIIFYSGVVNYDTDNFNKEILLDRSAGQNGAFKIKL DYVKKPIPESVFVQILEKLYEEDIGAGMYALYPYGGIMDEISESAIPFPHRAGILYELWYI CSWEKQEDNEKHLNWIRNIYNFMTPYVSKNPRLAYLNYRDLDIGINDPKNPNNYTQARI WGEKYFGKNFDRLVKVKTLVDPNNFFRNEQSIPPLPRHRH SEQIDNO:12-N-terminaltruncation(?1-30)CBDaSfromCannabissativa RENFLKCFSQYIPNNATNLKLVYTQNNPLYMSVLNSTIHNLRFTSDTTPKPLVIVTPSHVS HIQGTILCSKKVGLQIRTRSGGHDSEGMSYISQVPFVIVDLRNMRSIKIDVHSQTAWVEA GATLGEVYYWVNEKNENLSLAAGYCPTVCAGGHFGGGGYGPLMRNYGLAADNIIDAH LVNVHGKVLDRKSMGEDLFWALRGGGAESFGIIVAWKIRLVAVPKSTMFSVKKIMETHE LVKLVNKWQNIAYKYDKDLLLMTHFITRNITDNQGKNKTAIHTYFSSVFLGGVDSLVDL MNKSFPELGIKKTDCRQLSWIDTIIFYSGVVNYDTDNFNKEILLDRSAGQNGAFKIKLDY VKKPIPESVFVQILEKLYEEDIGAGMYALYPYGGIMDEISESAIPFPHRAGILYELWYICS WEKQEDNEKHLNWIRNIYNFMTPYVSKNPRLAYLNYRDLDIGINDPKNPNNYTQARIW GEKYFGKNFDRLVKVKTLVDPNNFFRNEQSIPPLPRHRH SEQIDNO:13-N-terminaltruncation(?1-31)CBDaSfromCannabissativa ENFLKCFSQYIPNNATNLKLVYTQNNPLYMSVLNSTIHNLRFTSDTTPKPLVIVTPSHVSH IQGTILCSKKVGLQIRTRSGGHDSEGMSYISQVPFVIVDLRNMRSIKIDVHSQTAWVEAG ATLGEVYYWVNEKNENLSLAAGYCPTVCAGGHFGGGGYGPLMRNYGLAADNIIDAHL VNVHGKVLDRKSMGEDLFWALRGGGAESFGIIVAWKIRLVAVPKSTMFSVKKIMEIHEL VKLVNKWQNIAYKYDKDLLLMTHFITRNITDNQGKNKTAIHTYFSSVFLGGVDSLVDL MNKSFPELGIKKTDCRQLSWIDTIIFYSGVVNYDTDNFNKEILLDRSAGQNGAFKIKLDY VKKPIPESVFVQILEKLYEEDIGAGMYALYPYGGIMDEISESAIPFPHRAGILYELWYICS WEKQEDNEKHLNWIRNIYNFMTPYVSKNPRLAYLNYRDLDIGINDPKNPNNYTQARIW GEKYFGKNFDRLVKVKTLVDPNNFFRNEQSIPPLPRHRH SEQIDNO:14-N-terminaltruncation(?1-32)CBDaSfromCannabissativa NFLKCFSQYIPNNATNLKLVYTQNNPLYMSVLNSTIHNLRFTSDTTPKPLVIVTPSHVSHI QGTILCSKKVGLQIRTRSGGHDSEGMSYISQVPFVIVDLRNMRSIKIDVHSQTAWVEAGA TLGEVYYWVNEKNENLSLAAGYCPTVCAGGHFGGGGYGPLMRNYGLAADNIIDAHLV NVHGKVLDRKSMGEDLFWALRGGGAESFGIIVAWKIRLVAVPKSTMFSVKKIMEIHELV KLVNKWQNIAYKYDKDLLLMTHFITRNITDNQGKNKTAIHTYFSSVFLGGVDSLVDLM NKSFPELGIKKTDCRQLSWIDTIIFYSGVVNYDTDNFNKEILLDRSAGQNGAFKIKLDYV KKPIPESVFVQILEKLYEEDIGAGMYALYPYGGIMDEISESAIPFPHRAGILYELWYICSW EKQEDNEKHLNWIRNIYNFMTPYVSKNPRLAYLNYRDLDIGINDPKNPNNYTQARIWGE KYFGKNFDRLVKVKTLVDPNNFFRNEQSIPPLPRHRH SEQIDNO:15-CBDaSnaturaldiversityvariantfromCannabissativa NPRENFLKCFSQYIPNNATNLKLVYTQNNPLYMSVLNSTIHNLRFTSDTTPKPLVIVTPSH VSHIQGTILCSKKVGLQIRTRSGGHDSEGMSYISQVPFVIVDLRNMRSIKIDVHSQTAWV EAGATLGEVYYWVNEKNENLSLAAGYCPTVCAGGHFGGGGYGPLMRNYGLAADNIID AHLVNVHGKVLDRKSMGEDLFWALRGGGAESFGIIVAWKIRLVAVPKSTMFSVKKIME IHELVKLVNKWQNIAYKYDKDLLLMTHFITRNITDNQGKNKTAIHTYFSSVFLGGVDSL VDLMNKSFPELGIKKTDCRQLSWIDTIIFYSGVVNYDTDNFNKEILLDRSAGQNGAFKIK LDYVKKPIPESVFVQILEKLYEEDIGAGMYALYPYGGIMDEISESAIPFPHRAGILYELWY ICSWEKQEDNEKHLNWIRNIYNFMTPYVSKNPRLAYLNYRDLDIGINDPKNPNNYTQAR IWGEKYFGKNFDRLVKVKTLVDPNNFFRNEQSIPPQPRHRH* SEQIDNO:16-CBDaSnaturaldiversityvariantfromCannabissativa NPRENFLKCFSQYIPNNATNLKLVYTQNNPLYMSVLNSTIHNLRFTSDTTPKPLVIVTPSH VSHIQGTILCSKKVGLQIRTRSGGHDSEGMSYISQVPFVIVDLRNMRSIKIDVHSQTAWV EAGATLGEVYYWVNEKNENLSLAAGYCPTVCAGGHFGGGGYGPLMRNYGLAADNIID AHLVNVHGKVLDRKSMGEDLFWALRGGGAESFGIIVAWKIRLVAVPKSTMFSVKKIME IHELVKLVNKWQNIAYKYDKDLLLMTHFITRNITDNQGKNKTAIHTYFSSVFLGGVDSL VDLMNKSFPELGIKKTDCRQLSWIDTIIFYSGVVNYDTDNFNKEILLDRSAGQNGAFKIK LDYVKKPIPESVFVQILEKLYEEDIGAGMYALYPYGGIMDEISESAIPFPHRAGILYELWY ICSWEKQEDNEKHLNWIRNIYNFMTPYVSKNSRLAYLNYRDLDIGINDPKNPNNYTQAR IWGEKYFGKNFDRLVKVKTLVDPNNFFRNEQSIPPLPRHRH* SEQIDNO:17-CBDaSnaturaldiversityvariantfromCannabissativa NPRENFLKCFSQYIPNNATNLKLVYTQNNPLYMSVLNSTIHNLRFTSDTTPKPLVIVTPSH VSHIQGTILCSKKVGLQIRTRSGGHDSEGMSYISQVPFVIVDLRNMRSIKIDVRSQTAWV EAGATLGEVYYWVNEKNENLSLAAGYCPTVCAGGHFGGGGYGPLMRNYGLAADNIID AHLVNVHGKVLDRKSMGEDLFWALRGGGAESFGIIVAWKIRLVAVPKSTMFSVKKIME IHELVKLVNKWQNIAYKYDKDLLLMTHFITRNITDNQGKNKTAIHTYFSSVFLGGVDSL VDLMNKSFPELGIKKTDCRQLSWIDTIIFYSGVVNYDTDNFNKEILLDRSAGQNGAFKIK LDYVKKPIPESVFVQILEKLYEEDIGAGMYALYPYGGIMDEISESAIPFPHRAGILYELWY ICSWEKQEDNEKHLNWIRNIYNFMTPYVSKNPRLAYLNYRDLDIGINDPKNPNNYTQAR IWGEKYFGKNFDRLVKVKTLVDPNNFFRNEQSIPPLPRHRH* SEQIDNO:18-CBDaSnaturaldiversityvariantfromCannabissativa NPRENFLKCFSQYIPNNATNLKLVYTQNNPLYMSVLNSTIHNLRFTSDTTPKPLVIVTPSH VSHIQGTILCSKKVGLQIRTRSGGHDSEGMSYISQVPFVIVDLRNMRSIKIDVHSQTAWV EAGATLGEVYYWVNEKNENLSLAAGYCPTVCAGGHFGGGGYGPLMRNYGLAADNIID AHLVNVHGKVLDRKSMGEDLFWALRGGGAESFGIIVAWKIRLVAVPKSTMFSVKKIME IHELVKLVNKWQNIAYKYDKDLLLMTHFITRNITDNQGKNKTAIHTYFSSVFLGGVDSL VDLMNKSFPELGIKKTDCRQLSWIDTIIFYSGVVNYDTDNFNKEILLDRSAGQNGAFKIK LDYVKKPIPESVFVQILEKLYEEDIGAGMYALYPYGGIMDEISESAIPFPHRAGILYELWY ICSWEKQEDNEKHLNWIRNIYNFMTPYVSKNSRLAYLNYRDLDIGINDPKNPNNYTQAR IWGEKYFGKNFDRLVKVKTLVDPNNFFRNEQSIPPQPRHRH* SEQIDNO:19-CBDaSnaturaldiversityvariantfromCannabissativa NPRENFLKCFSQYIPNNATNLKLVYTQNNPLYMSVLNSTIHNLRFSSDTTPKPLVIVTPSH VSHIQGTILCSKKVGLQIRTRSGGHDSEGMSYISQVPFVIVDLRNMRSIKIDVHSQTAWV EAGATLGEVYYWVNEKNESLSLAAGYCPTVCAGGHFGGGGYGPLMRSYGLAADNIID AHLVNVHGKVLDRKSMGEDLFWALRGGGAESFGIIVAWKIRLVAVPKSTMFSVKKIME IHELVKLVNKWQNIAYKYDKDLLLMTHFITRNITDNQGKNKTAIHTYFSSVFLGGVDSL VDLMNKSFPELGIKKTDCRQLSWIDTIIFYSGVVNYDTDNFNKEILLDRSAGQNGAFKIK LDYVKKPIPESVFVQILEKLYEEDIGAGMYALYPYGGIMDEISESAIPFPHRAGILYELWY ICSWEKQEDNEKHLNWIRNIYNFMTPYVSQNPRLAYLNYRDLDIGINDPKNPNNYTQAR IWGEKYFGKNFDRLVKVKTLVDPNNFFRNEQSIPPLPRHRH* SEQIDNO:20-CBDaSnaturaldiversityvariantfromCannabissativa NPRENFLKCFSQYIPNNATNLKLVYTQNNPLYMSVLNSTIHNLRFSSDTTPKPLVIVTPSH VSHIQGTILCSKKVGLQIRTRSGGHDSEGMSYISQVPFVIVDLRNMRSIKIDVHSQTAWV EAGATLGEVYYWVNEKNESLSLAAGYCPTVCAGGHFGGGGYGPLMRSYGLAADNIID AHLVNVHGKVLDRKSMGEDLFWALRGGGAESFGIIVAWKIRLVAVPKSTMFSVKKIME IHELVKLVNKWQNIAYKYDKDLLLMTHFITRNITDNQGKNKTAIHTYFSSVFLGGVDSL VDLMNKSFPELGIKKTDCRQLSWIDTIIFYSGVVNYDTDNFNKEILLDRSAGQNGAFKIK LDYVKKPIPESVFVQILEKLYEEDIGAGMYALYPYGGIMDEISESAIPFPHRAGILYELWY ICSWEKQEDNEKHLNWIRNIYNFMTPYVSQNPRLAYLNYRDLDIRINDPKNPNNYTQAR IWGEKYFGKNFDRLVKVKTLVDPNNFFRNEQSIPPLPRHRH* SEQIDNO:21-CBDaSnaturaldiversityvariantfromCannabissativa NPRENFLKCFSQYIPNNATNLKLVYTQNNPLYMSVLNSTIHNLRFSSDTTPKPLVIVTPSH VSHIQGTILCSKKVGLQIRTRSGGHDSEGMSYISQVPFVIVDLRNMRSIKIDVHSQTAWV EAGATLGEVYYWVNEKNESLSLAAGYCPTVCAGGHFGGGGYGPLMRSYGLAADNIID AHLVNVHGKVLDRKSMGEDLFWALRGGGAESFGIIVAWKIRLVAVPKSTMFSVKKIME IHELVKLVNKWQNIAYKYDKDLLLMTHFITRNITDNQGKNKTAIHTYFSSVFLGGVDSL VDLMNKSFPELGIKKTDCRQLSWIDTIIFYSGVVNYDTDNFNKEILLDRSARQNGAFKIK