RAPAMYCIN ANALOGS AS MTOR INHIBITORS

Abstract

The present disclosure relates to mTOR inhibitors. Specifically, the embodiments are directed to compounds and compositions inhibiting mTOR, methods of treating diseases mediated by mTOR, and methods of synthesizing these compounds.

Claims

1. A compound represented by Formula I-X: ##STR01302## or a pharmaceutically acceptable salt, oxepane isomer, stereoisomer, or tautomer thereof, wherein: R.sup.16 is selected from R.sup.1, R.sup.2, H, (C.sub.1-C.sub.6)alkyl, —OR.sup.3, —SR.sup.3, ═O, —NR.sup.3C(O)OR.sup.3, —NR.sup.3C(O)N(R.sup.3).sub.2, —NR.sup.3S(O).sub.2OR.sup.3, —NR.sup.3S(O).sub.2N(R.sup.3).sub.2, —NR.sup.3S(O).sub.2R.sup.3, (C.sub.6-C.sub.10)aryl, and 5-7 membered heteroaryl, and ##STR01303## wherein the aryl and heteroaryl is optionally substituted with one or more substituents each independently selected from alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, and hydroxyl; R.sup.26 is selected from ═N—R.sup.1, ═N—R.sup.2, ═O, —OR.sup.3, and ═N—OR.sup.3; R.sup.28 is selected from R.sup.1, R.sup.2, —OR.sup.3, —OC(O)O(C(R.sup.3).sub.2).sub.n, —OC(O)N(R.sup.3).sub.2, —OS(O).sub.2N(R.sub.3).sub.2, and —N(R.sub.3)S(O).sub.2OR.sub.3; R.sup.32 is selected from ═N—R.sup.1, ═N—R.sup.2, H, ═O, —OR.sup.3, ═N—OR.sup.3, ═N—NHR.sup.3, and N(R.sup.3).sub.2; R.sup.40 is selected from R.sup.1, R.sup.2, —OR.sup.3, —SR.sup.3, —N.sub.3, —N(R.sup.3).sub.2, —NR.sup.3C(O)OR.sup.3, —NR.sup.3C(O)N(R.sup.3).sub.2, —NR.sup.3S(O).sub.2OR.sup.3, —NR.sup.3S(O).sub.2N(R.sup.3).sub.2, —NR.sup.3S(O).sub.2R.sup.3, —OP(O)(OR.sup.3).sub.2, —OP(O)(R.sup.3).sub.2, —NR.sup.3C(O)R.sup.3, —S(O)R.sup.3, —S(O).sub.2R.sup.3, —OS(O).sub.2NHC(O)R.sup.3, ##STR01304## wherein the compound comprises one R.sup.1 or one R.sup.2; R.sup.1 is -A-L.sup.1-B; R.sup.2 is -A-C≡CH, -A-N.sub.3, -A-COOH, or -A-NHR.sup.3; and wherein A is absent or is selected from —(C(R.sup.3).sub.2).sub.n—, —O(C(R.sup.3).sub.2).sub.n—, —NR.sup.3(C(R.sup.3).sub.2).sub.n—, —O(C(R.sup.3).sub.2).sub.n—[O(C(R.sup.3).sub.2).sub.n].sub.o—O(C(R.sup.3).sub.2).sub.p—, —C(O)(C(R.sup.3).sub.2).sub.n—, —C(O)NR.sup.3—, —NR.sup.3C(O)(C(R.sup.3).sub.2).sub.n—, —NR.sup.3C(O)O(C(R.sup.3).sub.2).sub.n—, —OC(O)NR.sup.3(C(R.sup.3).sub.2).sub.n—, —NHSO.sub.2NH(C(R.sup.3).sub.2).sub.n—, —OC(O)NHSO.sub.2NH(C(R.sup.3).sub.2).sub.n—, —O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-, —O(C(R.sup.3).sub.2).sub.n-heteroarylene-, —OC(O)NH(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-, —O—(C.sub.6-C.sub.10)arylene-, —O-heteroarylene-, -heteroarylene-(C.sub.6-C.sub.10)arylene-, —O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-(C.sub.6-C.sub.10)arylene-, —O(C(R.sup.3).sub.2).sub.n-heteroarylene-heteroarylene-, —O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-(C(R.sup.3).sub.2).sub.n—, —O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-O(C(R.sup.3).sub.2).sub.n—, —O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-NR.sup.3(C(R.sup.3).sub.2).sub.n—, —O(C(R.sup.3).sub.2).sub.n-heteroarylene-heterocyclylene-C(O)(C(R.sup.3).sub.2).sub.n—, -heteroarylene-(C.sub.6-C.sub.10)arylene-(C.sub.6-C.sub.10)arylene-, -heteroarylene-(C.sub.6-C.sub.10)arylene-heteroarylene-O(C(R.sup.3).sub.2).sub.n—, -heteroarylene-(C.sub.6-C.sub.10)arylene-heteroarylene-(C(R.sup.3).sub.2).sub.n2—O(C(R.sup.3).sub.2).sub.n—, —O(C(R.sup.3).sub.2).sub.n-heteroarylene-heteroarylene-NR.sup.3—(C.sub.6-C.sub.10)arylene-, —O(C(R.sup.3).sub.2).sub.n-heteroarylene-heteroarylene-heterocyclylene-(C(R.sup.3).sub.2).sub.n—, —O(C(R.sup.3).sub.2).sub.n-heteroarylene-heteroarylene-heterocyclylene-C(O)(C(R.sup.3).sub.2).sub.n—, —O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-(C(R.sup.3).sub.2).sub.n—, —O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-C(O)(C(R.sup.3).sub.2).sub.n—, —O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-SO.sub.2(C(R.sup.3).sub.2).sub.n—, -heteroarylene-(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-(C(R.sup.3).sub.2).sub.n—, -heteroarylene-(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-C(O)(C(R.sup.3).sub.2).sub.n—, -heteroarylene-(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-SO.sub.2(C(R.sup.3).sub.2).sub.n—, and —O(C(R.sup.3).sub.2).sub.n-heteroarylene-heteroarylene-heterocyclylene-S(O).sub.2NR.sup.3—(C.sub.6-C.sub.10)arylene-, wherein heteroarylene is 5-12 membered and contains 1-4 heteroatoms selected from O, N, and S; heterocyclylene is 5-12 membered and contains 1-4 heteroatoms selected from O, N, and S; wherein the arylene, heteroarylene, and heterocyclylene are optionally substituted with one or more substituents each independently selected from alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, hydroxyl, —C(O)OR.sup.3, —C(O)N(R.sup.3).sub.2, —N(R.sup.3).sub.2, and alkyl substituted with —N(R.sup.3).sub.2; L.sup.1 is selected from ##STR01305## ##STR01306## ##STR01307## ##STR01308## wherein the bond with variable position in the triazole is in the 4-position or 5-position, and wherein the A ring is phenylene or 5-8 membered heteroarylene; B is selected from ##STR01309## ##STR01310## ##STR01311## as drawn, is bound to L.sup.1; and wherein the heteroaryl, heterocyclyl, and arylene are optionally substituted with alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, or hydroxyl; each R.sup.3 is independently H, (C.sub.1-C.sub.6)alkyl, —C(O)(C.sub.1-C.sub.6)alkyl, —C(O)NH-aryl, or —C(S)NH-aryl, wherein the alkyl is unsubstituted or substituted with —COOH, (C.sub.6-C.sub.10)aryl or —OH; each R.sup.4 is independently H, (C.sub.1-C.sub.6)alkyl, halogen, 5-12 membered heteroaryl, 5-12 membered heterocyclyl, (C.sub.6-C.sub.10)aryl, wherein the heteroaryl, heterocyclyl, and aryl are optionally substituted with —N(R.sup.3).sub.2, —OR.sup.3, halogen, (C.sub.1-C.sub.6)alkyl, —(C.sub.1-C.sub.6)alkylene-heteroaryl, —(C.sub.1-C.sub.6)alkylene-CN, —C(O)NR.sup.3-heteroaryl, or —C(O)NR.sup.3-heterocyclyl; each Q is independently C(R.sup.3).sub.2 or O; each Y is independently C(R.sup.3).sub.2 or a bond; each n is independently a number from one to 12; each o is independently a number from zero to 12; each p is independently a number from zero to 12; each q is independently a number from zero to 30; and each r is independently 1, 2, 3, or 4; provided that when R.sup.40 is wherein R.sup.1, is -A-L.sup.1-B; L.sup.1 is ##STR01312## B is ##STR01313## then A is not —O(CH.sub.2).sub.2—O(CH.sub.2)—.

2-3. (canceled)

4. The compound of claim 1, represented by Formula (Ia-X): ##STR01314## or a pharmaceutically acceptable salt, oxepane isomer, stereoisomer, or tautomer thereof, wherein R.sup.16 is R.sup.1 or R.sup.2.

5. The compound of claim 1, represented by Formula (Ib-X): ##STR01315## or a pharmaceutically acceptable salt, oxepane isomer, stereoisomer, or tautomer thereof, wherein R.sup.26 is ═N—R.sup.1 or ═N—R.sup.2.

6. The compound of claim 1, represented by Formula (Ic-X): ##STR01316## or a pharmaceutically acceptable salt, oxepane isomer, stereoisomer, or tautomer thereof, wherein R.sup.28 is R.sup.1 or R.sup.2.

7. The compound of claim 1, represented by Formula (Id-X): ##STR01317## or a pharmaceutically acceptable salt, oxepane isomer, stereoisomer, or tautomer thereof, wherein R.sup.32 is ═N—R.sup.1 or R.sup.2.

8. The compound of claim 1, represented by Formula (Ie-X): ##STR01318## or a pharmaceutically acceptable salt, oxepane isomer, stereoisomer, or tautomer thereof, wherein R.sup.40 is R.sup.1 or R.sup.2.

9. The compound of claim 1, or a pharmaceutically acceptable salt, oxepane isomer, stereoisomer, or tautomer thereof, wherein the compound comprises R.sup.1.

10. The compound of claim 1, or a pharmaceutically acceptable salt, oxepane isomer, stereoisomer, or tautomer thereof, wherein the compound comprises R.sup.2.

11-14. (canceled)

15. The compound of claim 1, or a pharmaceutically acceptable salt, oxepane isomer, stereoisomer, or tautomer thereof, wherein A is —O(C(R.sup.3).sub.2).sub.n—.

16. The compound of claim 1, or a pharmaceutically acceptable salt, oxepane isomer, stereoisomer, or tautomer thereof, wherein A is —O(C(R.sup.3).sub.2).sub.n—[O(C(R.sup.3).sub.2).sub.n].sub.o—O(C(R.sup.3).sub.2).sub.p—.

17. The compound of claim 1, or a pharmaceutically acceptable salt, oxepane isomer, stereoisomer, or tautomer thereof, wherein A is —O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-(C(R.sup.3).sub.2).sub.n—.

18-21. (canceled)

22. The compound of claim 1, or a pharmaceutically acceptable salt, oxepane isomer, stereoisomer, or tautomer thereof, wherein L.sup.1 is ##STR01319##

23. The compound of claim 1, or a pharmaceutically acceptable salt, oxepane isomer, stereoisomer, or tautomer thereof, wherein L.sup.1 is ##STR01320##

24. The compound of claim 1, or a pharmaceutically acceptable salt, oxepane isomer, stereoisomer, or tautomer thereof, wherein L.sup.1 is ##STR01321##

25-35. (canceled)

36. The compound of claim 1, or a pharmaceutically acceptable salt, oxepane isomer, stereoisomer, or tautomer thereof, wherein B is ##STR01322##

37. The compound of claim 1, or a pharmaceutically acceptable salt, oxepane isomer, stereoisomer, or tautomer thereof, wherein B is ##STR01323##

38. The compound of claim 1, or a pharmaceutically acceptable salt, oxepane isomer, stereoisomer, or tautomer thereof, wherein B.sup.1 is custom-character NR.sup.3—(C(R.sup.3).sub.2).sub.n—.

39. The compound of claim 1, or a pharmaceutically acceptable salt, oxepane isomer, stereoisomer, or tautomer thereof, wherein B.sup.1 is ##STR01324##

40. The compound of claim 1, or a pharmaceutically acceptable salt, oxepane isomer, stereoisomer, or tautomer thereof, wherein R.sup.4 is 5-12 membered heteroaryl, optionally substituted with —N(R.sup.3).sub.2, —OR.sup.3, halogen, (C.sub.1-C.sub.6)alkyl, —(C.sub.1-C.sub.6)alkylene-heteroaryl, —(C.sub.1-C.sub.6)alkylene-CN, or —C(O)NR.sup.3-heteroaryl.