LDYVKKPIPESVFVQILEKLYEEDIGAGMYALYPYGGIMDEISESAIPFPHRAGILYELWY ICSWEKQEDNEKHLNWIRNIYNFMTPYVSQNPRLAYLNYRDLDIGINDPKNPNNYTQAR IWGEKYFGKNFDRLVKVKTLVDPNNFFRNEQSIPPLPRHRH* SEQIDNO:22-CBDaSnaturaldiversityvariantfromCannabissativa NPRENFLKCFSQYIPNNATNLKLVYTQNNPLYMSVLNSTIHNLRFTSDTTPKPLVIVTPSH VSHIQGTILCSKKVGLQIRTRSGGHDSEGMSYISQVPFVIVDLRNMRSIKIDVHSQTAWV EAGATLGEVYYWVNEKNENLSLAAGYCPTVCAGGHFGGGGYGPLMRNYGLAADNIID AHLVNVHGKVLDRKSMGEDLFWALRGGGAESFGIIVAWKIRLVAVPKSTMFSVKKIME IHELVKLVNKWQNIAYKYDKDLLLMTHFITRNITDNQGKNKTAIHTYFSSVFLGGVDSL VDLMNKSFPELGIKKTDCRQLSWIDTIIFYSGVVNYDTDNFNKEILLDRSAGQNGAFKIK LDYVKKPIPESVFVQILEKLYEEDIGAGMYALYPYGGIMDEISESAIPFPHRAGILYELWY ICSWEKQEDNEKHLNWIRNIYNFMTPHVSQNSRLAYINYRDLDIGINDPKNPNNYTQARI WGEKYFGKNFDRLVKVKTLVDPNNFFRNEQSIPPLPRHRH* SEQIDNO:23-CBDaSnaturaldiversityvariantfromCannabissativa NPRENFLKCFSQYIPNNATNLKLVYTQNNPLYMSVLNSTIHNLRFSSDTTPKPLVIVTPSH VSHIQGTILCSKKVGLQIRTRSGGHDSEGMSYISQVPFVIVDLRNMRSIKIDVHSQTAWV EAGATLGEVYYWVNEKNESLSLAAGYCPTVCAGGHFGGGGYGPLMRSYGLAADNIID AHLVNVHGKVLDRKSMGEDLFWALRGGGAESFGIIVAWKIRLVAVPKSTMFSVKKIME IHELVKLVNKWQNIAYKYDKDLLLMTHFITRNITDNQGKNKTAIHTYFSSVFLGGVDSL VDLMNKSFPELGIKKTDCRQLSWIDTIIFYSGVVNYDTDNFNKEILLDRSAGQNGAFKIK LDYVKKPIPESVFVQILEKLYEEDIGAGMYALYPYGGIMDEISESAIPFPHRAGILYELWY ICSWEKQEDNEKHLNWIRNIYNFMTPYVSQNPRLAYLNYRDLDIGINDPKHPNNPTHARI RAQKYFRQNFDKLVKVKTLVDPNNFFRNEQSIPPLPRHRH* SEQIDNO:24-FLO1carrierproteinfromSaccharomycescerevisiae MTMPHRYMFLAVETLLALTSVASGATEACLPAGQRKSGMNINFYQYSLKDSSTYSNAA YMAYGYASKTKLGSVGGQTDISIDYNIPCVSSSGTFPCPQEDSYGNWGCKGMGACSNS QGIAYWSTDLFGFYTTPTNVTLEMTGYFLPPQTGSYTFKFATVDDSAILSVGGATAFNC CAQQQPPITSTNFTIDGIKPWGGSLPPNIEGTVYMYAGYYYPMKVVYSNAVSWGTLPIS VTLPDGTTVSDDFEGYVYSFDDDLSQSNCTVPDPSNYAVSTTTTTTEPWTGTFTSTSTEM TTVTGTNGVPTDETVIVIRTPTTASTIITTTEPWNSTFTSTSTELTTVTGTNGVRTDETIIVI RTPTTATTAITTTEPWNSTFTSTSTELTTVTGTNGLPTDETIIVIRTPTTATTAMTTTQPWN DTFTSTSTELTTVTGTNGLPTDETIIVIRTPTTATTAMTTTQPWNDTFTSTSTELTTVTGTN GLPTDETIIVIRTPTTATTAMTTTQPWNDTFTSTSTEITTVTGTNGLPTDETIIVIRTPTTAT TAMTTPQPWNDTFTSTSTEMTTVTGTNGLPTDETIIVIRTPTTATTAITTTEPWNSTFTSTS TEMTTVTGTNGLPTDETIIVIRTPTTATTAITTTQPWNDTFTSTSTEMTTVTGTNGLPTDE TIIVIRTPTTATTAMTTTQPWNDTFTSTSTEITTVTGTTGLPTDETIIVIRTPTTATTAMTTT QPWNDTFTSTSTEMTTVTGTNGVPTDETVIVIRTPTSEGLISTTTEPWTGTFTSTSTEMTT VTGTNGQPTDETVIVIRTPTSEGLVTTTTEPWTGTFTSTSTEMTTITGTNGVPTDETVIVIR TPTSEGLISTTTEPWTGTFTSTSTEMTTITGTNGQPTDETVIVIRTPTSEGLISTTTEPWTGT FTSTSTEMTHVTGTNGVPTDETVIVIRTPTSEGLISTTTEPWTGIFTSTSTEVTTITGTNGQ PTDETVIVIRTPTSEGLISTTTEPWTGTFTS SEQIDNO:25-PIR1carrierproteinfromSaccharomycescerevisiae MQYKKSLVASALVATSLAAYAPKDPWSTLTPSATYKGGITDYSSTFGIAVEPIATTASSK AKRAAAISQIGDGQIQATTKTTAAAVSQIGDGQIQATTKTKAAAVSQIGDGQIQATTKTT SAKTTAAAVSQIGDGQIQATTKTKAAAVSQIGDGQIQATTKTTAAAVSQIGDGQIQATT KTTAAAVSQIGDGQIQATTNTTVAPVSQITDGQIQATTLTSATIIPSPAPAPITNGTDPVTA ETCKSSGTLEMNLKGGILTDGKGRIGSIVANRQFQFDGPPPQAGAIYAAGWSITPEGNLA IGDQDTFYQCLSGNFYNLYDEHIGTQCNAVHLQAIDLLNC SEQIDNO:26-PIR2carrierproteinfromSaccharomycescerevisiae MQYKKTLVASALAATTLAAYAPSEPWSTLTPTATYSGGVTDYASTFGIAVQPISTTSSAS SAATTASSKAKRAASQIGDGQVQAATTTASVSTKSTAAAVSQIGDGQIQATTKTTAAAV SQIGDGQIQATTKTTSAKTTAAAVSQISDGQIQATTTTLAPKSTAAAVSQIGDGQVQATT TTLAPKSTAAAVSQIGDGQVQATTKTTAAAVSQIGDGQVQATTKTTAAAVSQIGDGQV QATTKTTAAAVSQIGDGQVQATTKTTAAAVSQITDGQVQATTKTTQAASQVSDGQVQA TTATSASAAATSTDPVDAVSCKTSGTLEMNLKGGILTDGKGRIGSIVANRQFQFDGPPPQ AGAIYAAGWSITPDGNLAIGDNDVFYQCLSGTFYNLYDEHIGSQCTPVHLEAIDLIDC SEQIDNO:27-PIR3carrierproteinfromSaccharomycescerevisiae MQYKKPLVVSALAATSLAAYAPKDPWSTLTPSATYKGGITDYSSSFGIAIEAVATSASSV ASSKAKRAASQIGDGQVQAATTTAAVSKKSTAAAVSQITDGQVQAAKSTAAAVSQITD GQVQAAKSTAAAVSQITDGQVQAAKSTAAAVSQITDGQVQAAKSTAAAASQISDGQVQ ATTSTKAAASQITDGQIQASKTTSGASQVSDGQVQATAEVKDANDPVDVVSCNNNSTL SMSLSKGILTDRKGRIGSIVANRQFQFDGPPPQAGAIYAAGWSITPEGNLALGDQDTFYQ CLSGDFYNLYDKHIGSQCHEVYLQAIDLIDC SEQIDNO:28-PIR4carrierproteinfromSaccharomycescerevisiae MQFKNVALAASVAALSATASAEGYTPGEPWSTLTPTGSISCGAAEYTTTFGIAVQAITSS KAKRDVISQIGDGQVQATSAATAQATDSQAQATTTATPTSSEKISSSASKTSTNATSSSC ATPSLKDSSCKNSGTLELTLKDGVLTDAKGRIGSIVANRQFQFDGPPPQAGAIYAAGWSI TEDGYLALGDSDVFYQCLSGNFYNLYDQNVAEQCSAIHLEAVSLVDC SEQIDNO:29-AGA1carrierproteinfromSaccharomycescerevisiae TVVSSSAIEPSSASIISPVTSTLSSTTSSNPTTTSLSSTSTSPSSTSTSPSSTSTSSSSTSTSSSST STSSSSTSTSPSSTSTSSSLTSTSSSSTSTSQSSTSTSSSSTSTSPSSTSTSSSSTSTSPSSKSTSA SSTSTSSYSTSTSPSLTSSSPTLASTSPSSTSISSTFTDSTSSLGSSIASSSTSVSLYSPSTPVYS VPSTSSNVATPSMTSSTVETTVSSQSSSEYITKSSISTTIPSFSMSTYFTTVSGVTTMYTTW CPYSSESETSTLTSMHETVTTDATVCTHESCMPSQTTSLITSSIKMSTKNVATSVSTSTVE SSYACSTCAETSHSYSSVQTASSSSVTQQTTSTKSWVSSMTTSDEDENKHATGKYHVTS SGTSTISTSVSEATSTSSIDSESQEQSSHLLSTSVLSSSSLSATLSSDSTILLFSSVSSLSVEQS PVTTLQISSTSEILQPTSSTAIATISASTSSLSATSISTPSTSVESTIESSSLTPTVSSIFLSSSSA PSSLQTSVTTTEVSTTSISIQYQTSSMVTISQYMGSGSQTRLPLGKLVFAIMAVACNVIFS SEQIDNO:30-CCW12carrierproteinfromSaccharomycescerevisiae VDDVITQYTTWCPLTTEAPKNGTSTAAPVTSTEAPKNTTSAAPTHSVTSYTGAAAKALP AAGALLAGAAALLL SEQIDNO:31-CWP1carrierproteinfromSaccharomycescerevisiae LVSIRSGSDLQYLSVYSDNGTLKLGSGSGSFEATITDDGKLKFDDDKYAVVNEDGSFKE GSESDAATGFSIKDGHLNYKSSSGFYAIKDGSSYIFSSKQSDDATGVAIRPTSKSGSVAAD FSPSDSSSSSSASASSASASSSTKHSSSIESVETSTTVETSSASSPTASVISQITDGQIQAPNT VYEQTENAGAKAAVGMGAGALAVAAAYLL SEQIDNO:32-CWP2carrierproteinfromSaccharomycescerevisiae ISQITDGQIQATTTATTEATTTAAPSSTVETVSPSSTETISQQTENGAAKAAVGMGAGAL AAAAMLL SEQIDNO:33-DAN4carrierproteinfromSaccharomycescerevisiae SVASFASSSPLLVSSRSNCSDARSSNTISSGLFSTIENVRNATSTFTNLSTDEIVITSCKSSCT NEDSVLTKTQVSTVETTITSCSGGICTTLMSPVTTINAKANTLTTTETSTVETTITTCPGGV CSTLTVPVTTITSEATTTATISCEDNEEDITSTETELLTLETTITSCSGGICTTLMSPVTTINA KANTLTTTETSTVETTITTCSGGVCSTLTVPVTTITSEATTTATISCEDNEEDVASTKTELL TMETTITSCSGGICTTLMSPVSSFNSKATTSNNAESTIPKAIKVSCSAGACTTLTTVDAGIS MFTRTGLSITQTTVTNCSGGTCTMLTAPIATATSKVISPIPKASSATSIAHSSASYTVSINT NGAYNFDKDNIFGTAIVAVVALLLL SEQIDNO:34-FLO5carrierproteinfromSaccharomycescerevisiae FYPSNGTSVISSSVISSSVTSSLVTSSSFISSSVISSSTTTSTSIFSESSTSSVIPTSSSTSGSSES KTSSASSSSSSSSISSESPKSPTNSSSSLPPVTSATTGQETASSLPPATTTKTSEQTTLVTVTS CESHVCTESISSAIVSTATVTVSGVTTEYTTWCPISTTETTKQTKGTTEQTKGTTEQTTET TKQTTVVTISSCESDICSKTASPAIVSTSTATINGVTTEYTTWCPISTTESKQQTTLVTVTS CESGVCSETTSPAIVSTATATVNDVVTVYPTWRPQTTNEQSVSSKMNSATSETTTNTGA AETKTAVTSSLSRFNHAETQTASATDVIGHNNSVVSVSETGNTKSLTSSGLSTMSQQPRS TPASSMVGYSTASLEISTYAGSANSLLAGSGLSVFIASLLLAII SEQIDNO:35-PRY3carrierproteinfromSaccharomycescerevisiae SSTSLGARTTTGSNGRSTTSQQDGSAMHQPTSSIYTQLKEGTSTTAKLSAYEGAATPLSIF QCNSLAGTIAAFVVAVLFAF SEQIDNO:36-SAG1carrierproteinfromSaccharomycescerevisiae SAKSSFISTTTTDLTSINTSAYSTGSISTVETGNRTTSEVISHVVTTSTKLSPTATTSLTIAQT SIYSTDSNITVGTDIHTTSEVISDVETISRETASTVVAAPTSTTGWTGAMNTYISQFTSSSF ATINSTPIISSSAVFETSDASIVNVHTENITNTAAVPSEEPTFVNATRNSLNSFCSSKQPSSP SSYTSSPLVSSLSVSKTLLSTSFTPSVPTSNTYIKTKNTGYFEHTALTTSSVGLNSFSETAV SSQGTKIDTFLVSSLIAYPSSASGSQLSGIQQNFTSTSLMISTYEGKASIFFSAELGSIIFLLL SYLLF SEQIDNO:37-SED1carrierproteinfromSaccharomycescerevisiae ALPTNGTSTEAPTDTTTEAPTTGLPTNGTTSAFPPTTSLPPSNTTTTPPYNPSTDYTTDYTV VTEYTTYCPEPTTFTTNGKTYTVTEPTTLTITDCPCTIEKPTTTSTTEYTVVTEYTTYCPEP TTFTTNGKTYTVTEPTTLTITDCPCTIEKSEAPESSVPVTESKGTTTKETGVTTKQTTANPS LTVSTVVPVSSSASSHSVVINSNGANVVVPGALGLAGVAMLFL SEQIDNO:38-SRP2carrierproteinfromSaccharomycescerevisiae SSEASSSAATSSAVASSSEATSSTVASSTKAASSTKASSSAVSSAVASSTKASAISQISDGQ VQATSTVSEQTENGAAKAVIGMGAGVMAAAAMLL SEQIDNO:39-TIP1carrierproteinfromSaccharomycescerevisiae MTYTDDAYTTLFSELDFDAITKTIVKLPWYTTRLSSEIAAALASVSPASSEAASSSEAASS SKAASSSEATSSAAPSSSAAPSSSAAPSSSAESSSKAVSSSVAPTTSSVSTSTVETASNAGQ RVNAGAASFGAVVAGAAALLL SEQIDNO:40-TIR1carrierproteinfromSaccharomycescerevisiae SLASDSSSGFSLSSMPAGVLDIGMALASATDDSYTTLYSEVDFAGVSKMLTMVPWYSSR LEPALKSLNGDASSSAAPSSSAAPTSSAAPSSSAAPTSSAASSSSEAKSSSAAPSSSEAKSS SAAPSSSEAKSSSAAPSSSEAKSSSAAPSSTEAKITSAAPSSTGAKTSAISQITDGQIQATKA VSEQTENGAAKAFVGMGAGVVAAAAMLL SEQIDNO:41-TOS6carrierproteinfromSaccharomycescerevisiae TSMVSTVKTTSTPYTTSTIATLSTKSISSQANTTTHEISTYVGAAVKGSVAGMGAIMGAA AFALL SEQIDNO:42-SignalsequencefromSaccharomycescerevisiae MQLLRCFSIFSVIASVLA SEQIDNO:43-SignalsequencefromSaccharomycescerevisiae MTLSFAHFTYLFTILLGLTNIALA SEQIDNO:44-SignalsequencefromSaccharomycescerevisiae MQFSTVASVAFVALANFVAA SEQIDNO:45-SignalsequencefromSaccharomycescerevisiae MQFSTVASIAAVAAVASA SEQIDNO:46-SignalsequencefromSaccharomycescerevisiae MQYKKSLVASALVATSLA SEQIDNO:47-SignalsequencefromSaccharomycescerevisiae MQYKKPLVVSALAATSLA SEQIDNO:48-SignalsequencefromSaccharomycescerevisiae MAYIKIALLAAIAALASA SEQIDNO:49-SignalsequencefromSaccharomycescerevisiae MESVSSLFNIFSTIMVNYKSLVLALLSVSNLKYARG SEQIDNO:50-SignalsequencefromSaccharomycescerevisiae MSAINHLCLKLILASFAIINTITA SEQIDNO:51-SignalsequencefromSaccharomycescerevisiae MVNISIVAGIVALATSAAA SEQIDNO:52-SignalsequencefromSaccharomycescerevisiae MRQVWFSWIVGLFLCFFNVSSA SEQIDNO:53-SignalsequencefromSaccharomycescerevisiae MLLQAFLFLLAGFAAKISA SEQIDNO:54-SignalsequencefromSaccharomycescerevisiae MFSLKALLPLALLLVSANQVAA SEQIDNO:55-SignalsequencefromSaccharomycescerevisiae MKFSTALSVALFALAKMVIA SEQIDNO:56-Acyl-activatingenzymefromCannabissativa MGKNYKSLDSVVASDFIALGITSEVAETLHGRLAEIVCNYGAATPQTWINIANHILSPDL PFSLHQMLFYGCYKDFGPAPPAWIPDPEKVKSTNLGALLEKRGKEFLGVKYKDPISSFSH FQEFSVRNPEVYWRTVLMDEMKISFSKDPECILRRDDINNPGGSEWLPGGYLNSAKNCL NVNSNKKLNDTMIVWRDEGNDDLPLNKLTLDQLRKRVWLVGYALEEMGLEKGCAIAI DMPMHVDAVVIYLAIVLAGYVVVSIADSFSAPEISTRLRLSKAKAIFTQDHIIRGKKRIPL YSRVVEAKSPMAIVIPCSGSNIGAELRDGDISWDYFLERAKEFKNCEFTAREQPVDAYTN ILFSSGTTGEPKAIPWTQATPLKAAADGWSHLDIRKGDVIVWPTNLGWMMGPWLVYAS LLNGASIALYNGSPLVSGFAKFVQDAKVTMLGVVPSIVRSWKSTNCVSGYDWSTIRCFS SSGEASNVDEYLWLMGRANYKPVIEMCGGTEIGGAFSAGSFLQAQSLSSFSSQCMGCTL YILDKNGYPMPKNKPGIGELALGPVMFGASKTLLNGNHHDVYFKGMPTLNGEVLRRHG DIFELTSNGYYHAHGRADDTMNIGGIKISSIEIERVCNEVDDRVFETTAIGVPPLGGGPEQ LVIFFVLKDSNDTTIDLNQLRLSFNLGLQKKLNPLFKVTRVVPLSSLPRTATNKIMRRVL RQQFSHFE SEQIDNO:57-SignalsequencefromSaccharomycescerevisiae MQYKKTLVASALAATTLA SEQIDNO:58-SignalsequencefromSaccharomycescerevisiae MQFKNVALAASVAALSATASAEGYTPGEPWSTLTPTGSISCGAAEYTTTFGIAVQAITSS KAKRDVISQIGDGQVQATSAATAQATDSQAQATTTATPTSSEKISSSASKTSTNATSSSC ATPSLKDSSCKNSGTLELTLKDGVLTDAKGRIGSIVANRQFQFDGPPPQAGAIYAAGWSI TEDGYLALGDSDVFYQCLSGNFYNLYDQNVAEQCSAIHLEAVSLVDC SEQIDNO:59-SignalsequencefromSaccharomycescerevisiae MSVSKIAFVLSAIASLAVA SEQIDNO:60-SignalsequencefromSaccharomycescerevisiae MKLSTVLLSAGLASTTLA SEQIDNO:61-SignalsequencefromSaccharomycescerevisiae MAYTKIALFAAIAALASA SEQIDNO:62-SignalsequencefromSaccharomycescerevisiae MLEFPISVLLGCLVAVKA SEQIDNO:63-SignalsequencefromSaccharomycescerevisiae MKFSTLSTVAAIAAFASA SEQIDNO:64-SignalsequencefromSaccharomycescerevisiae MTKPTQVLVRSVSILFFITLLHLVVALNDVAGPAETAPVSLLPR SEQIDNO:65-SignalsequencefromSaccharomycescerevisiae MSRISILAVAAALVASATA SEQIDNO:66-SignalsequencefromSaccharomycescerevisiae MRFPSIFTAVLFAASSALA SEQIDNO:67-SignalsequencefromSaccharomycescerevisiae MKAFTSLLCGLGLSTTLAKA SEQIDNO:68-SignalsequencefromSaccharomycescerevisiae MFNRFNKLQAALALVLYSQSALG SEQIDNO:69-SignalsequencefromSaccharomycescerevisiae MRFSNFLTVSALLTGALG SEQIDNO:70-SignalsequencefromSaccharomycescerevisiae MISANSLLISTLCAFAIA SEQIDNO:71-SignalsequencefromSaccharomycescerevisiae MFTFLKIILWLFSLALASA SEQIDNO:72-CarrierproteinfromSaccharomycescerevisiae YQGRNLGTASAKSSFISTTTTDLTSINTSAYSTGSISTVETGNRTTSEVISHVVTTSTKLSP TATTSLTIAQTSIYSTDSNITVGTDIHTTSEVISDVETISRETASTVVAAPTSTTGWTGAMN TYISQFTSSSFATINSTPIISSSAVFETSDASIVNVHTENITNTAAVPSEEPTFVNATRNSLNS FCSSKQPSSPSSYTSSPLVSSLSVSKTLLSTSFTPSVPTSNTYIKTKNTGYFEHTALTTSSVG LNSFSETAVSSQGTKIDTFLVSSLIAYPSSASGSQLSGIQQNFTSTSLMISTYEGKASIFFSA ELGSIIFLLLSYLLF SEQIDNO:73-CarrierproteinfromSaccharomycescerevisiae ASAKSSFISTTTTDLTSINTSAYSTGSISTVETGNRTTSEVISHVVTTSTKLSPTATTSLTIA QTSIYSTDSNITVGTDIHTTSEVISDVETISRETASTVVAAPTSTTGWTGAMNTYISQFTSS SFATINSTPIISSSAVFETSDASIVNVHTENITNTAAVPSEEPTFVNATRNSLNSFCSSKQPS SPSSYTSSPLVSSLSVSKTLLSTSFTPSVPTSNTYIKTKNTGYFEHTALTTSSVGLNSFSETA VSSQGTKIDTFLVSSLIAYPSSASGSQLSGIQQNFTSTSLMISTYEGKASIFFSAELGSIIFLL LSYLLF SEQIDNO:74-TetraketidesynthasefromCannabissativa MNHLRAEGPASVLAIGTANPENILLQDEFPDYYFRVTKSEHMTQLKEKFRKICDKSMIR KRNCFLNEEHLKQNPRLVEHEMQTLDARQDMLVVEVPKLGKDACAKAIKEWGQPKSK