41. The compound of claim 1, or a pharmaceutically acceptable salt, oxepane isomer, stereoisomer, or tautomer thereof, wherein R.sup.4 is heteroaryl optionally substituted with —NH.sub.2 or —OR.sup.3.

42. A compound selected from the group consisting of: TABLE-US-00054 Structure embedded image Example 1 embedded image Example 2 embedded image Example 3 embedded image Example 4 embedded image Example 5 embedded image Example 6 embedded image Example 7 embedded image Example 8 embedded image Example 9 embedded image Example 10 embedded image Example 11 embedded image Example 12 embedded image Example 13 embedded image Exampe 14 embedded image Example 15 embedded image Example 16 embedded image Example 17 embedded image Example 18 embedded image Example 19 embedded image Example 20 embedded image Example 21 embedded image Example 22 embedded image Example 23 embedded image Example 24 embedded image Example 25 embedded image Example 26 embedded image Example 27 embedded image Example 28 embedded image Example 29 embedded image Example 30 embedded image Example 31 embedded image Example 32 embedded image Example 33 embedded image Example 34 embedded image Example 35 embedded image Example 36 embedded image Example 37 embedded image Example 38 embedded image Example 39 embedded image Example 40 embedded image Example 41 embedded image Example 42 embedded image Example 43 embedded image Example 44 embedded image Example 45 embedded image Example 46 embedded image Example 47 embedded image Example 48 embedded image Example 49 embedded image Example 50 embedded image Example 51 embedded image Example 52 embedded image Example 53 embedded image Example 54 embedded image Example 55 embedded image Example 56 embedded image Example 57 embedded image Example 58 embedded image Example 59 embedded image Example 60 embedded image Example 61 embedded image Example 62 embedded image Example 63 embedded image Example 64 embedded image Example 65 embedded image Example 66 embedded image Example 67 embedded image Example 68 embedded image Example 69 embedded image Example 70 embedded image Example 71 embedded image Example 72 embedded image Example 73 embedded image Example 74 embedded image Example 75 embedded image Example 76 embedded image Example 77 embedded image Example 78 embedded image Example 79 embedded image Example 80 embedded image Example 81 embedded image Example 82 embedded image Example 83 embedded image Example 84 embedded image Example 85 embedded image Example 86 embedded image Example 87 embedded image Example 88 embedded image Example 89 embedded image Example 90 embedded image Example 91 embedded image Example 92 embedded image Example 93 embedded image Example 94 embedded image Example 95 embedded image Example 96 embedded image Example 97 embedded image Example 98 embedded image Example 99 embedded image Example 100 embedded image Example 101 embedded image Example 102 embedded image Example 103 embedded image Example 104 embedded image Example 105 embedded image Example 106 embedded image Example 107 embedded image Example 108 embedded image Example 109 embedded image Example 110 embedded image Example 111 embedded image Example 112 embedded image Example 113 embedded image Example 114 embedded image Example 115 embedded image Example 116 embedded image Example 117 embedded image Example 118 embedded image Example 119 embedded image Example 120 embedded image Example 121 embedded image Example 122 embedded image Example 123 embedded image Example 124 embedded image Example 125 embedded image Example 126 embedded image Example 127 embedded image Example 128 embedded image Example 129 embedded image Example 130 embedded image Example 131 embedded image Example 132 embedded image Example 133 embedded image Example 134 embedded image Example 135 embedded image Example 136 embedded image Example 137 embedded image Example 138 embedded image Example 139 embedded image Example 140 embedded image Example 141 embedded image Example 142 embedded image Example 143 embedded image Example 144 embedded image Example 145 embedded image Example 146 embedded image Example 147 embedded image Example 148 embedded image Example 149 embedded image Example 150 embedded image Example 151 embedded image Example 152 embedded image Example 153 embedded image Example 154 embedded image Example 155 embedded image Example 156 embedded image Example 157 embedded image Example 158 embedded image Example 159 embedded image Example 160 embedded image Example 161 embedded image Example 162 embedded image Example 163 embedded image Example 164 embedded image Example 165 embedded image Example 166 embedded image Example 167 embedded image Example 168 embedded image Example 169 embedded image Example 170 embedded image Example 171 embedded image Example 172 embedded image Example 173 embedded image Example 174 embedded image Example 175 embedded image Example 176 embedded image Example 177 embedded image Example 178 embedded image Example 179 embedded image Example 180 embedded image Example 181 embedded image Example 182 embedded image Example 183 embedded image Example 184 embedded image Example 185 embedded image Example 186 embedded image Example 187 embedded image Example 188 embedded image Example 189 embedded image Example 190 embedded image Example 191 embedded image Example 192 embedded image Example 193 embedded image Example 194 embedded image Example 195 embedded image Example 196 embedded image Example 197 embedded image Example 198 embedded image Example 199 embedded image Example 200 embedded image Example 201 embedded image Example 202 or a pharmaceutically acceptable salt, oxepane isomer, stereoisomer, or tautomer thereof.

43. A pharmaceutical composition comprising a compound of claim 1, or a pharmaceutically acceptable salt, oxepane isomer, stereoisomer, or tautomer thereof, and at least one of a pharmaceutically acceptable carrier, diluent, or excipient.

44. A method of treating, preventing, or reducing the risk of a disease or disorder mediated by mTOR comprising administering to the subject suffering from or susceptible to developing a disease or disorder mediated by mTOR a therapeutically effective amount of one or more compounds of claim 1, or a pharmaceutically acceptable salt, oxepane isomer, stereoisomer, or tautomer thereof.

45-49. (canceled)

50. A method of treating cancer comprising administering to the subject a therapeutically effective amount of one or more compounds of claim 1, or a pharmaceutically acceptable salt, oxepane isomer, stereoisomer, or tautomer thereof.

51. The method of claim 50, wherein the cancer is selected from the group consisting of brain tumors, neurovascular tumors, head and neck cancers, breast cancer, lung cancer, mesothelioma, lymphoid cancer, stomach cancer, kidney cancer, renal carcinoma, liver cancer, ovarian cancer, ovary endometriosis, testicular cancer, gastrointestinal cancer, prostate cancer, glioblastoma, skin cancer, melanoma, neurological cancers, spleen cancers, pancreatic cancers, blood proliferative disorders, lymphoma, leukemia, endometrial cancer, cervical cancer, vulva cancer, prostate cancer, penile cancer, bone cancers, muscle cancers, soft tissue cancers, intestinal or rectal cancer, anal cancer, bladder cancer, bile duct cancer, ocular cancer, gastrointestinal stromal tumors, and neuro-endocrine tumors.

52. A method of treating an immune-mediated disease comprising administering to the subject a therapeutically effective amount of one or more compounds of claim 1, or a pharmaceutically acceptable salt, oxepane isomer, stereoisomer, or tautomer thereof.

53. The method of claim 52, wherein the immune-mediated disease is selected from resistance by transplantation of heart, kidney, liver, medulla ossium, skin, cornea, lung, pancreas, intestinum tenue, limb, muscle, nerves, duodenum, small-bowel, or pancreatic-islet-cell; graft-versus-host diseases brought about by medulla ossium transplantation; rheumatoid arthritis, systemic lupus erythematosus, Hashimoto's thyroiditis, multiple sclerosis, myasthenia gravis, type I diabetes, uveitis, allergic encephalomyelitis, and glomerulonephritis.

54. A method of treating an age related condition comprising administering to the subject a therapeutically effective amount of one or more compounds of claim 1, or a pharmaceutically acceptable salt, oxepane isomer, stereoisomer, or tautomer thereof.

55. The method of claim 54, wherein the age related condition is selected from the group consisting of sarcopenia, skin atrophy, muscle wasting, brain atrophy, atherosclerosis, arteriosclerosis, pulmonary emphysema, osteoporosis, osteoarthritis, high blood pressure, erectile dysfunction, dementia, Huntington's disease, Alzheimer's disease, cataracts, age-related macular degeneration, prostate cancer, stroke, diminished life expectancy, impaired kidney function, and age-related hearing loss, aging-related mobility disability, cognitive decline, age-related dementia, memory impairment, tendon stiffness, heart dysfunction, immunosenescence, cancer, obesity, and diabetes.

56-63. (canceled)

64. The method of claim 55, wherein the aging-related mobility disability is frailty.

65. The method of claim 55, wherein the heart dysfunction is cardiac hypertrophy, systolic dysfunction, and diastolic dysfunction.

Description

DETAILED DESCRIPTION OF THE DISCLOSURE

[0258] The present disclosure relates to mTOR inhibitors. Specifically, the embodiments are directed to compounds and compositions inhibiting mTOR, methods of treating diseases mediated by mTOR, and methods of synthesizing these compounds

[0259] The details of the disclosure are set forth in the accompanying description below. Although methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present disclosure, illustrative methods and materials are now described. Other features, objects, and advantages of the disclosure will be apparent from the description and from the claims. In the specification and the appended claims, the singular forms also may include the plural unless the context clearly dictates otherwise. Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure belongs. All patents and publications cited in this specification are incorporated herein by reference in their entireties.

Terms

[0260] The articles “a” and “an” are used in this disclosure and may refer to one or more than one (i.e., to at least one) of the grammatical object of the article. By way of example, “an element” may mean one element or more than one element.

[0261] The term “and/or” is used in this disclosure and may mean either “and” or “or” unless indicated otherwise.

[0262] The term “alkyl,” by itself or as part of another substituent, may mean, unless otherwise stated, a straight (i.e., unbranched) or branched non-cyclic carbon chain (or carbon), or combination thereof, which may be fully saturated, mono- or polyunsaturated and can include di- and multivalent radicals, having the number of carbon atoms designated (i.e., C.sub.1-C.sub.10 means one to ten carbons). Examples of saturated hydrocarbon radicals may include, but are not limited to, groups such as methyl, ethyl, n-propyl, isopropyl, n-butyl, t-butyl, isobutyl, sec-butyl, (cyclohexyl)methyl, homologs and isomers of, for example, n-pentyl, n-hexyl, n-heptyl, n-octyl, and the like. An unsaturated alkyl group is one having one or more double bonds or triple bonds. Examples of unsaturated alkyl groups may include, but are not limited to, vinyl, 2-propenyl, crotyl, 2-isopentenyl, 2-(butadienyl), 2,4-pentadienyl, pentadienyl), ethynyl, 1- and 3-propynyl, 3-butynyl, and the higher homologs and isomers.

[0263] The term “alkylene,” by itself or as part of another substituent, may mean, unless otherwise stated, a divalent radical derived from an alkyl. Typically, an alkyl (or alkylene) group will have from 1 to 24 carbon atoms, such as those groups having 10 or fewer carbon atoms.

[0264] The term “alkenyl” may mean an aliphatic hydrocarbon group containing a carbon-carbon double bond and which may be straight or branched having about 2 to about 6 carbon atoms in the chain. Certain alkenyl groups have 2 to about 4 carbon atoms in the chain. Branched may mean that one or more lower alkyl groups such as methyl, ethyl, or propyl are attached to a linear alkenyl chain. Exemplary alkenyl groups may include ethenyl, propenyl, n-butenyl, and i-butenyl. A C.sub.2-C.sub.6 alkenyl group is an alkenyl group containing between 2 and 6 carbon atoms.

[0265] The term “alkenylene,” by itself or as part of another substituent, may mean, unless otherwise stated, a divalent radical derived from an alkene.

[0266] The term “alkynyl” may mean an aliphatic hydrocarbon group containing a carbon-carbon triple bond and which may be straight or branched having about 2 to about 6 carbon atoms in the chain. Certain alkynyl groups have 2 to about 4 carbon atoms in the chain. Branched may mean that one or more lower alkyl groups such as methyl, ethyl, or propyl are attached to a linear alkynyl chain. Exemplary alkynyl groups may include ethynyl, propynyl, n-butynyl, 2-butynyl, 3-methylbutynyl, and n-pentynyl. A C.sub.2-C.sub.6 alkynyl group is an alkynyl group containing between 2 and 6 carbon atoms.

[0267] The term “alkynylene,” by itself or as part of another substituent, may mean, unless otherwise stated, a divalent radical derived from an alkyne.

[0268] The term “cycloalkyl” may mean monocyclic or polycyclic saturated carbon rings containing 3-18 carbon atoms. Examples of cycloalkyl groups may include, without limitations, cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptanyl, cyclooctanyl, norboranyl, norborenyl, bicyclo[2.2.2]octanyl, or bicyclo[2.2.2]octenyl. A C.sub.3-C.sub.8 cycloalkyl is a cycloalkyl group containing between 3 and 8 carbon atoms. A cycloalkyl group can be fused (e.g., decalin) or bridged (e.g., norbornane).

[0269] A “cycloalkylene,” alone or as part of another substituent, may mean a divalent radical derived from a cycloalkyl.

[0270] The terms “heterocyclyl” or “heterocycloalkyl” or “heterocycle” may refer to monocyclic or polycyclic 3 to 24-membered rings containing carbon and heteroatoms taken from oxygen, phosphorous nitrogen, or sulfur and wherein there is not delocalized 7E electrons (aromaticity) shared among the ring carbon or heteroatoms. Heterocyclyl rings may include, but are not limited to, oxetanyl, azetadinyl, tetrahydrofuranyl, pyrrolidinyl, oxazolinyl, oxazolidinyl, thiazolinyl, thiazolidinyl, pyranyl, thiopyranyl, tetrahydropyranyl, dioxalinyl, piperidinyl, morpholinyl, thiomorpholinyl, thiomorpholinyl S-oxide, thiomorpholinyl S-dioxide, piperazinyl, azepinyl, oxepinyl, diazepinyl, tropanyl, and homotropanyl. A heteroycyclyl or heterocycloalkyl ring can also be fused or bridged, e.g., can be a bicyclic ring.

[0271] A “heterocyclylene” or “heterocycloalkylene,” alone or as part of another substituent, may mean a divalent radical derived from a “heterocyclyl” or “heterocycloalkyl” or “heterocycle.”

[0272] The term “aryl” may mean, unless otherwise stated, a polyunsaturated, aromatic, hydrocarbon substituent, which can be a single ring or multiple rings (preferably from 1 to 3 rings) that are fused together (i.e., a fused ring aryl) or linked covalently. A fused ring aryl may refer to multiple rings fused together wherein at least one of the fused rings is an aryl ring.

[0273] An “arylene,” alone or as part of another substituent, may mean a divalent radical derived from an aryl.

[0274] The term “heteroaryl” may refer to aryl groups (or rings) that contain at least one heteroatom such as N, O, or S, wherein the nitrogen and sulfur atoms are optionally oxidized, and the nitrogen atom(s) are optionally quaternized. Thus, the term “heteroaryl” may include fused ring heteroaryl groups (i.e., multiple rings fused together wherein at least one of the fused rings is a heteroaromatic ring). A 5,6-fused ring heteroarylene may refer to two rings fused together, wherein one ring has 5 members and the other ring has 6 members, and wherein at least one ring is a heteroaryl ring. Likewise, a 6,6-fused ring heteroarylene may refer to two rings fused together, wherein one ring has 6 members and the other ring has 6 members, and wherein at least one ring is a heteroaryl ring. And a 6,5-fused ring heteroarylene may refer to two rings fused together, wherein one ring has 6 members and the other ring has 5 members, and wherein at least one ring is a heteroaryl ring. A heteroaryl group can be attached to the remainder of the molecule through a carbon or heteroatom. Non-limiting examples of aryl and heteroaryl groups may include phenyl, 1-naphthyl, 2-naphthyl, 4-biphenyl, 1-pyrrolyl, 2-pyrrolyl, 3-pyrrolyl, 3-pyrazolyl, 2-imidazolyl, 4-imidazolyl, pyrazinyl, 2-oxazolyl, 4-oxazolyl, 2-phenyl-4-oxazolyl, 5-oxazolyl, 3-isoxazolyl, 4-isoxazolyl, 5-isoxazolyl, 2-thiazolyl, 4-thiazolyl, 5-thiazolyl, 2-furyl, 3-furyl, 2-thienyl, 3-thienyl, 2-pyridyl, 3-pyridyl, 4-pyridyl, 2-pyrimidyl, 4-pyrimidyl, 5-benzothiazolyl, purinyl, 2-benzimidazolyl, 5-indolyl, 1-isoquinolyl, 5-isoquinolyl, 2-quinoxalinyl, 5-quinoxalinyl, 3-quinolyl, and 6-quinolyl. Substituents for each of the above noted aryl and heteroaryl ring systems are selected from the group of acceptable substituents described herein.

[0275] The term may also include multiple condensed ring systems that have at least one such aromatic ring, which multiple condensed ring systems are further described below. The term may also include multiple condensed ring systems (e.g., ring systems comprising 2, 3 or 4 rings) wherein a heteroaryl group, as defined above, can be condensed with one or more rings selected from heteroaryls (to form for example a naphthyridinyl such as 1,8-naphthyridinyl), heterocycles, (to form for example a 1, 2, 3, 4-tetrahydronaphthyridinyl such as 1, 2, 3, 4-tetrahydro-1,8-naphthyridinyl), carbocycles (to form for example 5,6,7, 8-tetrahydroquinolyl) and aryls (to form for example indazolyl) to form the multiple condensed ring system. The rings of the multiple condensed ring system can be connected to each other via fused, Spiro and bridged bonds when allowed by valency requirements. It is to be understood that the individual rings of the multiple condensed ring system may be connected in any order relative to one another. It is also to be understood that the point of attachment of a multiple condensed ring system (as defined above for a heteroaryl) can be at any position of the multiple condensed ring system including a heteroaryl, heterocycle, aryl or carbocycle portion of the multiple condensed ring system and at any suitable atom of the multiple condensed ring system including a carbon atom and heteroatom (e.g., a nitrogen).

[0276] A “heteroarylene,” alone or as part of another substituent, may mean a divalent radical derived from a heteroaryl.

[0277] Non-limiting examples of aryl and heteroaryl groups may include pyridinyl, pyrimidinyl, thiophenyl, thienyl, furanyl, indolyl, benzoxadiazolyl, benzodioxolyl, benzodioxanyl, thianaphthanyl, pyrrolopyridinyl, indazolyl, quinolinyl, quinoxalinyl, pyridopyrazinyl, quinazolinonyl, benzoisoxazolyl, imidazopyridinyl, benzofuranyl, benzothienyl, benzothiophenyl, phenyl, naphthyl, biphenyl, pyrrolyl, pyrazolyl, imidazolyl, pyrazinyl, oxazolyl, isoxazolyl, thiazolyl, furylthienyl, pyridyl, pyrimidyl, benzothiazolyl, purinyl, benzimidazolyl, isoquinolyl, thiadiazolyl, oxadiazolyl, pyrrolyl, diazolyl, triazolyl, tetrazolyl, benzothiadiazolyl, isothiazolyl, pyrazolopyrimidinyl, pyrrolopyrimidinyl, benzotriazolyl, benzoxazolyl, or quinolyl. The examples above may be substituted or unsubstituted and divalent radicals of each heteroaryl example above are non-limiting examples of heteroarylene. A heteroaryl moiety may include one ring heteroatom (e.g., O, N, or S). A heteroaryl moiety may include two optionally different ring heteroatoms (e.g., O, N, or S). A heteroaryl moiety may include three optionally different ring heteroatoms (e.g., O, N, or S). A heteroaryl moiety may include four optionally different ring heteroatoms (e.g., O, N, or S). A heteroaryl moiety may include five optionally different ring heteroatoms (e.g., O, N, or S). An aryl moiety may have a single ring. An aryl moiety may have two optionally different rings. An aryl moiety may have three optionally different rings. An aryl moiety may have four optionally different rings. A heteroaryl moiety may have one ring. A heteroaryl moiety may have two optionally different rings. A heteroaryl moiety may have three optionally different rings. A heteroaryl moiety may have four optionally different rings. A heteroaryl moiety may have five optionally different rings.

[0278] The terms “halo” or “halogen,” by themselves or as part of another substituent, may mean, unless otherwise stated, a fluorine, chlorine, bromine, or iodine atom. Additionally, terms such as “haloalkyl” may include monohaloalkyl and polyhaloalkyl. For example, the term “halo(C.sub.1-C.sub.4)alkyl” may include, but is not limited to, fluoromethyl, difluoromethyl, trifluoromethyl, 2,2,2-trifluoroethyl, 4-chlorobutyl, 3-bromopropyl, and the like.

[0279] The term “hydroxyl,” as used herein, means —OH.

[0280] The term “hydroxyalkyl” as used herein, may mean an alkyl moiety as defined herein, substituted with one or more, such as one, two or three, hydroxy groups. In certain instances, the same carbon atom does not carry more than one hydroxy group. Representative examples may include, but are not limited to, hydroxymethyl, 2-hydroxyethyl, 2-hydroxypropyl, 3-hydroxypropyl, 1-(hydroxymethyl)-2-methylpropyl, 2-hydroxybutyl, 3-hydroxybutyl, 4-hydroxybutyl, 2,3-dihydroxypropyl, 2-hydroxy-1-hydroxymethylethyl, 2,3-dihydroxybutyl, 3,4-dihydroxybutyl and 2-(hydroxymethyl)-3-hydroxypropyl.

[0281] The term “oxo,” as used herein, means an oxygen that is double bonded to a carbon atom.

[0282] A substituent group, as used herein, may be a group selected from the following moieties:

(A) oxo, halogen, —CF.sub.3, —CN, —OH, —NH.sub.2, —COOH, —CONH.sub.2, —NO.sub.2, —SH, —SO.sub.3H, —SO.sub.4H, —SO.sub.2NH.sub.2, —NHNH.sub.2, —ONH.sub.2, —NHC═(O)NHNH.sub.2, —NHC═(O)NH.sub.2, —NHSO.sub.2H, —NHC═(O)H, —NHC(O)—OH, —NHOH, —OCF.sub.3, —OCHF.sub.2, unsubstituted alkyl, unsubstituted cycloalkyl, unsubstituted heterocycloalkyl, unsubstituted aryl, unsubstituted heteroaryl, and
(B) alkyl, cycloalkyl, heterocyclyl, aryl, heteroaryl, substituted with at least one substituent selected from:

[0283] (i) oxo, halogen, —CF.sub.3, —CN, —OH, —NH.sub.2, —COOH, —CONH.sub.2, —NO.sub.2, —SH, —SO.sub.3H, —SO.sub.4H, —SO.sub.2NH.sub.2, —NHNH.sub.2, —ONH.sub.2, —NHC═(O)NHNH.sub.2, —NHC═(O)NH.sub.2, —NHSO.sub.2H, —NHC═(O)H, —NHC(O)—OH, —NHOH, —OCF.sub.3, —OCHF.sub.2, unsubstituted alkyl, unsubstituted heteroalkyl, unsubstituted cycloalkyl, unsubstituted heterocycloalkyl, unsubstituted aryl, unsubstituted heteroaryl, and

[0284] (ii) alkyl, heteroalkyl, cycloalkyl, heterocycloalkyl, aryl, heteroaryl, substituted with at least one substituent selected from: [0285] (a) oxo, halogen, —CF.sub.3, —CN, —OH, —NH.sub.2, —COOH, —CONH.sub.2, —NO.sub.2, —SH, —SO.sub.3H, —SO.sub.4H, —SO.sub.2NH.sub.2, —NHNH.sub.2, —ONH.sub.2, —NHC═(O)NHNH.sub.2, —NHC═(O)NH.sub.2, —NHSO.sub.2H, —NHC═(O)H, —NHC(O)—OH, —NHOH, —OCF.sub.3, —OCHF.sub.2, unsubstituted alkyl, unsubstituted heteroalkyl, unsubstituted cycloalkyl, unsubstituted heterocycloalkyl, unsubstituted aryl, unsubstituted heteroaryl, and [0286] (b) alkyl, heteroalkyl, cycloalkyl, heterocycloalkyl, aryl, heteroaryl, substituted with at least one substituent selected from: oxo, halogen, —CF.sub.3, —CN, —OH, —NH.sub.2, —COOH, —CONH.sub.2, —NO.sub.2, —SH, —SO.sub.3H, —SO.sub.4H, —SO.sub.2NH.sub.2, —ONH.sub.2, —NHC═(O)NHNH.sub.2, —NHC═(O) NH.sub.2, —NHSO.sub.2H, —NHC═(O)H, —NHC(O)—OH, —NHOH, —OCF.sub.3, —OCHF.sub.2, unsubstituted alkyl, unsubstituted heteroalkyl, unsubstituted cycloalkyl, unsubstituted heterocycloalkyl, unsubstituted aryl, unsubstituted heteroaryl.

[0287] An “effective amount” when used in connection with a compound is an amount effective for treating or preventing a disease in a subject as described herein.

[0288] The term “carrier”, as used in this disclosure, encompasses carriers, excipients, and diluents and may mean a material, composition or vehicle, such as a liquid or solid filler, diluent, excipient, solvent or encapsulating material, involved in carrying or transporting a pharmaceutical agent from one organ, or portion of the body, to another organ, or portion of the body of a subject.