ITHLIFTSASTTDMPGADYHCAKLLGLSPSVKRVMMYQLGCYGGGTVLRIAKDIAENNK GARVLAVCCDIMACLFRGPSESDLELLVGQAIFGDGAAAVIVGAEPDESVGERPIFELVS TGQTILPNSEGTIGGHIREAGLIFDLHKDVPMLISNNIEKCLIEAFTPIGISDWNSIFWITHP GGKAILDKVEEKLHLKSDKFVDSRHVLSEHGNMSSSTVLFVMDELRKRSLEEGKSTTGD GFEWGVLFGFGPGLTVERVVVRSVPIKY SEQIDNO:75-CarrierproteinfromSaccharomycescerevisiae TTTTDLTSINTSAYSTGSISTVETGNRTTSEVISHVVTTSTKLSPTATTSLTIAQTSIYSTDS NITVGTDIHTTSEVISDVETISRETASTVVAAPTSTTGWTGAMNTYISQFTSSSFATINSTPI ISSSAVFETSDASIVNVHTENITNTAAVPSEEPTFVNATRNSLNSFCSSKQPSSPSSYTSSPL VSSLSVSKTLLSTSFTPSVPTSNTYIKTKNTGYFEHTALTTSSVGLNSFSETAVSSQGTKID TFLVSSLIAYPSSASGSQLSGIQQNFTSTSLMISTYEGKASIFFSAELGSIIFLLLSYLLF SEQIDNO:76-CarrierproteinfromSaccharomycescerevisiae SAYSTGSISTVETGNRTTSEVISHVVTTSTKLSPTATTSLTIAQTSIYSTDSNITVGTDIHTT SEVISDVETISRETASTVVAAPTSTTGWTGAMNTYISQFTSSSFATINSTPIISSSAVFETSD ASIVNVHTENITNTAAVPSEEPTFVNATRNSLNSFCSSKQPSSPSSYTSSPLVSSLSVSKTL LSTSFTPSVPTSNTYIKTKNTGYFEHTALTTSSVGLNSFSETAVSSQGTKIDTFLVSSLIAY PSSASGSQLSGIQQNFTSTSLMISTYEGKASIFFSAELGSIIFLLLSYLLF SEQIDNO:77-CarrierproteinfromSaccharomycescerevisiae VETGNRTTSEVISHVVTTSTKLSPTATTSLTIAQTSIYSTDSNITVGTDIHTTSEVISDVETIS RETASTVVAAPTSTTGWTGAMNTYISQFTSSSFATINSTPIISSSAVFETSDASIVNVHTEN ITNTAAVPSEEPTFVNATRNSLNSFCSSKQPSSPSSYTSSPLVSSLSVSKTLLSTSFTPSVPT SNTYIKTKNTGYFEHTALTTSSVGLNSFSETAVSSQGTKIDTFLVSSLIAYPSSASGSQLSG IQQNFTSTSLMISTYEGKASIFFSAELGSIIFLLLSYLLF SEQIDNO:78-CarrierproteinfromSaccharomycescerevisiae VISHVVTTSTKLSPTATTSLTIAQTSIYSTDSNITVGTDIHTTSEVISDVETISRETASTVVA APTSTTGWTGAMNTYISQFTSSSFATINSTPIISSSAVFETSDASIVNVHTENITNTAAVPSE EPTFVNATRNSLNSFCSSKQPSSPSSYTSSPLVSSLSVSKTLLSTSFTPSVPTSNTYIKTKNT GYFEHTALTTSSVGLNSFSETAVSSQGTKIDTFLVSSLIAYPSSASGSQLSGIQQNFTSTSL MISTYEGKASIFFSAELGSIIFLLLSYLLF SEQIDNO:79-CarrierproteinfromSaccharomycescerevisiae TATTSLTIAQTSIYSTDSNITVGTDIHTTSEVISDVETISRETASTVVAAPTSTTGWTGAMN TYISQFTSSSFATINSTPIISSSAVFETSDASIVNVHTENITNTAAVPSEEPTFVNATRNSLNS FCSSKQPSSPSSYTSSPLVSSLSVSKTLLSTSFTPSVPTSNTYIKTKNTGYFEHTALTTSSVG LNSFSETAVSSQGTKIDTFLVSSLIAYPSSASGSQLSGIQQNFTSTSLMISTYEGKASIFFSA ELGSIIFLLLSYLLF SEQIDNO:80-CarrierproteinfromSaccharomycescerevisiae TIAQTSIYSTDSNITVGTDIHTTSEVISDVETISRETASTVVAAPTSTTGWTGAMNTYISQF TSSSFATINSTPIISSSAVFETSDASIVNVHTENITNTAAVPSEEPTFVNATRNSLNSFCSSK QPSSPSSYTSSPLVSSLSVSKTLLSTSFTPSVPTSNTYIKTKNTGYFEHTALTTSSVGLNSFS ETAVSSQGTKIDTFLVSSLIAYPSSASGSQLSGIQQNFTSTSLMISTYEGKASIFFSAELGSII FLLLSYLLF SEQIDNO:81-CarrierproteinfromSaccharomycescerevisiae DSNITVGTDIHTTSEVISDVETISRETASTVVAAPTSTTGWTGAMNTYISQFTSSSFATINS TPIISSSAVFETSDASIVNVHTENITNTAAVPSEEPTFVNATRNSLNSFCSSKQPSSPSSYTS SPLVSSLSVSKTLLSTSFTPSVPTSNTYIKTKNTGYFEHTALTTSSVGLNSFSETAVSSQGT KIDTFLVSSLIAYPSSASGSQLSGIQQNFTSTSLMISTYEGKASIFFSAELGSIIFLLLSYLLF SEQIDNO:82-CarrierproteinfromSaccharomycescerevisiae HTTSEVISDVETISRETASTVVAAPTSTTGWTGAMNTYISQFTSSSFATINSTPIISSSAVFE TSDASIVNVHTENITNTAAVPSEEPTFVNATRNSLNSFCSSKQPSSPSSYTSSPLVSSLSVS KTLLSTSFTPSVPTSNTYIKTKNTGYFEHTALTTSSVGLNSFSETAVSSQGTKIDTFLVSSL IAYPSSASGSQLSGIQQNFTSTSLMISTYEGKASIFFSAELGSIIFLLLSYLLF SEQIDNO:83-CarrierproteinfromSaccharomycescerevisiae ETISRETASTVVAAPTSTTGWTGAMNTYISQFTSSSFATINSTPIISSSAVFETSDASIVNVH TENITNTAAVPSEEPTFVNATRNSLNSFCSSKQPSSPSSYTSSPLVSSLSVSKILLSTSFTPS VPTSNTYIKTKNTGYFEHTALTTSSVGLNSFSETAVSSQGTKIDTFLVSSLIAYPSSASGSQ LSGIQQNFTSTSLMISTYEGKASIFFSAELGSIIFLLLSYLLF SEQIDNO:84-CarrierproteinfromSaccharomycescerevisiae VVAAPTSTTGWTGAMNTYISQFTSSSFATINSTPIISSSAVFETSDASIVNVHTENITNTAA VPSEEPTFVNATRNSLNSFCSSKQPSSPSSYTSSPLVSSLSVSKTLLSTSFTPSVPTSNTYIK TKNTGYFEHTALTTSSVGLNSFSETAVSSQGTKIDTFLVSSLIAYPSSASGSQLSGIQQNFT STSLMISTYEGKASIFFSAELGSIIFLLLSYLLF SEQIDNO:85-CarrierproteinfromSaccharomycescerevisiae WTGAMNTYISQFTSSSFATINSTPIISSSAVFETSDASIVNVHTENITNTAAVPSEEPTFVN ATRNSLNSFCSSKQPSSPSSYTSSPLVSSLSVSKTLLSTSFTPSVPTSNTYIKTKNTGYFEHT ALTTSSVGLNSFSETAVSSQGTKIDTFLVSSLIAYPSSASGSQLSGIQQNFTSTSLMISTYE GKASIFFSAELGSIIFLLLSYLLF SEQIDNO:86-CarrierproteinfromSaccharomycescerevisiae QFTSSSFATINSTPIISSSAVFETSDASIVNVHTENITNTAAVPSEEPTFVNATRNSLNSFCSS KQPSSPSSYTSSPLVSSLSVSKTLLSTSFTPSVPTSNTYIKTKNTGYFEHTALTTSSVGLNSF SETAVSSQGTKIDTFLVSSLIAYPSSASGSQLSGIQQNFTSTSLMISTYEGKASIFFSAELGS IIFLLLSYLLF SEQIDNO:87-CarrierproteinfromSaccharomycescerevisiae NSTPIISSSAVFETSDASIVNVHTENITNTAAVPSEEPTFVNATRNSLNSFCSSKQPSSPSSY TSSPLVSSLSVSKTLLSTSFTPSVPTSNTYIKTKNTGYFEHTALTTSSVGLNSFSETAVSSQ GTKIDTFLVSSLIAYPSSASGSQLSGIQQNFTSTSLMISTYEGKASIFFSAELGSIIFLLLSYL LF SEQIDNO:88-CarrierproteinfromSaccharomycescerevisiae VFETSDASIVNVHTENITNTAAVPSEEPTFVNATRNSLNSFCSSKQPSSPSSYTSSPLVSSL SVSKTLLSTSFTPSVPTSNTYIKTKNTGYFEHTALTTSSVGLNSFSETAVSSQGTKIDTFLV SSLIAYPSSASGSQLSGIQQNFTSTSLMISTYEGKASIFFSAELGSIIFLLLSYLLF SEQIDNO:89-CarrierproteinfromSaccharomycescerevisiae NVHTENITNTAAVPSEEPTFVNATRNSLNSFCSSKQPSSPSSYTSSPLVSSLSVSKILLSTS FTPSVPTSNTYIKTKNTGYFEHTALTTSSVGLNSFSETAVSSQGTKIDTFLVSSLIAYPSSA SGSQLSGIQQNFTSTSLMISTYEGKASIFFSAELGSIIFLLLSYLLF SEQIDNO:90-CarrierproteinfromSaccharomycescerevisiae AAVPSEEPTFVNATRNSLNSFCSSKQPSSPSSYTSSPLVSSLSVSKTLLSTSFTPSVPTSNTY IKTKNTGYFEHTALTTSSVGLNSFSETAVSSQGTKIDTFLVSSLIAYPSSASGSQLSGIQQN FTSTSLMISTYEGKASIFFSAELGSIIFLLLSYLLF SEQIDNO:91-CarrierproteinfromSaccharomycescerevisiae VNATRNSLNSFCSSKQPSSPSSYTSSPLVSSLSVSKTLLSTSFTPSVPTSNTYIKTKNTGYF EHTALTTSSVGLNSFSETAVSSQGTKIDTFLVSSLIAYPSSASGSQLSGIQQNFTSTSLMIST YEGKASIFFSAELGSIIFLLLSYLLF SEQIDNO:92-CarrierproteinfromSaccharomycescerevisiae FCSSKQPSSPSSYTSSPLVSSLSVSKTLLSTSFTPSVPTSNTYIKTKNTGYFEHTALTTSSVG LNSFSETAVSSQGTKIDTFLVSSLIAYPSSASGSQLSGIQQNFTSTSLMISTYEGKASIFFSA ELGSIIFLLLSYLLF SEQIDNO:93-CarrierproteinfromSaccharomycescerevisiae SSYTSSPLVSSLSVSKTLLSTSFTPSVPTSNTYIKTKNTGYFEHTALTTSSVGLNSFSETAV SSQGTKIDTFLVSSLIAYPSSASGSQLSGIQQNFTSTSLMISTYEGKASIFFSAELGSIIFLLL SYLLF SEQIDNO:94-CarrierproteinfromSaccharomycescerevisiae SLSVSKTLLSTSFTPSVPTSNTYIKTKNTGYFEHTALTTSSVGLNSFSETAVSSQGTKIDTF LVSSLIAYPSSASGSQLSGIQQNFTSTSLMISTYEGKASIFFSAELGSIIFLLLSYLLF SEQIDNO:95-CarrierproteinfromSaccharomycescerevisiae TSFTPSVPTSNTYIKTKNTGYFEHTALTTSSVGLNSFSETAVSSQGTKIDTFLVSSLIAYPS SASGSQLSGIQQNFTSTSLMISTYEGKASIFFSAELGSIIFLLLSYLLF SEQIDNO:96-CarrierproteinfromSaccharomycescerevisiae NTYIKTKNTGYFEHTALTTSSVGLNSFSETAVSSQGTKIDTFLVSSLIAYPSSASGSQLSGI QQNFTSTSLMISTYEGKASIFFSAELGSIIFLLLSYLLF SEQIDNO:97-CarrierproteinfromSaccharomycescerevisiae YFEHTALTTSSVGLNSFSETAVSSQGTKIDTFLVSSLIAYPSSASGSQLSGIQQNFTSTSLM ISTYEGKASIFFSAELGSIIFLLLSYLLF SEQIDNO:98-CarrierproteinfromSaccharomycescerevisiae SVGLNSFSETAVSSQGTKIDTFLVSSLIAYPSSASGSQLSGIQQNFTSTSLMISTYEGKASIF FSAELGSIIFLLLSYLLF SEQIDNO:99-CarrierproteinfromSaccharomycescerevisiae AVSSQGTKIDTFLVSSLIAYPSSASGSQLSGIQQNFTSTSLMISTYEGKASIFFSAELGSIIFL LLSYLLF SEQIDNO:100-CarrierproteinfromSaccharomycescerevisiae TFLVSSLIAYPSSASGSQLSGIQQNFTSTSLMISTYEGKASIFFSAELGSIIFLLLSYLLF SEQIDNO:101-CarrierproteinfromSaccharomycescerevisiae PSSASGSQLSGIQQNFTSTSLMISTYEGKASIFFSAELGSIIFLLLSYLLF SEQIDNO:102-OlivetolicacidcyclasefromCannabissativa MAVKHLIVLKFKDEITEAQKEEFFKTYVNLVNIIPAMKDVYWGKDVTQKNKEEGYTHI VEVTFESVETIQDYIIHPAHVGFGDVYRSFWEKLLIFDYTPRK SEQIDNO:103-CarrierproteinfromSaccharomycescerevisiae YPSNGTSVISSSVISSSVTSSLVTSSSFISSSVISSSTTTSTSIFSESSTSSVIPTSSSTSGSSESK TSSASSSSSSSSISSESPKSPTNSSSSLPPVTSATTGQETASSLPPATTTKTSEQTTLVTVTSC ESHVCTESISSAIVSTATVTVSGVTTEYTTWCPISTTETTKQTKGTTEQTKGTTEQTTETT KQTTVVTISSCESDICSKTASPAIVSTSTATINGVTTEYTTWCPISTTESKQQTTLVTVTSC ESGVCSETTSPAIVSTATATVNDVVTVYPTWRPQTTNEQSVSSKMNSATSETTTNTGAA ETKTAVTSSLSRFNHAETQTASATDVIGHNNSVVSVSETGNTKSLTSSGLSTMSQQPRST PASSMVGYSTASLEISTYAGSANSLLAGSGLSVFIASLLLAII SEQIDNO:104-CarrierproteinfromSaccharomycescerevisiae PSNGTSVISSSVISSSVTSSLVTSSSFISSSVISSSTTTSTSIFSESSTSSVIPTSSSTSGSSESKTS SASSSSSSSSISSESPKSPTNSSSSLPPVTSATTGQETASSLPPATTTKTSEQTTLVTVTSCES HVCTESISSAIVSTATVTVSGVTTEYTTWCPISTTETTKQTKGTTEQTKGTTEQTTETTKQ TTVVTISSCESDICSKTASPAIVSTSTATINGVTTEYTTWCPISTTESKQQTTLVTVTSCESG VCSETTSPAIVSTATATVNDVVTVYPTWRPQTTNEQSVSSKMNSATSETTTNTGAAETK TAVTSSLSRFNHAETQTASATDVIGHNNSVVSVSETGNTKSLTSSGLSTMSQQPRSTPAS SMVGYSTASLEISTYAGSANSLLAGSGLSVFIASLLLAII SEQIDNO:105-CarrierproteinfromSaccharomycescerevisiae SNGTSVISSSVISSSVTSSLVTSSSFISSSVISSSTTTSTSIFSESSTSSVIPTSSSTSGSSESKTSS ASSSSSSSSISSESPKSPTNSSSSLPPVTSATTGQETASSLPPATTTKTSEQTTLVTVTSCESH VCTESISSAIVSTATVTVSGVTTEYTTWCPISTTETTKQTKGTTEQTKGTTEQTTETTKQT TVVTISSCESDICSKTASPAIVSTSTATINGVTTEYTTWCPISTTESKQQTTLVTVTSCESG VCSETTSPAIVSTATATVNDVVTVYPTWRPQTTNEQSVSSKMNSATSETTTNTGAAETK TAVTSSLSRFNHAETQTASATDVIGHNNSVVSVSETGNTKSLTSSGLSTMSQQPRSTPAS SMVGYSTASLEISTYAGSANSLLAGSGLSVFIASLLLAII SEQIDNO:106-CarrierproteinfromSaccharomycescerevisiae NGTSVISSSVISSSVTSSLVTSSSFISSSVISSSTTTSTSIFSESSTSSVIPTSSSTSGSSESKTSS ASSSSSSSSISSESPKSPTNSSSSLPPVTSATTGQETASSLPPATTTKTSEQTTLVTVTSCESH VCTESISSAIVSTATVTVSGVTTEYTTWCPISTTETTKQTKGTTEQTKGTTEQTTETTKQT TVVTISSCESDICSKTASPAIVSTSTATINGVTTEYTTWCPISTTESKQQTTLVTVTSCESG VCSETTSPAIVSTATATVNDVVTVYPTWRPQTTNEQSVSSKMNSATSETTTNTGAAETK TAVTSSLSRFNHAETQTASATDVIGHNNSVVSVSETGNTKSLTSSGLSTMSQQPRSTPAS SMVGYSTASLEISTYAGSANSLLAGSGLSVFIASLLLAII SEQIDNO:107-CarrierproteinfromSaccharomycescerevisiae VISSSVTSSLVTSSSFISSSVISSSTTTSTSIFSESSTSSVIPTSSSTSGSSESKTSSASSSSSSSSI SSESPKSPTNSSSSLPPVTSATTGQETASSLPPATTTKTSEQTTLVTVTSCESHVCTESISSA IVSTATVTVSGVTTEYTTWCPISTTETTKQTKGTTEQTKGTTEQTTETTKQTTVVTISSCE SDICSKTASPAIVSTSTATINGVTTEYTTWCPISTTESKQQTTLVTVTSCESGVCSETTSPAI VSTATATVNDVVTVYPTWRPQTTNEQSVSSKMNSATSETTTNTGAAETKTAVTSSLSRF NHAETQTASATDVIGHNNSVVSVSETGNTKSLTSSGLSTMSQQPRSTPASSMVGYSTAS LEISTYAGSANSLLAGSGLSVFIASLLLAII SEQIDNO:108-CarrierproteinfromSaccharomycescerevisiae VTSSSFISSSVISSSTTTSTSIFSESSTSSVIPTSSSTSGSSESKTSSASSSSSSSSISSESPKSPTN SSSSLPPVTSATTGQETASSLPPATTTKTSEQTTLVTVTSCESHVCTESISSAIVSTATVTVS GVTTEYTTWCPISTTETTKQTKGTTEQTKGTTEQTTETTKQTTVVTISSCESDICSKTASP AIVSTSTATINGVTTEYTTWCPISTTESKQQTTLVTVTSCESGVCSETTSPAIVSTATATVN DVVTVYPTWRPQTTNEQSVSSKMNSATSETTTNTGAAETKTAVTSSLSRFNHAETQTAS ATDVIGHNNSVVSVSETGNTKSLTSSGLSTMSQQPRSTPASSMVGYSTASLEISTYAGSA NSLLAGSGLSVFIASLLLAII SEQIDNO:109-CarrierproteinfromSaccharomycescerevisiae VISSSTTTSTSIFSESSTSSVIPTSSSTSGSSESKTSSASSSSSSSSISSESPKSPTNSSSSLPPVT SATTGQETASSLPPATTTKTSEQTTLVTVTSCESHVCTESISSAIVSTATVTVSGVTTEYTT WCPISTTETTKQTKGTTEQTKGTTEQTTETTKQTTVVTISSCESDICSKTASPAIVSTSTAT INGVTTEYTTWCPISTTESKQQTTLVTVTSCESGVCSETTSPAIVSTATATVNDVVTVYPT WRPQTTNEQSVSSKMNSATSETTTNTGAAETKTAVTSSLSRFNHAETQTASATDVIGHN NSVVSVSETGNTKSLTSSGLSTMSQQPRSTPASSMVGYSTASLEISTYAGSANSLLAGSG LSVFIASLLLAII SEQIDNO:110-CarrierproteinfromSaccharomycescerevisiae SIFSESSTSSVIPTSSSTSGSSESKTSSASSSSSSSSISSESPKSPTNSSSSLPPVTSATTGQETA SSLPPATTTKTSEQTTLVTVTSCESHVCTESISSAIVSTATVTVSGVTTEYTTWCPISTTET TKQTKGTTEQTKGTTEQTTETTKQTTVVTISSCESDICSKTASPAIVSTSTATINGVTTEYT TWCPISTTESKQQTTLVTVTSCESGVCSETTSPAIVSTATATVNDVVTVYPTWRPQTTNE QSVSSKMNSATSETTTNTGAAETKTAVTSSLSRFNHAETQTASATDVIGHNNSVVSVSE TGNTKSLTSSGLSTMSQQPRSTPASSMVGYSTASLEISTYAGSANSLLAGSGLSVFIASLL LAII SEQIDNO:111-CarrierproteinfromSaccharomycescerevisiae VIPTSSSTSGSSESKTSSASSSSSSSSISSESPKSPTNSSSSLPPVTSATTGQETASSLPPATTT KTSEQTTLVTVTSCESHVCTESISSAIVSTATVTVSGVTTEYTTWCPISTTETTKQTKGTTE QTKGTTEQTTETTKQTTVVTISSCESDICSKTASPAIVSTSTATINGVTTEYTTWCPISTTES KQQTTLVTVTSCESGVCSETTSPAIVSTATATVNDVVTVYPTWRPQTTNEQSVSSKMNS ATSETTTNTGAAETKTAVTSSLSRFNHAETQTASATDVIGHNNSVVSVSETGNTKSLTSS GLSTMSQQPRSTPASSMVGYSTASLEISTYAGSANSLLAGSGLSVFIASLLLAII SEQIDNO:112-CarrierproteinfromSaccharomycescerevisiae SSESKTSSASSSSSSSSISSESPKSPTNSSSSLPPVTSATTGQETASSLPPATTTKTSEQTTLV TVTSCESHVCTESISSAIVSTATVTVSGVTTEYTTWCPISTTETTKQTKGTTEQTKGTTEQ TTETTKQTTVVTISSCESDICSKTASPAIVSTSTATINGVTTEYTTWCPISTTESKQQTTLVT VTSCESGVCSETTSPAIVSTATATVNDVVTVYPTWRPQTTNEQSVSSKMNSATSETTTNT GAAETKTAVTSSLSRFNHAETQTASATDVIGHNNSVVSVSETGNTKSLTSSGLSTMSQQP RSTPASSMVGYSTASLEISTYAGSANSLLAGSGLSVFIASLLLAII SEQIDNO:113-Linker GSGGSG SEQIDNO:114-Linker GSGSGS SEQIDNO:115-Linker HHHHGSGGSG SEQIDNO:116-Linker GSGAGGVSGAGG SEQIDNO:117-Linker GSGGSGGSGGSG SEQIDNO:118-Linker HHHHHHGSGGSG SEQIDNO:119-Linker GSGGSGGSGGSGGSGGSG SEQIDNO:120-Linker AEAAAKEAAAKA SEQIDNO:121-Linker APAPAPAPAPAPAPA SEQIDNO:122-Linker EPEPEPEPEPEPEPE SEQIDNO:123-Linker KPKPKPKPKPKPKP SEQIDNO:124-Linker AEAAAKEAAAKEAAAKA