[0289] The term “treating” with regard to a subject, may refer to improving at least one symptom of the subject's disorder. Treating may include curing, improving, or at least partially ameliorating the disorder.

[0290] The term “prevent” or “preventing” with regard to a subject may refer to keeping a disease or disorder from afflicting the subject. Preventing may include prophylactic treatment. For instance, preventing can include administering to the subject a compound disclosed herein before a subject is afflicted with a disease and the administration will keep the subject from being afflicted with the disease.

[0291] The term “disorder” is used in this disclosure and may mean, and is used interchangeably with, the terms disease, condition, or illness, unless otherwise indicated.

[0292] The term “administer”, “administering”, or “administration” as used in this disclosure may refer to either directly administering a disclosed compound or pharmaceutically acceptable salt or tautomer of the disclosed compound or a composition to a subject, or administering a prodrug derivative or analog of the compound or pharmaceutically acceptable salt or tautomer of the compound or composition to the subject, which can form an equivalent amount of active compound within the subject's body.

[0293] A “patient” or “subject” is a mammal, e.g., a human, mouse, rat, guinea pig, dog, cat, horse, cow, pig, or non-human primate, such as a monkey, chimpanzee, baboon or rhesus.

Compounds

[0294] The present disclosure provides compounds having the structure of Formula (I),

##STR00057##

and pharmaceutically acceptable salts and tautomers thereof, wherein R.sup.16, R.sup.26, R.sup.28, R.sup.32, and R.sup.40 are described as above.

[0295] In some embodiments, the compounds of Formula I are compounds of Formulae Ia, Ib, Ic, Id, Ie, or If, or pharmaceutically acceptable salts or tautomers thereof.

[0296] The present disclosure provides compounds having the structure of Formula (Ia),

##STR00058##

and pharmaceutically acceptable salts and tautomers thereof, wherein R.sup.16, R.sup.26, R.sup.28, R.sup.32, and R.sup.40 are described as above.

[0297] The present disclosure provides compounds having the structure of Formula (Ib),

##STR00059##

and pharmaceutically acceptable salts and tautomers thereof, wherein R.sup.16, R.sup.26, R.sup.28, R.sup.32, and R.sup.40 are described as above.

[0298] The present disclosure provides compounds having the structure of Formula (Ic),

##STR00060##

and pharmaceutically acceptable salts and tautomers thereof, wherein R.sup.16, R.sup.26, R.sup.28, R.sup.32, and R.sup.40 are described as above.

[0299] The present disclosure provides compounds having the structure of Formula (Id),

##STR00061##

and pharmaceutically acceptable salts and tautomers thereof, wherein R.sup.16, R.sup.26, R.sup.28, R.sup.32, and R.sup.40 are described as above.

[0300] The present disclosure provides compounds having the structure of Formula (Ie),

##STR00062##

and pharmaceutically acceptable salts and tautomers thereof, wherein R.sup.16, R.sup.26, R.sup.28, R.sup.32, and R.sup.40 are described as above.

[0301] The present disclosure provides compounds having the structure of Formula (If),

##STR00063##

[0302] and pharmaceutically acceptable salts and tautomers thereof, wherein:

[0303] R.sup.16 is selected from H, (C.sub.1-C.sub.6)alkyl, —OR.sup.3, —SR.sup.3, ═O, —NR.sup.3C(O)OR.sup.3, —NR.sup.3C(O)N(R.sup.3).sub.2, —NR.sup.3S(O).sub.2OR.sup.3, —NR.sup.3S(O).sub.2N(R.sup.3).sub.2, —NR.sup.3S(O).sub.2R.sup.3, (C.sub.6-C.sub.10)aryl, and 5-7 membered heteroaryl, and

##STR00064##

wherein the aryl and heteroaryl is optionally substituted with one or more substituents each independently selected from alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, and hydroxyl;

[0304] R.sup.26 is selected from ═O, —OR.sup.3, and ═N—OR.sup.3;

[0305] R.sup.28 is selected from —OR.sup.3, —OC(O)O(C(R.sup.3).sub.2).sub.n, —OC(O)N(R.sup.3).sub.2, and —OS(O).sub.2N(R.sub.3).sub.2, and —N(R.sub.3)S(O).sub.2OR.sub.3;

[0306] R.sup.32 is selected from H, ═O, —OR.sup.3, and ═N—OR.sup.3; and

[0307] R.sup.40 is selected from —OR.sup.3, —SR.sup.3, —N.sub.3, —N(R.sup.3).sub.2, —NR.sup.3C(O)OR.sup.3, —NR.sup.3C(O)N(R.sup.3).sub.2, —NR.sup.3S(O).sub.2OR.sup.3, —NR.sup.3S(O).sub.2N(R.sup.3).sub.2, —NR.sup.3S(O).sub.2R.sup.3, —OP(O)(OR.sup.3).sub.2, —OP(O)(R.sup.3).sub.2, —NR.sup.3C(O)R.sup.3, —S(O)R.sup.3, —S(O).sub.2R.sup.3, —OS(O).sub.2NHC(O)R.sup.3,

##STR00065##

[0308] provided that compound does not comprise the combination of R.sup.16 is —OCH.sub.3; R.sup.26 is ═O; R.sup.28 is —OH; R.sup.32 is ═O; and R.sup.40 is —OH.

[0309] The present disclosure provides compounds having the structure of Formula I-X:

##STR00066##

[0310] and pharmaceutically acceptable salts and tautomers thereof, wherein R.sup.16, R.sup.26, R.sup.28, R.sup.32, and R.sup.40 are described as above.

[0311] In some embodiments, the compounds of Formula I-X are represented by the structure of Formula I-Xa:

##STR00067##

[0312] and pharmaceutically acceptable salts and tautomers thereof, wherein R.sup.16, R.sup.26, R.sup.28, R.sup.32, and R.sup.40 are described as above.

[0313] In some embodiments, the compounds of Formulae I, I-X, and I-Xa are represented by the structure of Formula (Ia-X):

##STR00068##

and pharmaceutically acceptable salts and tautomers thereof, wherein R.sup.16 is R.sup.1 or R.sup.2.

[0314] In some embodiments, the compounds of Formulae I, I-X, and I-Xa are represented by the structure of Formula (Ib-X):

##STR00069##

and pharmaceutically acceptable salts and tautomers thereof, wherein R.sup.26 is ═N—R.sup.1 or ═N—R.sup.2.

[0315] In some embodiments, the compounds of Formulae I, I-X, and I-Xa are represented by the structure of Formula (Ic-X):

##STR00070##

or a pharmaceutically acceptable salt or tautomer thereof, wherein R.sup.28 is R.sup.1 or R.sup.2.

[0316] In some embodiments, the compounds of Formulae I, I-X, and I-Xa are represented by the structure of Formula (Id-X):

##STR00071##

or a pharmaceutically acceptable salt or tautomer thereof, wherein R.sup.32 is ═N—R.sup.1 or R.sup.2.

[0317] In some embodiments, the compounds of Formulae I, I-X, and I-Xa are represented by the structure of Formula (Ie-X):

##STR00072##

or a pharmaceutically acceptable salt or tautomer thereof, wherein R.sup.40 is R.sup.1 or R.sup.2.

[0318] In certain embodiments, the present disclosure provides compounds of Formulae Ia, Ib, Ic, Id, Ie, or If, or Formula I-X (including compounds of Formula I-Xa), where the stereochemistry is not determined, as shown below.

##STR00073##

and pharmaceutically acceptable salts and tautomers thereof, wherein R.sup.16, R.sup.26, R.sup.28, R.sup.32, and R.sup.40.

[0319] In certain embodiments, R.sup.16 is R.sup.1. In certain embodiments, R.sup.16 is R.sup.2. In certain embodiments, R.sup.10 is H, (C.sub.1-C.sub.6)alkyl, —OR.sup.3, —SR.sup.3, ═O, —NR.sup.3C(O)OR.sup.3, —NR.sup.3C(O)N(R.sup.3).sub.2, —NR.sup.3S(O).sub.2OR.sup.3, —NR.sup.3S(O).sub.2N(R.sup.3).sub.2, —NR.sup.3S(O).sub.2R.sup.3, (C.sub.6-C.sub.10)aryl, and 5-7 membered heteroaryl, or

##STR00074##

wherein the aryl and heteroaryl is optionally substituted with one or more substituents each independently selected from alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, and hydroxyl.

[0320] In certain embodiments, R.sup.26 is ═N—R.sup.1. In certain embodiments, R.sup.26 is ═N—R.sup.2. In certain embodiments, R.sup.26 is ═O, —OR.sup.3, or ═N—OR.sup.3.

[0321] In certain embodiments, R.sup.28 is R.sup.1. In certain embodiments, R.sup.28 is R.sup.2. In certain embodiments, R.sup.28 is —OR.sup.3, —OC(O)O(C(R.sup.3).sub.2).sub.n, —OC(O)N(R.sup.3).sub.2, and —OS(O).sub.2N(R.sub.3).sub.2, or —N(R.sub.3)S(O).sub.2OR.sub.3.

[0322] In certain embodiments, R.sup.32 is ═N—R.sup.1. In certain embodiments, R.sup.32 is ═N—R.sup.2. In certain embodiments, R.sup.32 is H, ═O, —OR.sup.3, or ═N—OR.sup.3. In certain embodiments, R.sup.32 is, ═N—NHR.sup.3, and N(R.sup.3).sub.2.

[0323] In certain embodiments, R.sup.40 is R.sup.1. In certain embodiments, R.sup.40 is R.sup.2. In certain embodiments, R.sup.40 is —OR.sup.3, —SR.sup.3, —N.sub.3, —N(R.sup.3).sub.2, —NR.sup.3C(O)OR.sup.3, —NR.sup.3C(O)N(R.sup.3).sub.2, —NR.sup.3S(O).sub.2OR.sup.3, —NR.sup.3S(O).sub.2N(R.sup.3).sub.2, —NR.sup.3S(O).sub.2R.sup.3, —OP(O)(OR.sup.3).sub.2, —OP(O)(R.sup.3).sub.2, —NR.sup.3C(O)R.sup.3, —S(O)R.sup.3, —S(O).sub.2R.sup.3,

—OS(O).sub.2NHC(O)R.sup.3,

##STR00075##

[0324] In certain embodiments, the compound comprises R.sup.1. In certain embodiments, the compound comprises R.sup.2.

[0325] In certain embodiments, R.sup.2 is -A-C≡CH. In certain embodiments, R.sup.2 is -A-N.sub.3. In certain embodiments, R.sup.2 is -A-COOH. In certain embodiments, R.sup.2 is -A-NHR.sup.3.

[0326] In certain embodiments, A is absent. In certain embodiments, A is —(C(R.sup.3).sub.2).sub.n—, —O(C(R.sup.3).sub.2).sub.n—, —NR.sup.3(C(R.sup.3).sub.2).sub.n—, —O(C(R.sup.3).sub.2).sub.n—[O(C(R.sup.3).sub.2).sub.n].sub.o—O(C(R.sup.3).sub.2).sub.p—, —C(O)(C(R.sup.3).sub.2).sub.n—, —C(O)NR.sup.3—, —NR.sup.3C(O)(C(R.sup.3).sub.2).sub.n—, —NR.sup.3C(O)O(C(R.sup.3).sub.2).sub.n—, —OC(O)NR.sup.3(C(R.sup.3).sub.2).sub.n—, —NHSO.sub.2NH(C(R.sup.3).sub.2).sub.n—, or —OC(O)NHSO.sub.2NH(C(R.sup.3).sub.2).sub.n—. In certain embodiments, A is —O(C(R.sup.3).sub.2).sub.n—. In certain embodiments, A is —O(C(R.sup.3).sub.2).sub.n—[O(C(R.sup.3).sub.2).sub.n].sub.o—O(C(R.sup.3).sub.2).sub.p—.

[0327] In certain embodiments, A is —O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-, —O(C(R.sup.3).sub.2).sub.n— heteroarylene-, or —OC(O)NH(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-. In certain embodiments, A is —O—(C.sub.6-C.sub.10)arylene- or —O-heteroarylene-.

[0328] In certain embodiments, A is -heteroarylene-(C.sub.6-C.sub.10)arylene-, —O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-(C.sub.6-C.sub.10)arylene-, —O(C(R.sup.3).sub.2).sub.n-heteroarylene-heteroarylene-, —O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-(C(R.sup.3).sub.2).sub.n—, —O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-O(C(R.sup.3).sub.2).sub.n—, —O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-NR.sup.3(C(R.sup.3).sub.2).sub.n—, or —O(C(R.sup.3).sub.2).sub.n-heteroarylene-heterocyclylene-C(O)(C(R.sup.3).sub.2).sub.n—.