SEQIDNO:125-Linker AEAAAKEAAAKEAAAKEAAAKA SEQIDNO:126-SignalsequencefromSaccharomycescerevisiae MQLLRCFSIFSVIASVLARR SEQIDNO:127-SignalsequencefromSaccharomycescerevisiae MSAINHLCLKLILASFAIINTITARR SEQIDNO:128-SignalsequencefromSaccharomycescerevisiae MRQVWFSWIVGLFLCFFNVSSARR SEQIDNO:129-SignalsequencefromSaccharomycescerevisiae MFSLKALLPLALLLVSANQVAARR SEQIDNO:130-SignalsequencefromSaccharomycescerevisiae MQYKKSLVASALVATSLARR SEQIDNO:131-SignalsequencefromSaccharomycescerevisiae MQYKKPLVVSALAATSLARR SEQIDNO:132-SignalsequencefromSaccharomycescerevisiae MFTFLKIILWLFSLALASARR SEQIDNO:133-SignalsequencefromSaccharomycescerevisiae MLLQAFLFLLAGFAAKISARR SEQIDNO:134-CBDaSfromCannabissativa TFSFWFVCKIIFFFFSFNIQTSIANPRENFLKCFSQYIPNNATNLKLVYTQNNPLYMSVLNS TIHNLRFSSDTTPKPLVIVTPSHVSHIQGTILCSKKVGLQIRTRSGGHDSEGMSYISQVPFV IVDLRNMRSIKIDVHSQTAWVEAGATLGEVYYWVNEKNESLSLAAGYCPTVCAGGHFG GGGYGPLMRSYGLAADNIIDAHLVNVHGKVLDRKSMGEDLFWALRGGGAESFGIIVA WKIRLVAVPKSTMFSVKKIMEIHELVKLVNKWQNIAYKYDKDLLLMTHFITRNITDNQG KNKTAIHTYFSSVFLGGVDSLVDLMNKSFPELGIKKTDCRQLSWIDTIIFYSGVVNYDTD NFNKEILLDRSAGQNGAFKIKLDYVKKPIPESVFVQILEKLYEEDIGAGMYALYPYGGIM DEISESAIPFPHRAGILYELWYICSWEKQEDNEKHLNWIRNIYNFMTPYVSQNPRLAYLN YRDLDIGINDPKNPNNYTQARIWGEKYFGKNFDRLVKVKTLVDPNNFFRNEQSIPPLPR HRH SEQIDNO:135-CBDaSfromCannabissativa FSFWFVCKIIFFFFSFNIQTSIANPRENFLKCFSQYIPNNATNLKLVYTQNNPLYMSVLNST IHNLRFSSDTTPKPLVIVTPSHVSHIQGTILCSKKVGLQIRTRSGGHDSEGMSYISQVPFVI VDLRNMRSIKIDVHSQTAWVEAGATLGEVYYWVNEKNESLSLAAGYCPTVCAGGHFG GGGYGPLMRSYGLAADNIIDAHLVNVHGKVLDRKSMGEDLFWALRGGGAESFGIIVA WKIRLVAVPKSTMFSVKKIMEIHELVKLVNKWQNIAYKYDKDLLLMTHFITRNITDNQG KNKTAIHTYFSSVFLGGVDSLVDLMNKSFPELGIKKTDCRQLSWIDTIIFYSGVVNYDTD NFNKEILLDRSAGQNGAFKIKLDYVKKPIPESVFVQILEKLYEEDIGAGMYALYPYGGIM DEISESAIPFPHRAGILYELWYICSWEKQEDNEKHLNWIRNIYNFMTPYVSQNPRLAYLN YRDLDIGINDPKNPNNYTQARIWGEKYFGKNFDRLVKVKTLVDPNNFFRNEQSIPPLPR HRH SEQIDNO:136-CBDaSfromCannabissativa MKCSTFSFWFVCKIIFFFFSFNIQTSIANPRENFLKCFSQYIPNNATNLKLVYTQNNPLYM SVLNSTIHNLRFSSDTTPKPLVIVTPSHVSHIQGTILCSKKVGLQIRTRSGGHDSEGMSYIS QVPFVIVDLRNMRSIKIDVHSQTAWVEAGATLGEVYYWVNEKNESLSLAAGYCPTVCA GGHFGGGGYGPLMRSYGLAADNIIDAHLVNVHGKVLDRKSMGEDLFWALRGGGAESF GIIVAWKIRLVAVPKSTMFSVKKIMEIHELVKLVNKWQNIAYKYDKDLLLMTHFITRNIT DNQGKNKTAIHTYFSSVFLGGVDSLVDLMNKSFPELGIKKTDCRQLSWIDTIIFYSGVVN YDTDNFNKEILLDRSAGQNGAFKIKLDYVKKPIPESVFVQILEKLYEEDIGAGMYALYPY GGIMDEISESAIPFPHRAGILYELWYICSWEKQEDNEKHLNWIRNIYNFMTPYVSQNPRL AYLNYRDLDIGINDPKNPNNYTQARIWGEKYFGKNFDRLVKVKTLVDPNNFFRNEQSIP PLPRHRH SEQIDNO:137-CBDaSfromCannabissativa MKCSTFSFWFVCKIIFFFFSFNIQTSIANPRENFLKCFSQYIPNNATNLKLVYTQNNPLYM SVLNSTIHNLRFSSDTTPKPLVIVTPSHVSHIQGTILCSKKVGLQIRTRSGGHDSEGMSYIS QVPFVIVDLRNMRSIKIDVHSQTAWVEAGATLGEVYYWVNEKNENLTLAAGYCPTVCA GGHFGGGGYGPLMRSYGLAADNIIDAHLVNVHGKVLDRKSMGEDLFWALRGGGAESF GIIVAWKIRLVAVPKSTMFSVKKIMEIHELVKLVNKWQNIAYKYDKDLLLMTHFITRNIT DNQGKNKTAIHTYFSSVFLGGVDSLVDLMNKTFPELGIKKTDCRQLSWIDTIIFYSGVVN YDTDNFNKEILLDRSAGQNGAFKIKLDYVKKPIPESVFVQILEKLYEEDIGAGMYALYPY GGIMDEISESAIPFPHRAGILYELWYICSWEKQEDNEKHLNWIRNIYNFMTPYVSQNPRL AYLNYRDLDIGINDPKNPNNYTQARIWGEKYFGKNFDRLVKVKTLVDPNNFFRNEQSIP PLPRHRH SEQIDNO:138-SignalsequencefromSaccharomycescerevisiae MQFSTVASVAFVALANFVAARR SEQIDNO:139-SignalsequencefromSaccharomycescerevisiae MQFSTVASVAFVALANFVAAKR SEQIDNO:140-SignalsequencefromSaccharomycescerevisiae MQFSTVASVAFVALANFVAARRK SEQIDNO:141-SignalsequencefromSaccharomycescerevisiae MQFSTVASVAFVALANFVAARRQ SEQIDNO:142-SignalsequencefromSaccharomycescerevisiae MQFSTVASVAFVALANFVAARRW SEQIDNO:143-SignalsequencefromSaccharomycescerevisiae MQFSTVASVAFVALANFVAARRE SEQIDNO:144-SignalsequencefromSaccharomycescerevisiae MQFSTVASVAFVALANFVAALDKR SEQIDNO:145-SignalsequencefromSaccharomycescerevisiae MQFSTVASVAFVALANFVAALDKREAEA SEQIDNO:146-SignalsequencefromSaccharomycescerevisiae MQFSTVASVAFVALANFVAAKREAEA SEQIDNO:147-CBDaSfromCannabissativa QTSIANPRENFLKCFSQYIPNNATNLKLVYTQNNPLYMSVLNSTIHNLRFSSDTTPKPLVI VTPSHVSHIQGTILCSKKVGLQIRTRSGGHDSEGMSYISQVPFVIVDLRNMRSIKIDVHSQ TAWVEAGATLGEVYYWVNEKNESLSLAAGYCPTVCAGGHFGGGGYGPLMRSYGLAA DNIIDAHLVNVHGKVLDRKSMGEDLFWALRGGGAESFGIIVAWKIRLVAVPKSTMFSV KKIMEIHELVKLVNKWQNIAYKYDKDLLLMTHFITRNITDNQGKNKTAIHTYFSSVFLG GVDSLVDLMNKSFPELGIKKTDCRQLSWIDTIIFYSGVVNYDTDNFNKEILLDRSAGQNG AFKIKLDYVKKPIPESVFVQILEKLYEEDIGAGMYALYPYGGIMDEISESAIPFPHRAGILY ELWYICSWEKQEDNEKHLNWIRNIYNFMTPYVSQNPRLAYLNYRDLDIGINDPKNPNNY TQARIWGEKYFGKNFDRLVKVKTLVDPNNFFRNEQSIPPLPRHRH SEQIDNO:148-CBDaSfromCannabissativa MKCSTFSFWFVCKIIFFFFSFNIQTSIANPTENFLKCFSQYIDNNATNDKLVYTQNNPLYM SVLNSTIHNLRFSSDTTPKPLVIVTPSHVSHIQGTILCSKKVGLQIRTRSGGHDSEGMSYIS QVPFVIVDLRNMRSIKIDVHSQTAWVEAGATLGEVYYNVNEKNENLTLAAGYCPTVCA GGHFGGGGYGPLMRSYGLAADNIIDAHLVNVDGKVLDRKSMGEDLFWALRGGGAESF GIVVAWKIRLVAVPKSTMFSVKKIMEIHELVKLVNKWQNIAYKYDKDLLLMTHFITRNI TDNQGNNKTAIHTYFSCVFLGGVDSLVDLMNKTFPELGIKKTDCRQLSWIDTIIFYSGVV NYDTDNFNKEILLDRSAGQNGAFKIKLDYVKKPIPESVFVQILEKLYEEDIGAGMYALYP YGGIMDEISESAIPFPHRAGILYELWYICSWEKQEDNEKHLNWIRNIYNFMTPYVSQNPR LAYLNYRDLDIGINDPKNPNNYTQARIWGEKYFGKNFDRLVKVKTLVDPNNFFRNEQSI PPLPRHRH SEQIDNO:149-CBDaSfromCannabissativa NPRENFLKCFSQYIDNNATNDKLVYTQNNPLYMSVLNSTIHNLRFSSDTTPKPLVIVTPS HVSHIQGTILCSKKVGLQIRTRSGGHDSEGMSYISQVPFVIVDLRNMRSIKIDVHSQTAW VEAGATLGEVYYNVNEKNENLTLAAGYCPTVCAGGHFGGGGYGPLMRSYGLAADNII DAHLVNVDGKVLDRKSMGEDLFWALRGGGAESFGIVVAWKIRLVAVPKSTMFSVKKI MEIHELVKLVNKWQNIAYKYDKDLLLMTHFITRNITDNQGNNKTAIHTYFSCVFLGGVD SLVDLMNKTFPELGIKKTDCRQLSWIDTIIFYSGVVNYDTDNFNKEILLDRSAGQNGAFK IKLDYVKKPIPESVFVQILEKLYEEDIGAGMYALYPYGGIMDEISESAIPFPHRAGILYEL WYICSWEKQEDNEKHLNWIRNIYNFMTPYVSQNPRLAYLNYRDLDIGINDPKNPNNYT QARIWGEKYFGKNFDRLVKVKTLVDPNNFFRNEQSIPPLPRHRH SEQIDNO:150-CBDaSfromCannabissativa MKCSTFSFWFVCKIIFFFFSFNIQTSIANPTENFLKCFSQYIDNNATNDKLVYTQNNPLYM SVLNSTIHNLRFSSDTTPKPLVIVTPSHVSHIQGTILCSKKVGLQIRTRSGGHDSEGMSYIS QVPFVIVDLRNMRSIKIDVHSQTAWVEAGATLGEVYYNVNEKNENLTLAAGYCPTVCA GGHFGGGGYGPLMRSYGLAADNIIDAHLVNVDGKVLDRKSMGEDLFWALRGGGAESF GIVVAWKIRLVAVPKSTMFSVKKIMEIHELVKLVNKWQNIAYKYDKDLLLMTHFITRNI TDNQGNNKTAIHTYFSCVFLGGVDSLVDLMNKTFPELGIKKTDCRQLSWIDTIIFYSGVV NYDTDNFNKEILLDRSAGQNGAFKIKLDYVKKPIPESVFVQILEKLYEEDIGAGMYALYP YGGIMDEISESAIPFPHRAGILYELWYICSWEKQEDNEKHLNWIRNIYNFMTPYVSQNPR LAYLNYRDLDIGINDPKNPNNYTQARIWGEKYFGKNFDRLVKVKTLVDPNNFFRNEQSI PPLPRHR SEQIDNO:151-CBDaSfromCannabissativa NPRENFLKCFSQYIDNNATNDKLVYTQNNPLYMSVLNSTIHNLRFSSDTTPKPLVIVTPS HVSHIQGTILCSKKVGLQIRTRSGGHDSEGMSYISQVPFVIVDLRNMRSIKIDVHSQTAW VEAGATLGEVYYNVNEKNENLTLAAGYCPTVCAGGHFGGGGYGPLMRSYGLAADNII DAHLVNVDGKVLDRKSMGEDLFWALRGGGAESFGIVVAWKIRLVAVPKSTMFSVKKI MEIHELVKLVNKWQNIAYKYDKDLLLMTHFITRNITDNQGNNKTAIHTYFSCVFLGGVD SLVDLMNKTFPELGIKKTDCRQLSWIDTIIFYSGVVNYDTDNFNKEILLDRSAGQNGAFK IKLDYVKKPIPESVFVQILEKLYEEDIGAGMYALYPYGGIMDEISESAIPFPHRAGILYEL WYICSWEKQEDNEKHLNWIRNIYNFMTPYVSQNPRLAYLNYRDLDIGINDPKNPNNYT QARIWGEKYFGKNFDRLVKVKTLVDPNNFFRNEQSIPPLPRHR SEQIDNO:152-Linker VVPAIPN SEQIDNO:153-MF(alpha)-preprofromSaccharomycescerevisiae MRFPSIFTAVLFAASSALAAPVNTTTEDETAQIPAEAVIGYLDLEGDFDVAVLPFSNSTN NGLLFINTTIASIAAKEEGVSLDKREAEA SEQIDNO:154-MF(alpha)-pre,syntheticpro1fromSaccharomycescerevisiae MRFPSIFTAVLFAASSALAQPIDDTESNTTSVNLMADDTESRFATNTTLALDVVNLISMA KREEAEAEAEPK SEQIDNO:155-MF(alpha)-pre,syntheticpro2fromSaccharomycescerevisiae MRFPSIFTAVLFAASSALAQPIDDTESQTTSVNLMADDTESAFATQTNSGGLDVVGLISM AKREEGEPK SEQIDNO:156-PEP4wholeproteinfromSaccharomycescerevisiae MFSLKALLPLALLLVSANQVAAKVHKAKIYKHELSDEMKEVTFEQHLAHLGQKYLTQF EKANPEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTPPQNFKVILDTGSSNLWVP SNECGSLACFLHSKYDHEASSSYKANGTEFAIQYGTGSLEGYISQDTLSIGDLTIPKQDFA EATSEPGLTFAFGKFDGILGLGYDTISVDKVVPPFYNAIQQDLLDEKRFAFYLGDTSKDT ENGGEATFGGIDESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTS LITLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGPYDYTLEVS GSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVGLAKAIAEAAAKEAAAKA SEQIDNO:157-PEP4-preprofromSaccharomycescerevisiae MFSLKALLPLALLLVSANQVAAKVHKAKIYKHELSDEMKEVTFEQHLAHLGQKYLTQF EKANPEVVFSREHPFFTEAEAAAKEAAAKA SEQIDNO:158-pGAL1 TGGAACTTTCAGTAATACGCTTAACTGCTCATTGCTATATTGAAGTACGGATTAGAA GCCGCCGAGCGGGCGACAGCCCTCCGACGGAAGACTCTCCTCCGTGCGTCCTGGTCT TCACCGGTCGCGTTCCTGAAACGCAGATGTGCCTCGCGCCGCACTGCTCCGAACAAT AAAGATTCTACAATACTAGCTTTTATGGTTATGAAGAGGAAAAATTGGCAGTAACCT GGCCCCACAAACCTTCAAATCAACGAATCAAATTAACAACCATAGGATAATAATGC GATTAGTTTTTTAGCCTTATTTCTGGGGTAATTAATCAGCGAAGCGATGATTTTTGAT CTATTAACAGATATATAAATGCAAAAGCTGCATAACCACTTTAACTAATACTTTCAA CATTTTCGGTTTGTATTACTTCTTATTCAAATGTCATAAAAGTATCAACAAAAAATTG TTAATATACCTCTATACTTTAACGTCAAGGAGAAAAAACTATA SEQIDNO:159-pGAL10 CATCGCTTCGCTGATTAATTACCCCAGAAATAAGGCTAAAAAACTAATCGCATTATT ATCCTATGGTTGTTAATTTGATTCGTTGATTTGAAGGTTTGTGGGGCCAGGTTACTGC CAATTTTTCCTCTTCATAACCATAAAAGCTAGTATTGTAGAATCTTTATTGTTCGGAG CAGTGCGGCGCGAGGCACATCTGCGTTTCAGGAACGCGACCGGTGAAGACCAGGAC GCACGGAGGAGAGTCTTCCGTCGGAGGGCTGTCGCCCGCTCGGCGGCTTCTAATCCG TACTTCAATATAGCAATGAGCAGTTAAGCGTATTACTGAAAGTTCCAAAGAGAAGG TTTTTTTAGGCTAAGATAATGGGGCTCTTTACATTTCCACAACATATAAGTAAGATTA GATATGGATATGTATATGGTGGTATTGCCATGTAATATGATTATTAAACTTCTTTGCG TCCATCCAAAAAAAAAGTAAGAATTTTTGAAAATTCAATATAA SEQIDNO:160-pGAL2 GGCTTAAGTAGGTTGCAATTTCTTTTTCTATTAGTAGCTAAAAATGGGTCACGTGATC TATATTCGAAAGGGGCGGTTGCCTCAGGAAGGCACCGGCGGTCTTTCGTCCGTGCGG AGATATCTGCGCCGTTCAGGGGTCCATGTGCCTTGGACGATATTAAGGCAGAAGGC AGTATCGGGGCGGATCACTCCGAACCGAGATTAGTTAAGCCCTTCCCATCTCAAGAT GGGGAGCAAATGGCATTATACTCCTGCTAGAAAGTTAACTGTGCACATATTCTTAAA TTATACAATGTTCTGGAGAGCTATTGTTTAAAAAACAAACATTTCGCAGGCTAAAAT GTGGAGATAGGATTAGTTTTGTAGACATATATAAACAATCAGTAATTGGATTGAAAA TTTGGTGTTGTGAATTGCTCTTCATTATGCACCTTATTCAATTATCATCAAGAATAGC AATAGTTAAGTAAACACAAGATTAACATAATAAAAAAAATAATTCTTTCATA SEQIDNO:161-pGAL3 TTTTACTATTATCTTCTACGCTGACAGTAATATCAAACAGTGACACATATTAAACAC AGTGGTTTCTTTGCATAAACACCATCAGCCTCAAGTCGTCAAGTAAAGATTTCGTGT TCATGCAGATAGATAACAATCTATATGTTGATAATTAGCGTTGCCTCATCAATGCGA GATCCGTTTAACCGGACCCTAGTGCACTTACCCCACGTTCGGTCCACTGTGTGCCGA ACATGCTCCTTCACTATTTTAACATGTGGAATTCTTGAAAGAATGAAATCGCCATGC CAAGCCATCACACGGTCTTTTATGCAATTGATTGACCGCCTGCAACACATAGGCAGT AAAATTTTTACTGAAACGTATATAATCATCATAAGCGACAAGTGAGGCAACACCTTT GTTACCACATTGACAACCCCAGGTATTCATACTTCCTATTAGCGGAATCAGGAGTGC AAAAAGAGAAAATAAAAGTAAAAAGGTAGGGCAACACATAGT SEQIDNO:162-pGAL7 GGACGGTAGCAACAAGAATATAGCACGAGCCGCGAAGTTCATTTCGTTACTTTTGAT ATCGCTCACAACTATTGCGAAGCGCTTCAGTGAAAAAATCATAAGGAAAAGTTGTA AATATTATTGGTAGTATTCGTTTGGTAAAGTAGAGGGGGTAATTTTTCCCCTTTATTT TGTTCATACATTCTTAAATTGCTTTGCCTCTCCTTTTGGAAAGCTATACTTCGGAGCA CTGTTGAGCGAAGGCTCATTAGATATATTTTCTGTCATTTTCCTTAACCCAAAAATAA GGGAAAGGGTCCAAAAAGCGCTCGGACAACTGTTGACCGTGATCCGAAGGACTGGC TATACAGTGTTCACAAAATAGCCAAGCTGAAAATAATGTGTAGCTATGTTCAGTTAG TTTGGCTAGCAAAGATATAAAAGCAGGTCGGAAATATTTATGGGCATTATTATGCAG AGCATCAACATGATAAAAAAAAACAGTTGAATATTCCCTCAAAA SEQIDNO:163-pGAL4 GCGACACAGAGATGACAGACGGTGGCGCAGGATCCGGTTTAAACGAGGATCCCTTA AGTTTAAACAACAACAGCAAGCAGGTGTGCAAGACACTAGAGACTCCTAACATGAT GTATGCCAATAAAACACAAGAGATAAACAACATTGCATGGAGGCCCCAGAGGGGCG ATTGGTTTGGGTGCGTGAGCGGCAAGAAGTTTCAAAACGTCCGCGTCCTTTGAGACA GCATTCGCCCAGTATTTTTTTTATTCTACAAACCTTCTATAATTTCAAAGTATTTACA TAATTCTGTATCAGTTTAATCACCATAATATCGTTTTCTTTGTTTAGTGCAATTAATTT TTCCTATTGTTACTTCGGGCCTTTTTCTGTTTTATGAGCTATTTTTTCCGTCATCCTTC CCCAGATTTTCAGCTTCATCTCCAGATTGTGTCTACGTAATGCACGCCATCATTTTAA GAGAGGACAGAGAAGCAAGCCTCCTGAAAG SEQIDNO:164-pMAL1 GATGATGGACACTAGTGTGTCGAGAATGTATCAACTATATATAGTCCTAATGCCACA CAAATATGAAGTGGGGGAAGCCCATTCTTAATCCGGCTCAATTTTGGTGCGTGATCG CGGCCTATGTTTGCTTCCAGAAAAAGCTTAGAATAATATTTCTCACCTTTGATGGAA TGCTCGCGAGTGCTCGTTTTGATTACCCCATATGCATTGTTGCAGCATGCAAGCACT ATTGCAAGCCACGCATGGAAGAAATTTGCAAACACCTATAGCCCCGCGTTGTTGAG GAGGTGGACTTGGTGTAGGACCATAAAGCTGTGCACTACTATGGTGAGCTCTGTCGT CTGGTGACCTTCTATCTCAGGCACATCCTCGTTTTTGTGCATGAGGTTCGAGTCACGC CCACGGCCTATTAATCCGCGAAATAAATGCGAAATCTAAATTATGACGCAAGGCTG AGAGATTCTGACACGCCGCATTTGCGGGGCAGTAATTATCGGGCAGTTTTCCGGGGT TCGGGATGGGGTTTGGAGAGAAAGTTCAACACAGACCAAAACAGCTTGGGACCACT TGGATGGAGGTCCCCGCAGAAGAGCTCTGGCGCGTTGGACAAACATTGACAATCCA CGGCAAAATTGTCTACAGTTCCGTGTATGCGGATAGGGATATCTTCGGGAGTATCGC AATAGGATACAGGCACTGTGCAGATTACGCGACATGATAGCTTTGTATGTTCTACAG ACTCTGCCGTAGCAGTCTAGATATAATATCGGAGTTTTGTAGCGTCGTAAGGAAAAC TTGGGTTACACAGGTTTCTTGAGAGCCCTTTGACGTTGATTGCTCTGGCTTCCATCCA