[0329] In certain embodiments, A is -heteroarylene-(C.sub.6-C.sub.10)arylene-(C.sub.6-C.sub.10)arylene-, -heteroarylene-(C.sub.6-C.sub.10)arylene-heteroarylene-O(C(R.sup.3).sub.2).sub.n—, -heteroarylene-(C.sub.6-C.sub.10)arylene-heteroarylene-(C(R.sup.3).sub.2).sub.n2—O(C(R.sup.3).sub.2).sub.n—, —O(C(R.sup.3).sub.2).sub.n-heteroarylene-heteroarylene-NR.sup.3—(C.sub.6-C.sub.10)arylene-, —O(C(R.sup.3).sub.2).sub.n-heteroarylene-heteroarylene-heterocyclylene-(C(R.sup.3).sub.2).sub.n—, —O(C(R.sup.3).sub.2).sub.n-heteroarylene-heteroarylene-heterocyclylene-C(O)(C(R.sup.3).sub.2).sub.n—, —O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-(C(R.sup.3).sub.2).sub.n—, —O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-C(O)(C(R.sup.3).sub.2).sub.n—, or —O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-SO.sub.2(C(R.sup.3).sub.2).sub.n—. In certain embodiments, A is —O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-(C(R.sup.3).sub.2).sub.n—, —O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-C(O)(C(R.sup.3).sub.2).sub.n—, or —O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-SO.sub.2(C(R.sup.3).sub.2).sub.n—. In certain embodiments, A is —O(C(R.sup.3).sub.2).sub.n-heteroarylene-heteroarylene-NR.sup.3—(C.sub.6-C.sub.10)arylene-, —O(C(R.sup.3).sub.2).sub.n-heteroarylene-heteroarylene-heterocyclylene-(C(R.sup.3).sub.2).sub.n—, or —O(C(R.sup.3).sub.2).sub.n-heteroarylene-heteroarylene-heterocyclylene-C(O)(C(R.sup.3).sub.2).sub.n—. In certain embodiments, A is -heteroarylene-(C.sub.6-C.sub.10)arylene-(C.sub.6-C.sub.10)arylene-, -heteroarylene-(C.sub.6-C.sub.10)arylene-heteroarylene-O(C(R.sup.3).sub.2).sub.n—, or -heteroarylene-(C.sub.6-C.sub.10)arylene-heteroarylene-(C(R.sup.3).sub.2).sub.n2—O(C(R.sup.3).sub.2).sub.n—.

[0330] In certain embodiments, A is -heteroarylene-(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-(C(R.sup.3).sub.2).sub.n—, -heteroarylene-(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-C(O)(C(R.sup.3).sub.2).sub.n—, -heteroarylene-(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-SO.sub.2(C(R.sup.3).sub.2).sub.n—, or —O(C(R.sup.3).sub.2).sub.n-heteroarylene-heteroarylene-heterocyclylene-S(O).sub.2NR.sup.3—(C.sub.6-C.sub.10)arylene-.

[0331] In certain embodiments, in A, the heteroarylene is 5-12 membered and contains 1-4 heteroatoms selected from O, N, and S. In certain embodiments, in A, heterocyclylene is 5-12 membered and contains 1-4 heteroatoms selected from O, N, and S. In certain embodiments, the heteroarylene is 5-6-membered comprising 1-4 heteroatoms that is N. In certain embodiments, the heterocyclylene is 5-6-membered comprising 1-4 heteroatoms that is N.

[0332] In certain embodiments, in A, the arylene, heteroarylene, and heterocyclylene are optionally substituted with one or more substituents each independently selected from alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, and hydroxyl. In certain embodiments, the arylene, heteroarylene, and heterocyclylene are substituted with alkyl, hydroxyalkyl, or haloalkyl. In certain embodiments, the arylene, heteroarylene, and heterocyclylene are substituted with alkoxy. In certain embodiments, the arylene, heteroarylene, and heterocyclylene are substituted with halogen or hydroxyl. In certain embodiments, the arylene, heteroarylene, and heterocyclylene are substituted with, —C(O)OR.sup.3, —C(O)N(R.sup.3).sub.2, —N(R.sup.3).sub.2, and alkyl substituted with —N(R.sup.3).sub.2.

[0333] In certain embodiments, L.sup.1 is

##STR00076##

[0334] In certain embodiments, L.sup.1 is

##STR00077##

[0335] In certain embodiments, L.sup.1 is

##STR00078##

In certain embodiments, L.sup.1 is

##STR00079##

[0336] In certain embodiments, L.sup.1 is

##STR00080##

In certain embodiments, L.sup.1 is

##STR00081##

In certain embodiments, L.sup.1 is

##STR00082##

and q is zero.

[0337] In certain embodiments, L.sup.1 is

##STR00083##

[0338] In certain embodiments, L.sup.1 is

##STR00084##

[0339] In certain embodiments, L.sup.1 is

##STR00085## ##STR00086##

[0340] In certain embodiments, L.sup.1 is

##STR00087##

[0341] In certain embodiments, L.sup.1 is

##STR00088##

[0342] In certain embodiments, L.sup.1 is

##STR00089##

[0343] In certain embodiments, L.sup.1 is

##STR00090## ##STR00091## ##STR00092## ##STR00093##

[0344] In certain embodiments, L.sup.1 is

##STR00094##

[0345] In certain embodiments, L.sup.1 is

##STR00095##

[0346] In certain embodiments, L.sup.1 is

##STR00096##

[0347] In certain embodiments, L.sup.1 is

##STR00097##

[0348] In certain embodiments, L.sup.1 is

##STR00098##

[0349] In certain embodiments, L.sup.1 is

##STR00099##

[0350] In certain embodiments, L.sup.1 is

##STR00100##

[0351] In certain embodiments, L.sup.1 is

##STR00101##

[0352] In certain embodiments, L.sup.1 is

##STR00102##

[0353] In certain embodiments, L.sup.1 is

##STR00103##

In certain embodiments, L.sup.1 is

##STR00104##

In certain embodiments, L.sup.1 is

##STR00105##

[0354] In certain embodiments, A ring is phenylene. In certain embodiments, A ring is 1, 3-phenylene. In certain embodiments, A ring is 1, 4-phenylene. In certain embodiments, A ring is 5-8 membered heteroarylene, such as 5-membered heteroarylene, 6-membered heteroarylene, 7-membered heteroarylene, or 8-membered heteroarylene.

[0355] In certain embodiments, B is

##STR00106##

[0356] In certain embodiments, B is

##STR00107##

[0357] In certain embodiments, B is

##STR00108##

In certain embodiments, B is

##STR00109##

[0358] In certain embodiments, B.sup.1 is

##STR00110##

[0359] In certain embodiments, B.sup.1 is

##STR00111##

In certain embodiments, B.sup.1 is

##STR00112##

wherein arylene are optionally substituted with haloalkyl.

[0360] In certain embodiments, B.sup.1 is

##STR00113##

[0361] In certain embodiments, B.sup.1 is

##STR00114##

[0362] In certain embodiments, B.sup.1 is

##STR00115##

In certain embodiments, B.sup.1 is

##STR00116##

In certain embodiments, B.sup.1 is

##STR00117##

[0363] In certain embodiments, in B.sup.1, the heteroaryl, heterocyclyl, and arylene are optionally substituted with alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, or hydroxyl.

[0364] In certain embodiments, R.sup.3 is H. In certain embodiments, R.sup.3 is (C.sub.1-C.sub.6)alkyl. In certain embodiments, R.sup.3 is (C.sub.1-C.sub.6)alkyl optionally substituted with —COOH or (C.sub.6-C.sub.10)aryl. In certain embodiments, R.sup.3 is (C.sub.1-C.sub.6)alkyl substituted with —COOH. In certain embodiments, R.sup.3 is (C.sub.1-C.sub.6)alkyl substituted with (C.sub.6-C.sub.10)aryl. In certain embodiments, R.sup.3 is (C.sub.1-C.sub.6)alkyl substituted with OH.

[0365] In certain embodiments, R.sup.3 is —C(O)(C.sub.1-C.sub.6)alkyl. In certain embodiments, R.sup.3 is —C(O)NH-aryl. In certain embodiments, R.sup.3 is —C(S)NH-aryl.

[0366] In certain embodiments, R.sup.4 is H. In certain embodiments, R.sup.4 is (C.sub.1-C.sub.6)alkyl. In certain embodiments, R.sup.4 is halogen. In certain embodiments, R.sup.4 is 5-12 membered heteroaryl, 5-12 membered heterocyclyl, or (C.sub.6-C.sub.10)aryl, wherein the heteroaryl, heterocyclyl, and aryl are optionally substituted with —N(R.sup.3).sub.2, —OR.sup.3, halogen, (C.sub.1-C.sub.6)alkyl, —(C.sub.1-C.sub.6)alkylene-heteroaryl, —(C.sub.1-C.sub.6)alkylene-CN, or —C(O)NR.sup.3-heteroaryl. In certain embodiments, R.sup.4 is —C(O)NR.sup.3-heterocyclyl. In certain embodiments, R.sup.4 is 5-12 membered heteroaryl, optionally substituted with —N(R.sup.3).sub.2 or —OR.sup.3.

[0367] In certain embodiments, Q is C(R.sup.3).sub.2. In certain embodiments, Q is O.

[0368] In certain embodiments, Y is C(R.sup.3).sub.2. In certain embodiments, Y is a bond.

[0369] In certain embodiments, Z is H. In certain embodiments, Z is absent.

[0370] In certain embodiments, n is 1, 2, 3, 4, 5, 6, 7, or 8. In certain embodiments, n is 1, 2, 3, or 4. In certain embodiments, n is 5, 6, 7, or 8. In certain embodiments, n is 9, 10, 11, or 12.

[0371] In certain embodiments, o is 0, 1, 2, 3, 4, 5, 6, 7, or 8. In certain embodiments, o is 0, 1, 2, 3, or 4. In certain embodiments, o is 5, 6, 7, or 8. In certain embodiments, o is 9, 10, 11, or 12. In certain embodiments, o is one to 2.

[0372] In certain embodiments, p is 0, 1, 2, 3, 4, 5, or 6. In certain embodiments, p is 7, 8, 9, 10, 11, or 12. In certain embodiments, p is 0, 1, 2, or 3. In certain embodiments, p is 4, 5, or 6.

[0373] In certain embodiments, q is a number from zero to 10. In certain embodiments, q is 0, 1, 2, 3, 4, or 5. In certain embodiments, q is 6, 7, 8, 9, or 10. In certain embodiments, q is one to 7. In certain embodiments, q is one to 8. In certain embodiments, q is one to 9. In certain embodiments, q is 3 to 8.

[0374] In certain embodiments, q is a number from zero to 30. In certain embodiments, q is a number from zero to 26, 27, 28, 29, or 30. In certain embodiments, q is a number from zero to 21, 22, 23, 24, or 25. In certain embodiments, q is a number from zero to 16, 17, 18, 19, or 20. In certain embodiments, q is a number from zero to 11, 12,13, 14 or 15.

[0375] In certain embodiments, r is 1, 2, 3, or 4. In certain embodiments, r is 1. In certain embodiments, r is 2. In certain embodiments, r is 3. In certain embodiments, r is 4.

[0376] The present disclosure provides a compound of formula (I),

##STR00118##

having one, two, three, or four of the following features:

[0377] a) A is —O(C(R.sup.3).sub.2).sub.n— or —O(C(R.sup.3).sub.2).sub.n—[O(C(R.sup.3).sub.2).sub.n].sub.o—O(C(R.sup.3).sub.2).sub.p—;

[0378] b) L.sup.1 is

##STR00119##

[0379] c) B is

##STR00120##

and

[0380] d) B.sup.1 is

##STR00121##

wherein the arylene are optionally substituted with alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, or hydroxyl.

[0381] The present disclosure provides a compound of formula (I),

##STR00122##

having one, two, three, or four of the following features:

[0382] a) A is —O(C(R.sup.3).sub.2).sub.n— or —O(C(R.sup.3).sub.2).sub.n—[O(C(R.sup.3).sub.2).sub.n].sub.o—O(C(R.sup.3).sub.2).sub.p—;

[0383] b) L.sup.1 is

##STR00123##

[0384] c) B is

##STR00124##

and

[0385] d) B.sup.1 is

##STR00125##

wherein the arylene are optionally substituted with alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, or hydroxyl.

[0386] The present disclosure provides a compound of formula (I),

##STR00126##

having one, two, three, or four of the following features:

[0387] a) A is —O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-(C(R.sup.3).sub.2).sub.n—;

[0388] b) L.sup.1 is

##STR00127##

[0389] c) B is

##STR00128##

and

[0390] d) B.sup.1 is

##STR00129##

wherein the arylene are optionally substituted with alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, or hydroxyl.

[0391] The present disclosure provides a compound of formula (I),

##STR00130##

having one, two, three, or four of the following features:

[0392] a) A is —O(C(R.sup.3).sub.2).sub.n—;

[0393] b) L.sup.1 is

##STR00131##

[0394] c) q is zero;

[0395] d) B is

##STR00132##

[0396] e) B.sup.1 is

##STR00133##

[0397] f) R.sup.4 is heteroaryl optionally substituted with —NH.sub.2; and

[0398] g) R.sup.26 is ═N—R.sup.1.

[0399] In certain embodiments, the present disclosure provide for the following compounds, and pharmaceutically acceptable salts and tautomers thereof,

TABLE-US-00001 Structure [00134]embedded image Example 1 [00135]embedded image Example 2 [00136]embedded image Example 3 [00137]embedded image Example 4 [00138]embedded image Example 5 [00139]embedded image Example 6 [00140]embedded image Example 7 [00141]embedded image Example 8 [00142]embedded image Example 9 [00143]embedded image Example 10 [00144]embedded image Example 11 [00145]embedded image Example 12 [00146]embedded image Example 13 [00147]embedded image Example 14 [00148]embedded image Example 15 [00149]embedded image Example 16 [00150]embedded image Example 17 [00151]embedded image Example 18 [00152]embedded image Example 19 [00153]embedded image Example 20 [00154]embedded image Example 21 [00155]embedded image Example 22 [00156]embedded image Example 23 [00157]embedded image Example 24 [00158]embedded image Example 25 [00159]embedded image Example 26 [00160]embedded image Example 27 [00161]embedded image Example 28 [00162]embedded image Example 29 [00163]embedded image Example 30 [00164]embedded image Example 31 [00165]embedded image Example 32 [00166]embedded image Example 33 [00167]embedded image Example 34 [00168]embedded image Example 35 [00169]embedded image Example 36 [00170]embedded image Example 37 [00171]embedded image Example 38 [00172]embedded image Example 39 [00173]embedded image Example 40 [00174]embedded image Example 41 [00175]embedded image Example 42 [00176]embedded image Example 43 [00177]embedded image Example 44 [00178]embedded image Example 45 [00179]embedded image Example 46 [00180]embedded image Example 47 [00181]embedded image Example 48 [00182]embedded image Example 49 [00183]embedded image Example 50 [00184]embedded image Example 51 [00185]embedded image Example 52 [00186]embedded image Example 53 [00187]embedded image Example 54 [00188]embedded image Example 55 [00189]embedded image Example 56 [00190]embedded image Example 57 [00191]embedded image Example 58 [00192]embedded image Example 59 [00193]embedded image Example 60 [00194]embedded image Example 61 [00195]embedded image Example 62 [00196]embedded image Example 63 [00197]embedded image Example 64 [00198]embedded image Example 65 [00199]embedded image Example 66 [00200]embedded image Example 67 [00201]embedded image Example 68 [00202]embedded image Example 69 [00203]embedded image Example 70 [00204]embedded image Example 71 [00205]embedded image Example 72 [00206]embedded image Example 73 [00207]embedded image Example 74 [00208]embedded image Example 75 [00209]embedded image Example 76 [00210]embedded image Example 77 [00211]embedded image Example 78 [00212]embedded image Example 79 [00213]embedded image Example 80 [00214]embedded image Example 81 [00215]embedded image Example 82 [00216]embedded image Example 83 [00217]embedded image Example 84 [00218]embedded image Example 85 [00219]embedded image Example 86 [00220]embedded image Example 87 [00221]embedded image Example 88 [00222]embedded image Example 89 [00223]embedded image Example 90 [00224]embedded image Example 91 [00225]embedded image Example 92 [00226]embedded image Example 93 [00227]embedded image Example 94 [00228]embedded image Example 95 [00229]embedded image Example 96 [00230]embedded image Example 97 [00231]embedded image Example 98 [00232]embedded image Example 99 [00233]embedded image Example 100 [00234]embedded image Example 101 [00235]embedded image Example 102 [00236]embedded image Example 103 [00237]embedded image Example 104 [00238]embedded image Example 105 [00239]embedded image Example 106 [00240]embedded image Example 107 [00241]embedded image Example 108 [00242]embedded image Example 109 [00243]embedded image Example 110 [00244]embedded image Example 111 [00245]embedded image Example 112 [00246]embedded image Example 113 [00247]embedded image Example 114 [00248]embedded image Example 115 [00249]embedded image Example 116 [00250]embedded image Example 117 [00251]embedded image Example 118 [00252]embedded image Example 119 [00253]embedded image Example 120 [00254]embedded image Example 121 [00255]embedded image Example 122 [00256]embedded image Example 123 [00257]embedded image Example 124 [00258]embedded image Example 125 [00259]embedded image Example 126 [00260]embedded image Example 127 [00261]embedded image Example 128 [00262]embedded image Example 129 [00263]embedded image Example 130 [00264]embedded image Example 131 [00265]embedded image Example 132 [00266]embedded image Example 133 [00267]embedded image Example 134 [00268]embedded image Example 135 [00269]embedded image Example 136 [00270]embedded image Example 137 [00271]embedded image Example 138 [00272]embedded image Example 139 [00273]embedded image Example 140 [00274]embedded image Example 141 [00275]embedded image Example 142 [00276]embedded image Example 143 [00277]embedded image Example 144 [00278]embedded image Example 145 [00279]embedded image Example 146 [00280]embedded image Example 147 [00281]embedded image Example 148 [00282]embedded image Example 149 [00283]embedded image Example 150 [00284]embedded image Example 151 [00285]embedded image Example 152 [00286]embedded image Example 153 [00287]embedded image Example 154 [00288]embedded image Example 155 [00289]embedded image Example 156 [00290]embedded image Example 157 [00291]embedded image Example 158 [00292]embedded image Example 159 [00293]embedded image Example 160 [00294]embedded image Example 161 [00295]embedded image Example 162 [00296]embedded image Example 163 [00297]embedded image Example 164 [00298]embedded image Example 165 [00299]embedded image Example 166 [00300]embedded image Example 167 [00301]embedded image Example 168 [00302]embedded image Example 169 [00303]embedded image Example 170 [00304]embedded image Example 171 [00305]embedded image Example 172 [00306]embedded image Example 173 [00307]embedded image Example 174 [00308]embedded image Example 175 [00309]embedded image Example 176 [00310]embedded image Example 177 [00311]embedded image Example 178 [00312]embedded image Example 179 [00313]embedded image Example 180 [00314]embedded image Example 181 [00315]embedded image Example 182 [00316]embedded image Example 183 [00317]embedded image Example 184 [00318]embedded image Example 185 [00319]embedded image Example 186 [00320]embedded image Example 187 [00321]embedded image Example 188 [00322]embedded image Example 189 [00323]embedded image Example 190 [00324]embedded image Example 191 [00325]embedded image Example 192 [00326]embedded image Example 193 [00327]embedded image Example 194 [00328]embedded image Example 195 [00329]embedded image Example 196 [00330]embedded image Example 197 [00331]embedded image Example 198 [00332]embedded image Example 199 [00333]embedded image Example 200 [00334]embedded image Example 201 [00335]embedded image Example 202

[0400] The compounds of the disclosure may include pharmaceutically acceptable salts of the compounds disclosed herein. Representative “pharmaceutically acceptable salts” may include, e.g., water-soluble and water-insoluble salts, such as the acetate, amsonate (4,4-diaminostilbene-2,2-disulfonate), benzenesulfonate, benzonate, bicarbonate, bisulfate, bitartrate, borate, bromide, butyrate, calcium, calcium edetate, camsylate, carbonate, chloride, citrate, clavulariate, di hydrochloride, edetate, edisylate, estolate, esylate, fiunarate, gluceptate, gluconate, glutamate, glycollylarsanilate, hexafluorophosphate, hexylresorcinate, hydrabamine, hydrobromide, hydrochloride, hydroxynaphthoate, iodide, sethionate, lactate, lactobionate, laurate, magnesium, malate, maleate, mandelate, mesylate, methylbromide, methylnitrate, methylsulfate, mucate, napsylate, nitrate, N-methylglucamine ammonium salt, 3-hydroxy-2-naphthoate, oleate, oxalate, palmitate, pamoate, 1,1-methene-bis-2-hydroxy-3-naphthoate, einbonate, pantothenate, phosphate/diphosphate, picrate, polygalacturonate, propionate, p-toluenesulfonate, salicylate, stearate, subacetate, succinate, sulfate, sulfosalicylate, suramate, tannate, tartrate, teoclate, tosylate, triethiodide, and valerate salts.

[0401] “Pharmaceutically acceptable salt” may also include both acid and base addition salts. “Pharmaceutically acceptable acid addition salt” may refer to those salts which retain the biological effectiveness and properties of the free bases, which are not biologically or otherwise undesirable, and which may be formed with inorganic acids such as, but are not limited to, hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, phosphoric acid and the like, and organic acids such as, but not limited to, acetic acid, 2,2-dichloroacetic acid, adipic acid, alginic acid, ascorbic acid, aspartic acid, benzenesulfonic acid, benzoic acid, 4-acetamidobenzoic acid, camphoric acid, camphor-10-sulfonic acid, capric acid, caproic acid, caprylic acid, carbonic acid, cinnamic acid, citric acid, cyclamic acid, dodecylsulfuric acid, ethane-1,2-disulfonic acid, ethanesulfonic acid, 2-hydroxyethanesulfonic acid, formic acid, fumaric acid, galactaric acid, gentisic acid, glucoheptonic acid, gluconic acid, glucuronic acid, glutamic acid, glutaric acid, 2-oxo-glutaric acid, glycerophosphoric acid, glycolic acid, hippuric acid, isobutyric acid, lactic acid, lactobionic acid, lauric acid, maleic acid, malic acid, malonic acid, mandelic acid, methanesulfonic acid, mucic acid, naphthalene-1,5-disulfonic acid, naphthalene-2-sulfonic acid, 1-hydroxy-2-naphthoic acid, nicotinic acid, oleic acid, orotic acid, oxalic acid, palmitic acid, pamoic acid, propionic acid, pyroglutamic acid, pyruvic acid, salicylic acid, 4-aminosalicylic acid, sebacic acid, stearic acid, succinic acid, tartaric acid, thiocyanic acid, p-toluenesulfonic acid, trifluoroacetic acid, undecylenic acid, and the like.

[0402] “Pharmaceutically acceptable base addition salt” may refer to those salts that retain the biological effectiveness and properties of the free acids, which are not biologically or otherwise undesirable. These salts may be prepared from addition of an inorganic base or an organic base to the free acid. Salts derived from inorganic bases may include, but are not limited to, the sodium, potassium, lithium, ammonium, calcium, magnesium, iron, zinc, copper, manganese, aluminum salts and the like. For example, inorganic salts may include, but are not limited to, ammonium, sodium, potassium, calcium, and magnesium salts. Salts derived from organic bases may include, but are not limited to, salts of primary, secondary, and tertiary amines, substituted amines including naturally occurring substituted amines, cyclic amines and basic ion exchange resins, such as ammonia, isopropylamine, trimethylamine, diethylamine, triethylamine, tripropylamine, diethanolamine, ethanolamine, deanol, 2-dimethylaminoethanol, 2-diethylaminoethanol, dicyclohexylamine, lysine, arginine, histidine, caffeine, procaine, hydrabamine, choline, betaine, benethamine, benzathine, ethylenediamine, glucosamine, methylglucamine, theobromine, triethanolamine, tromethamine, purines, piperazine, piperidine, N-ethylpiperidine, polyamine resins and the like.

[0403] Unless otherwise stated, structures depicted herein may also include compounds which differ only in the presence of one or more isotopically enriched atoms. For example, compounds having the present structure except for the replacement of a hydrogen atom by deuterium or tritium, or the replacement of a carbon atom by .sup.13C or .sup.14C, or the replacement of a nitrogen atom by .sup.15N, or the replacement of an oxygen atom with .sup.17O or .sup.18O are within the scope of the disclosure. Such isotopically labeled compounds are useful as research or diagnostic tools.

Methods of Synthesizing Disclosed Compounds

[0404] The compounds of the present disclosure may be made by a variety of methods, including standard chemistry. Suitable synthetic routes are depicted in the schemes given below.