GGCCCTCATGTGGTTCAGGTGCCTCCGCAGTGGCTGGCAAGCGTGGGGGTCAATTAC GTCACTTCTATTCATGTACCCCAGACTCAATTGTTGACAGCAATTTCAGCGAGAATT AAATTCCACAATCAATTCTCGCTGAAATAATTAGGCCGTGATTTAATTCTCGCTGAA ACAGAATCCTGTCTGGGGTACAGATAACAATCAAGTAACTATTATGGACGTGCATA GGAGGTGGAGTCCATGACGCAAAGGGAAATATTCATTTTATCCTCGCGAAGTTGGG ATGTGTCAAAGCGTCGCGCTCGCTATAGTGATGAGAATGTCTTTAGTAAGCTTAAGC CATATAAAGACCTTCCGCCTCCATATTTTTTTTTATCCCTCTTGACAATATTAATTCCT T SEQIDNO:165-pMAL2 AAGGAATTAATATTGTCAAGAGGGATAAAAAAAAATATGGAGGCGGAAGGTCTTTA TATGGCTTAAGCTTACTAAAGACATTCTCATCACTATAGCGAGCGCGACGCTTTGAC ACATCCCAACTTCGCGAGGATAAAATGAATATTTCCCTTTGCGTCATGGACTCCACC TCCTATGCACGTCCATAATAGTTACTTGATTGTTATCTGTACCCCAGACAGGATTCTG TTTCAGCGAGAATTAAATCACGGCCTAATTATTTCAGCGAGAATTGATTGTGGAATT TAATTCTCGCTGAAATTGCTGTCAACAATTGAGTCTGGGGTACATGAATAGAAGTGA CGTAATTGACCCCCACGCTTGCCAGCCACTGCGGAGGCACCTGAACCACATGAGGG CCTGGATGGAAGCCAGAGCAATCAACGTCAAAGGGCTCTCAAGAAACCTGTGTAAC CCAAGTTTTCCTTACGACGCTACAAAACTCCGATATTATATCTAGACTGCTACGGCA GAGTCTGTAGAACATACAAAGCTATCATGTCGCGTAATCTGCACAGTGCCTGTATCC TATTGCGATACTCCCGAAGATATCCCTATCCGCATACACGGAACTGTAGACAATTTT GCCGTGGATTGTCAATGTTTGTCCAACGCGCCAGAGCTCTTCTGCGGGGACCTCCAT CCAAGTGGTCCCAAGCTGTTTTGGTCTGTGTTGAACTTTCTCTCCAAACCCCATCCCG AACCCCGGAAAACTGCCCGATAATTACTGCCCCGCAAATGCGGCGTGTCAGAATCT CTCAGCCTTGCGTCATAATTTAGATTTCGCATTTATTTCGCGGATTAATAGGCCGTGG GCGTGACTCGAACCTCATGCACAAAAACGAGGATGTGCCTGAGATAGAAGGTCACC AGACGACAGAGCTCACCATAGTAGTGCACAGCTTTATGGTCCTACACCAAGTCCACC TCCTCAACAACGCGGGGCTATAGGTGTTTGCAAATTTCTTCCATGCGTGGCTTGCAA TAGTGCTTGCATGCTGCAACAATGCATATGGGGTAATCAAAACGAGCACTCGCGAG CATTCCATCAAAGGTGAGAAATATTATTCTAAGCTTTTTCTGGAAGCAAACATAGGC CGCGATCACGCACCAAAATTGAGCCGGATTAAGAATGGGCTTCCCCCACTTCATATT TGTGTGGCATTAGGACTATATATAGTTGATACATTCTCGACACACTAGTGTCCATCA TC SEQIDNO:166-pMAL11 GCGCCTCAAGAAAATGATGCTGCAAGAAGAATTGAGGAAGGAACTATTCATCTTAC GTTGTTTGTATCATCCCACGATCCAAATCATGTTACCTACGTTAGGTACGCTAGGAA CTAAAAAAAGAAAAGAAAAGTATGCGTTATCACTCTTCGAGCCAATTCTTAATTGTG TGGGGTCCGCGAAAATTTCCGGATAAATCCTGTAAACTTTAACTTAAACCCCGTGTT TAGCGAAATTTTCAACGAAGCGCGCAATAAGGAGAAATATTATCTAAAAGCGAGAG TTTAAGCGAGTTGCAAGAATCTCTACGGTACAGATGCAACTTACTATAGCCAAGGTC TATTCGTATTACTATGGCAGCGAAAGGAGCTTTAAGGTTTTAATTACCCCATAGCCA TAGATTCTACTCGGTCTATCTATCATGTAACACTCCGTTGATGCGTACTAGAAAATG ACAACGTACCGGGCTTGAGGGACATACAGAGACAATTACAGTAATCAAGAGTGTAC CCAACTTTAACGAACTCAGTAAAAAATAAGGAATGTCGACATCTTAATTTTTTATAT AAAGCGGTTTGGTATTGATTGTTTGAAGAATTTTCGGGTTGGTGTTTCTTTCTGATGC TACATAGAAGAACATCAAACAACTAAAAAAATAGTATAAT SEQIDNO:167-pMAL12 ATTATACTATTTTTTTAGTTGTTTGATGTTCTTCTATGTAGCATCAGAAAGAAACACC AACCCGAAAATTCTTCAAACAATCAATACCAAACCGCTTTATATAAAAAATTAAGAT GTCGACATTCCTTATTTTTTACTGAGTTCGTTAAAGTTGGGTACACTCTTGATTACTG TAATTGTCTCTGTATGTCCCTCAAGCCCGGTACGTTGTCATTTTCTAGTACGCATCAA CGGAGTGTTACATGATAGATAGACCGAGTAGAATCTATGGCTATGGGGTAATTAAA ACCTTAAAGCTCCTTTCGCTGCCATAGTAATACGAATAGACCTTGGCTATAGTAAGT TGCATCTGTACCGTAGAGATTCTTGCAACTCGCTTAAACTCTCGCTTTTAGATAATAT TTCTCCTTATTGCGCGCTTCGTTGAAAATTTCGCTAAACACGGGGTTTAAGTTAAAGT TTACAGGATTTATCCGGAAATTTTCGCGGACCCCACACAATTAAGAATTGGCTCGAA GAGTGATAACGCATACTTTTCTTTTCTTTTTTTAGTTCCTAGCGTACCTAACGTAGGT AACATGATTTGGATCGTGGGATGATACAAACAACGTAAGATGAATAGTTCCTTCCTC AATTCTTCTTGCAGCATCATTTTCTTGAGGCGCTCTGGGCAAGGTATAAAAAGTTCC ATTAATACGTCTCTAAAAAATTAAATCATCCATCTCTTAAGCAGTTTTTTTGATAATC TCAAATGTACATCAGTCAAGCGTAACTAAATTACATAA SEQIDNO:168-pMAL31 TTATGTATTTTAGTTACGCTTGACTGATGTACATTTGAGATTATCAAAAAAACTGCTT AAGAGATAGATGGTTTAATTTTTTAGAGACGTATTAATGGAACTTTTTATACCTTGCC CAGAGCGCCTCAAGAAAATGATGCTGAAAGAAGAATTGAGGAAGGAACTACTCATC TTACGTTGTTTGTATCATCCCACGATCCAAATCATGTTACCTACGTTAGGTACGCTAG GAACTGAAAAAAGAAAAGAAAAGTATGCGTTATCACTCTTCGAGCCAATTCTTAATT GTGTGGGGTCCGCGAAAACTTCCGGATAAATCCTGTAAACTTAAACTTAAACCCCGT GTTTAGCGAAATTTTCAACGAAGCGCGCAATAAGGAGAAATATTATATAAAAGCGA GAGTTTAAGCGAGGTTGCAAGAATCTCTACGGTACAGATGCAACTTACTATAGCCAA GGTCTATTCGTATTGGTATCCAAGCAGTGAAGCTACTCAGGGGAAAACATATTTTCA GAGATCAAAGTTATGTCAGTCTCTTTTTCATGTGTAACTTAACGTTTGTGCAGGTATC ATACCGGCCTCCACATAATTTTTGTGGGGAAGACGTTGTTGTAGCAGTCTCCTTATA CTCTCCAACAGGTGTTTAAAGACTTCTTCAGGCCTCATAGTCTACATCTGGAGACAA CATTAGATAGAAGTTTCCACAGAGGCAGCTTTCAATATACTTTCGGCTGTGTACATT TCATCCTGAGTGAGCGCATATTGCATAAGTACTCAGTATATAAAGAGACACAATATA CTCCATACTTGTTGTGAGTGGTTTTAGCGTATTCAGTATAACAATAAGAATTACATCC AAGACTATTAATTAACT SEQIDNO:169-pMAL32 AGTTAATTAATAGTCTTGGATGTAATTCTTATTGTTATACTGAATACGCTAAAACCAC TCACAACAAGTATGGAGTATATTGTGTCTCTTTATATACTGAGTACTTATGCAATATG CGCTCACTCAGGATGAAATGTACACAGCCGAAAGTATATTGAAAGCTGCCTCTGTGG AAACTTCTATCTAATGTTGTCTCCAGATGTAGACTATGAGGCCTGAAGAAGTCTTTA AACACCTGTTGGAGAGTATAAGGAGACTGCTACAACAACGTCTTCCCCACAAAAAT TATGTGGAGGCCGGTATGATACCTGCACAAACGTTAAGTTACACATGAAAAAGAGA CTGACATAACTTTGATCTCTGAAAATATGTTTTCCCCTGAGTAGCTTCACTGCTTGGA TACCAATACGAATAGACCTTGGCTATAGTAAGTTGCATCTGTACCGTAGAGATTCTT GCAACCTCGCTTAAACTCTCGCTTTTATATAATATTTCTCCTTATTGCGCGCTTCGTT GAAAATTTCGCTAAACACGGGGTTTAAGTTTAAGTTTACAGGATTTATCCGGAAGTT TTCGCGGACCCCACACAATTAAGAATTGGCTCGAAGAGTGATAACGCATACTTTTCT TTTCTTTTTTCAGTTCCTAGCGTACCTAACGTAGGTAACATGATTTGGATCGTGGGAT GATACAAACAACGTAAGATGAGTAGTTCCTTCCTCAATTCTTCTTTCAGCATCATTTT CTTGAGGCGCTCTGGGCAAGGTATAAAAAGTTCCATTAATACGTCTCTAAAAAATTA AACCATCTATCTCTTAAGCAGTTTTTTTGATAATCTCAAATGTACATCAGTCAAGCGT AACTAAAATACATAA SEQIDNO:170-CBGaSfromStachybotryschartarum MSAKVSPMAYTNPRYETGPLSLIPKPIVPYFELMRFELPHGYYLGYFPHLVGIMYGASA GPERLPARDLVFQALLYVGWTFAMRGAGCAWNDNIDQDFDRKTERCRTRPIARGAVST TAGHVFAVAGVALAFLCLSPLPTECHQLGVLFTVLSVIYPFCKRFTNFAQVILGMTLAA NFILAAYGAGLPALEQPYTRPTMSATLAITLLVVFYDVVYARQDTADDLKSGVKGMAV LFRNHIEVLLAVLTCTIGGLLAATGVSVGNGPYYFLFSVAGLTVALLAMIGGIRYRIFHT WNGYSGWFYVLAIINLMSGYFIEYLDNAPILARGS SEQIDNO:171-GeranylpyrophosphatesynthasefromStreptomycesaculeolatus MTTEVTSFTGAGPHPAASVRRITDDLLQRVEDKLASFLTAERDRYAAMDERALAAVDA LTDLVTSGGKRVRPTFCITGYLAAGGDAGDPGIVAAAAGLEMLHVSALIHDDILDNSAQ RRGKPTIHTLYGDLHDSHGWRGESRRFGEGIGILIGNLALVYSQELVCQAPPAVLAEWH RLCSEVNIGQCLDVCAAAEFSADPELSRLVALIKSGRYTIHRPLVMGANAASRPDLAAA YVEYGEAVGEAFQLRDDLLDAFGDSTETGKPTGLDFTQHKMTLLLGWAMQRDTHIRTL MTEPGHTPEEVRRRLEDTEVPKDVERHIADLVEQGRAAIADAPIDPQWRQELADMAVR AAYRTN SEQIDNO:172-Linker EPEPEPEPEPEPEPEASAKALLSQPLLLI