[0405] The compounds of any of the formulae described herein may be prepared by methods known in the art of organic synthesis as set forth in part by the following synthetic schemes and examples. In the schemes described below, it is well understood that protecting groups for sensitive or reactive groups are employed where necessary in accordance with general principles or chemistry. Protecting groups are manipulated according to standard methods of organic synthesis (T. W. Greene and P. G. M. Wuts, “Protective Groups in Organic Synthesis”, Third edition, Wiley, New York 1999). These groups are removed at a convenient stage of the compound synthesis using methods that are readily apparent to those skilled in the art. The selection processes, as well as the reaction conditions and order of their execution, shall be consistent with the preparation of compounds of Formula I (including compounds of Formulae Ia, Ib, Ic, Id, Ie, or If) or Formula I-X (including compounds of Formula I-Xa), or pharmaceutically acceptable salts and tautomers of any of the foregoing.

[0406] Those skilled in the art will recognize if a stereocenter exists in any of the compounds of the present disclosure. Accordingly, the present disclosure may include both possible stereoisomers (unless specified in the synthesis) and may include not only racemic compounds but the individual enantiomers and/or diastereomers as well. When a compound is desired as a single enantiomer or diastereomer, it may be obtained by stereospecific synthesis or by resolution of the final product or any convenient intermediate. Resolution of the final product, an intermediate, or a starting material may be affected by any suitable method known in the art. See, for example, “Stereochemistry of Organic Compounds” by E. L. Eliel, S. H. Wilen, and L. N. Mander (Wiley-Interscience, 1994).

PREPARATION OF COMPOUNDS

[0407] The compounds described herein may be made from commercially available starting materials or synthesized using known organic, inorganic, and/or enzymatic processes.

[0408] The compounds of the present disclosure can be prepared in a number of ways well known to those skilled in the art of organic synthesis. By way of example, compounds of the disclosure can be synthesized using the methods described below, together with synthetic methods known in the art of synthetic organic chemistry, or variations thereon as appreciated by those skilled in the art. These methods may include but are not limited to those methods described below.

[0409] The term “tautomers” may refer to a set of compounds that have the same number and type of atoms, but differ in bond connectivity and are in equilibrium with one another. A “tautomer” is a single member of this set of compounds. Typically a single tautomer is drawn but it may be understood that this single structure may represent all possible tautomers that might exist. Examples may include enol-ketone tautomerism. When a ketone is drawn it may be understood that both the enol and ketone forms are part of the disclosure.

[0410] In addition to tautomers that may exist at all amide, carbonyl, and oxime groups within compounds of Formula I (including compounds of Formulae Ia, Ib, Ic, Id, Ie, or If) or Formula I-X (including compounds of Formula I-Xa) or Formula Ia-X, Ib-X, Ic-X, Id-X, or Ie-X, compounds in this family readily interconvert via a ring-opened species between two major isomeric forms, known as the pyran and oxepane isomers (FIG. 1 below). This interconversion can be promoted by magnesium ions, mildly acidic conditions, or alkylamine salts, as described in the following references: i) Hughes, P. F.; Musser, J.; Conklin, M.; Russo, R. 1992. Tetrahedron Lett. 33(33): 4739-32. ii) Zhu, T. 2007. U.S. Pat. No. 7,241,771; Wyeth. iii) Hughes, P. F. 1994. U.S. Pat. No. 5,344,833; American Home Products Corp. The scheme below shows an interconversion between the pyran and oxepane isomers in compounds of Formula I (including compounds of Formulae Ia, Ib, Ic, Id, Ie, or If) or Formula I-X (including compounds of Formula I-Xa) or Formula Ia-X, Ib-X, Ic-X, Id-X, or Ie-X.

##STR00336##

[0411] As this interconversion occurs under mild condition, and the thermodynamic equilibrium position may vary between different members of compounds of Formula I (including compounds of Formulae Ia, Ib, Ic, Id, Ie, or If) or Formula I-X (including compounds of Formula I-Xa) or Formula Ia-X, Ib-X, Ic-X, Id-X, or Ie-X, both isomers are contemplated for the compounds of Formula I (including compounds of Formulae Ia, Ib, Ic, Id, Ie, or If) or Formula I-X (including compounds of Formula I-Xa) or Formula Ia-X, Ib-X, Ic-X, Id-X, or Ie-X. For the sake of brevity, the pyran isomer form of all intermediates and compounds of Formula I (including compounds of Formulae Ia, Ib, Ic, Id, Ie, or If) or Formula I-X (including compounds of Formula I-Xa) or Formula Ia-X, Ib-X, Ic-X, Id-X, or Ie-X is shown.

General Assembly Approaches for Bifunctional Rapalogs

[0412] With reference to the schemes below, rapamycin is Formula II,

##STR00337##

where R.sup.16 is —OCH.sub.3; R.sup.26 is ═O; R.sup.28 is —OH; R.sup.32 is ═O; and R.sup.40 is —OH. A “rapalog” may refer to an analog or derivative of rapamycin. For example, with reference to the schemes below, a rapalog can be rapamycin that is substituted at any position, such as R.sup.16, R.sup.26, R.sup.28, R.sup.32, or R.sup.40. An active site inhibitor (AS inhibitor) is active site mTOR inhibitor. In certain embodiments, AS inhibitor is depicted by B, in Formula I or Formula I-X.

Assembly of Series 1 Bifunctional Rapalogs

[0413] An assembly approach to Series 1 bifunctional rapalogs is shown in Scheme 1 below. For these types of bifunctional rapalogs, Linker Type A may include variations where q=0 to 30 or 0 to 10, such as q=1 to 7. An alkyne moiety can be attached to the rapalog at R.sup.40, R.sup.16, R.sup.28, R.sup.32, or R.sup.26 positions (Formula I or Formula I-X). The alkyne moiety can be attached via a variety of linkage fragments including variations found in Table 1 in the Examples Section. A Type 1 mTOR active site inhibitor can attach to the linker via a primary or secondary amine, and may include variations in Table 2 in the Examples Section. This assembly sequence starts with reaction of the linker Type A with the amino terminus of an active site inhibitor, such as those in Table 2, to provide an intermediate A1. Then, the intermediate is coupled to an alkyne containing rapalog, such as those from Table 1, via 3+2 cycloadditions to provide the Series 1 bifunctional rapalogs.

##STR00338##

Assembly of Series 2 Bifunctional Rapalogs

[0414] An assembly approach to Series 2 bifunctional rapalogs is shown in Scheme 2 below. For these types of bifunctional rapalogs, linker type B may include variations where q=0 to 30 or 0 to 10, such as q=1 to 8; o=0 to 8, such as o=0 to 2; and Q is CH.sub.2 or O (when o>0). The alkyne moiety can be attached to the rapalog at R.sup.40, R.sup.16, R.sup.28, R.sup.32, or R.sup.26 positions (Formula I or Formula I-X). The alkyne moiety can be attached via a variety of linkage fragments including variations in Table 1. The active site inhibitor can include variations in Table 2. This assembly sequence starts with reaction of the linker Type B with a cyclic anhydride to give Intermediate B1. The intermediate is then coupled to the amino terminus of an active site inhibitor, such as those in Table 2, to provide Intermediate B2. Then, the intermediate is coupled to an alkyne containing rapalog, such as those from Table 1, via 3+2 cycloadditions to provide the Series 2 bifunctional rapalogs.

##STR00339##

[0415] The general assembly of Series 2 bifunctional rapalogs can be used to prepare combinations of the Type B linkers, the alkyne-containing rapalogs in Table 1, and the Type 1 active site inhibitors in Table 2.

Assembly of Series 3 Bifunctional Rapalogs

[0416] An assembly approach to Series 3 bifunctional rapalogs is shown in Scheme 3 below. For these types of bifunctional rapalogs, linker type B may include variations where q=0 to 30 or 0 to 10, such as q=1 to 8. The alkyne moiety can be attached to the rapalog at R.sup.40, R.sup.16, R.sup.28, R.sup.32, or R.sup.26 positions (Formula I or Formula I-X). The alkyne moiety can be attached via a variety of linkage fragments including variations in Table 1. This assembly sequence starts with reaction of the linker Type B with a carboxylic acid of an active site inhibitor, such as those in Table 3 in the Examples Section, to provide Intermediate C1 (Scheme 3). Then, the intermediate is coupled to an alkyne containing rapalog, such as those from Table 1, via 3+2 cycloadditions to provide Series 3 bifunctional rapalogs.

##STR00340##

Assembly of Series 4 Bifunctional Rapalogs

[0417] An assembly approach to Series 4 bifunctional rapalogs is shown in Scheme 4 below. For these types of bifunctional rapalogs, linker type C may include variations where q=0 to 30 or 0 to 10, such as q=1 to 9. The azide moiety can be attached to the rapalog at R.sup.40, R.sup.16, R.sup.28, R.sup.32, or R.sup.26 positions (Formula I or Formula I-X). The azide moiety can be attached via a variety of linkage fragments including variations in Table 4 in the Examples Section. This assembly sequence starts with reaction of the linker type C with an amine-reactive alkyne-containing pre linker, such as those in Table 5 in the Examples Section, followed by carboxylic acid deprotection to provide Intermediate D1 (Scheme 4). The intermediate is then coupled to a nucleophilic amine containing active site inhibitor, such as those in Table 2, to provide Intermediate D2. Then, the intermediate is coupled to an azide containing rapalog, such as those in Table 4, via 3+2 cycloadditions to provide Series 4 bifunctional rapalogs. Another scheme for preparation of Series 4 bifunctional rapalogs is shown in Scheme 4A.

##STR00341##

##STR00342##

Assembly of Series 5 Bifunctional Rapalogs

[0418] An assembly approach to Series 5 bifunctional rapalogs is shown in Scheme 5 below. For these types of bifunctional rapalogs, linker type C may include variations where q=0 to 30 or 0 to 10, such as q=1 to 8. The azide moiety can be attached to the rapalog at R.sup.40, R.sup.16, R.sup.28, R.sup.32, or R.sup.26 positions (Formula I-X). The azide moiety can be attached via a variety of linkage fragments including variations in Table 4. This assembly sequence starts with reaction of the linker Type C with an amine-reactive alkyne-containing pre linker, such as those in Table 5 in the Examples Section, followed by carboxylic acid deprotection to provide Intermediate E1 (Scheme 5). Then, the intermediate is coupled to a Type C linker, using standard peptide forming conditions, followed by carboxylic acid deprotection to provide Intermediate E2. The intermediate is then coupled to an amine containing active site inhibitor, such as those in Table 2, using standard peptide bond forming conditions to provide Intermediate E3. Then, the intermediate is coupled to an azide containing rapalog, such as those in Table 4, via 3+2 cycloadditions to provide Series 5 bifunctional rapalogs.

##STR00343##

Assembly of Series 6 Bifunctional Rapalogs

[0419] An assembly approach to Series 6 bifunctional rapalogs is shown in Scheme 6 below. For these types of bifunctional rapalogs, linker type C may include variations where q=0 to 30 or 0 to 10, such as q=1 to 9. The azide moiety can be attached to the rapalog at R.sup.40, R.sup.16, R.sup.28, R.sup.32, or R.sup.26 positions (Formula I-X). The azide moiety can be attached via a variety of linkage fragments including variations in Table 4. This assembly sequence starts with reaction of the linker type C with an amine-reactive alkyne-containing pre linker, such as those in Table 5 in the Examples Section, followed by carboxylic acid deprotection to give Intermediate F1 (Scheme 6). The intermediate is then coupled to an amine containing linker, such as those found in Table 6 in the Examples Section, using standard peptide bond forming conditions followed by deprotection of the carboxylic acid to provide Intermediate F2. The intermediate is then coupled to an amine containing active site inhibitor, such as those in Table 2, using standard peptide bond forming conditions to provide Intermediate F3. Finally, the intermediate is coupled to an azide containing rapalog, such as those in Table 4, via 3+2 cycloadditions to provide Series 6 bifunctional rapalogs.

##STR00344##

Assembly of Series 7 Bifunctional Rapalogs

[0420] An assembly approach to Series 7 bifunctional rapalogs is shown in Scheme 7 below. For these types of bifunctional rapalogs, linker type A may include variations where q=0 to 30 or 0 to 10, such as q=1 to 8, and linker type D may include variations where o=0 to 10, such as o=1 to 8. The alkyne moiety can be attached to the rapalog at R.sup.40, R.sup.16, R.sup.28, R.sup.32, or R.sup.26 positions (Formula I-X). The alkyne moiety can be attached via a variety of linkage fragments including variations in Table 1. This assembly sequence starts with reaction of the linker Type D with a carboxylic acid of an active site inhibitor, such as those in Table 3 in the Examples Section, followed by N-deprotection to give Intermediate G1 (Scheme 7). Then, the intermediate is coupled to a type A linker, to provide Intermediate G2. Finally, the intermediate is coupled to an alkyne containing rapalog, such as those in Table 1, via 3+2 cycloadditions to provide Series 7 bifunctional rapalogs.

##STR00345##

Assembly of Series 8 Bifunctional Rapalogs

[0421] An assembly approach to Series 8 bifunctional rapalogs is shown in Scheme 8 below. For these types of bifunctional rapalogs, linker type C may include variations where q=0 to 30 or 0 to 10, such as q=1 to 9. The alkyne moiety can be attached to the rapalog at R.sup.40, R.sup.16, R.sup.28, R.sup.32, or R.sup.26 positions (Formula I-X). The alkyne moiety can be attached via a variety of linkage fragments including variations in Table 1. This assembly sequence starts with reaction of the linker type C with an azide containing pre-linker, such as those in Table 7 in the Examples Section, followed by carboxylic acid deprotection to give Intermediate H1 (Scheme 8). The intermediate is then coupled to the amine containing active site inhibitor, such as those in Table 2, using standard peptide bond forming conditions to provide Intermediate H2. Finally, the intermediate is coupled to an alkyne containing rapalog, such as those in Table 1, via 3+2 cycloadditions to provide Series 8 bifunctional rapalogs.

##STR00346##

Assembly of Series 9 Bifunctional Rapalogs

[0422] An assembly approach to Series 9 bifunctional rapalogs is shown in Scheme 9 below. For these types of bifunctional rapalogs, Linker Type E may include variations where q=0 to 30 or 0 to 10, such as q=1 to 7. An azide moiety can be attached to the rapalog at R.sup.40, R.sup.16, R.sup.28, R.sup.32, or R.sup.26 positions (Formula I-X). The azide moiety can be attached via a variety of linkage fragments including variations found in Table 4 in the Examples Section. A Type 1 mTOR active site inhibitor can attach to the linker via a primary or secondary amine, and may include variations in Table 2 in the Examples Section. This assembly sequence starts with reaction of the linker Type E with the amino terminus of an active site inhibitor, such as those in Table 2, to provide an intermediate I1. Then, the intermediate is coupled to an alkyne containing rapalog, such as those from Table 4, via 3+2 cycloadditions to provide the Series 9 bifunctional rapalogs.

##STR00347##

Assembly of Series 10 Bifunctional Rapalogs

[0423] An assembly approach to Series 10 bifunctional rapalogs is shown in Scheme 10 below. For these types of bifunctional rapalogs, linker type F includes variations where q=0 to 30 or 0 to 10, such as q=1 to 8, and linker type G includes variations where o=0 to 10, such as o=1 to 8. The azide moiety can be attached to the rapalog at R.sup.40, R.sup.16, R.sup.28, R.sup.32, or R.sup.26 positions (Formula I-X). The azide moiety can be attached via a variety of linkage fragments including variations in Table 4. This assembly sequence starts with reaction of the linker Type F with the amine of an active site inhibitor, such as those in Table 2 in the Examples Section. Then, the intermediate is coupled to a type G linker, to provide Intermediate J2. Finally, the intermediate is coupled to an azide containing rapalog, such as those in Table 4, via 3+2 cycloadditions to provide Series 10 bifunctional rapalogs.

##STR00348##

Assembly of Series 11 Bifunctional Rapalogs

[0424] An assembly approach to Series 11 bifunctional rapalogs is shown in Scheme 11 below. For these types of bifunctional rapalogs, linker type A includes variations where q=0 to 30 or 0 to 10, such as q=1 to 8, and linker type C includes variations where o=0 to 10, such as o=1 to 8. The alkyne moiety can be attached to the rapalog at R.sup.40, R.sup.16, R.sup.28, R.sup.32, or R.sup.26 positions (Formula I-X). The azide moiety can be attached via a variety of linkage fragments including variations in Table 1. This assembly sequence starts with reaction of the linker Type A with the amine of a linker Type C, followed by deprotection of the carboxylic acid to provide Intermediate K1. Then, the intermediate is coupled an amine containing active site inhibitor, such as those found in Table 2, to provide Intermediate K2. Finally, the intermediate is coupled to an alkyne containing rapalog, such as those in Table 1, via 3+2 cycloadditions to provide Series 11 bifunctional rapalogs.

##STR00349##

Assembly of Series 12 Bifunctional Rapalogs

[0425] An assembly approach to Series 12 bifunctional rapalogs is shown in Scheme 12 below. For these types of bifunctional rapalogs, linker type H may include variations where q=0 to 30 or 0 to 10, such as q=1 to 9. The alkyne moiety can be attached to the rapalog at R.sup.40, R.sup.16, R.sup.28, R.sup.32, or R.sup.26 positions (Formula I-X). The alkyne moiety can be attached via a variety of linkage fragments including variations in Table 1. This assembly sequence starts with reaction of the linker type H with a nucleophilic amine containing active site inhibitor, such as those in Table 2, followed by carboxylic acid deprotection to provide Intermediate L1. Then, the intermediate is coupled with an azide containing amine prelinker, which can be composed of a primary or seconday amine, such as those in Table 8, to provide Intermediate L2. Finally, the intermediate is coupled to an alkyne containing rapalog, such as those in Table 1, via 3+2 cycloadditions to provide Series 12 bifunctional rapalogs.

##STR00350##

Assembly of Series 13 Bifunctional Rapalogs

[0426] An assembly approach to Series 13 bifunctional rapalogs is shown in Scheme 13 below. For these types of bifunctional rapalogs, linker type I may include variations where q=0 to 30 or 0 to 10, such as q=1 to 9. The azide moiety can be attached to the rapalog at R.sup.40, R.sup.16, R.sup.28, R.sup.32, or R.sup.26 positions (Formula I or Formula I-X). The azide moiety can be attached via a variety of linkage fragments including variations in Table 4. This assembly sequence starts with reaction of the linker type I with an alkyne containing pre-linker amine, which can be composed of a primary or secondary amine, such as those in Table 9 in the Examples Section, followed by N-deprotection to give Intermediate M1. The intermediate is then coupled to the carboxylic acid containing active site inhibitor, such as those in Table 3, using standard peptide bond forming conditions to provide Intermediate M2. Then, the intermediate is coupled to an azide containing rapalog, such as those in Table 4, via 3+2 cycloadditions to provide Series 13 bifunctional rapalogs.

##STR00351##

Assembly of Series 14 Bifunctional Rapalogs

[0427] An assembly approach to Series 14 bifunctional rapalogs is shown in Scheme 14 below. For this type of bifunctional rapalogs, linker type I may include variations where q=0 to 30 or 0 to 10, such as q=1 to 9. The carboxylic acid moiety can be attached to the rapalog at R.sup.40, R.sup.16, R.sup.28, R.sup.32, or R.sup.26 positions (Formula I or Formula I-X). The carboxylic acid moiety can be attached via a variety of linkage fragments including variations in Table 10. This assembly sequence starts with reaction of the linker type I with a nucleophilic amine containing active site inhibitor, such as those in Table 2, followed by N-deprotection to provide Intermediate N1. The intermediate is then coupled to a carboxylic acid containing rapalog, such as those in Table 10 in the Examples Section, to provide Series 14 bifunctional rapalogs.

##STR00352##

Assembly of Series 15 Bifunctional Rapalogs

[0428] An assembly approach to Series 15 bifunctional rapalogs is shown in Scheme 15 below. For this type of bifunctional rapalogs, linker type J may include variations where q=0 to 30 or 0 to 10, such as q=3 to 8. The amino moiety can be attached to the rapalog at R.sup.40, R.sup.16, R.sup.28, R.sup.32, or R.sup.26 positions (Formula I or Formula I-X). The amino moiety can be attached via a variety of linkage fragments including variations in Table 11. This assembly sequence starts with reaction of the linker type J with a nucleophilic amine containing active site inhibitor, such as those in Table 2, followed by carboxylic acid deprotection to provide Intermediate O1. The intermediate is then coupled to an amine containing rapalog, such as those in Table 11 in the Examples Section, to provide Series 15 bifunctional rapalogs.

##STR00353##

Assembly of Series 16 Bifunctional Rapalogs

[0429] An assembly approach to Series 16 bifunctional rapalogs is shown in Scheme 16 below. For these types of bifunctional rapalogs, linker Type C may include variations where q=0 to 30 or 0 to 10, such as q=1 to 9. The amine containing rapalog monomers may include those in Table 11. This assembly sequence starts with reaction of the linker Type C with a carboxylic acid of an active site inhibitor, such as those in Table 3, to provide Intermediate P1. Then, the intermediate is coupled to an amine containing rapalog, such as those in Table 11 in the Examples Section, to provide Series 16 bifunctional rapalogs.

##STR00354##

PHARMACEUTICAL COMPOSITIONS

[0430] In another aspect is provided a pharmaceutical composition including a pharmaceutically acceptable excipient and a compound, or pharmaceutically acceptable salt or tautomer thereof.

[0431] In embodiments of the pharmaceutical compositions, the compound, or pharmaceutically acceptable salt or tautomer thereof, may be included in a therapeutically effective amount.

[0432] Administration of the disclosed compounds or compositions can be accomplished via any mode of administration for therapeutic agents. These modes may include systemic or local administration such as oral, nasal, parenteral, transdermal, subcutaneous, vaginal, buccal, rectal or topical administration modes.

[0433] Depending on the intended mode of administration, the disclosed compounds or pharmaceutical compositions can be in solid, semi-solid or liquid dosage form, such as, for example, injectables, tablets, suppositories, pills, time-release capsules, elixirs, tinctures, emulsions, syrups, powders, liquids, suspensions, or the like, sometimes in unit dosages and consistent with conventional pharmaceutical practices. Likewise, they can also be administered in intravenous (both bolus and infusion), intraperitoneal, subcutaneous or intramuscular form, and all using forms well known to those skilled in the pharmaceutical arts.

[0434] Illustrative pharmaceutical compositions are tablets and gelatin capsules comprising a compound of the disclosure and a pharmaceutically acceptable carrier, such as a) a diluent, e.g., purified water, triglyceride oils, such as hydrogenated or partially hydrogenated vegetable oil, or mixtures thereof, corn oil, olive oil, sunflower oil, safflower oil, fish oils, such as EPA or DHA, or their esters or triglycerides or mixtures thereof, omega-3 fatty acids or derivatives thereof, lactose, dextrose, sucrose, mannitol, sorbitol, cellulose, sodium, saccharin, glucose and/or glycine; b) a lubricant, e.g., silica, talcum, stearic acid, its magnesium or calcium salt, sodium oleate, sodium stearate, magnesium stearate, sodium benzoate, sodium acetate, sodium chloride and/or polyethylene glycol; for tablets also; c) a binder, e.g., magnesium aluminum silicate, starch paste, gelatin, tragacanth, methylcellulose, sodium carboxymethylcellulose, magnesium carbonate, natural sugars such as glucose or beta-lactose, corn sweeteners, natural and synthetic gums such as acacia, tragacanth or sodium alginate, waxes and/or polyvinylpyrrolidone, if desired; d) a disintegrant, e.g., starches, agar, methyl cellulose, bentonite, xanthan gum, algiic acid or its sodium salt, or effervescent mixtures; e) absorbent, colorant, flavorant and sweetener; f) an emulsifier or dispersing agent, such as Tween 80, Labrasol, HPMC, DOSS, caproyl 909, labrafac, labrafil, peceol, transcutol, capmul MCM, capmul PG-12, captex 355, gelucire, vitamin E TGPS or other acceptable emulsifier; and/or g) an agent that enhances absorption of the compound such as cyclodextrin, hydroxypropyl-cyclodextrin, PEG400, PEG200.

[0435] Liquid, particularly injectable, compositions can, for example, be prepared by dissolution, dispersion, etc. For example, the disclosed compound is dissolved in or mixed with a pharmaceutically acceptable solvent such as, for example, water, saline, aqueous dextrose, glycerol, ethanol, and the like, to thereby form an injectable isotonic solution or suspension. Proteins such as albumin, chylomicron particles, or serum proteins can be used to solubilize the disclosed compounds.

[0436] The disclosed compounds can be also formulated as a suppository that can be prepared from fatty emulsions or suspensions; using polyalkylene glycols such as propylene glycol, as the carrier.

[0437] The disclosed compounds can also be administered in the form of liposome delivery systems, such as small unilamellar vesicles, large unilamellar vesicles and multilamellar vesicles. Liposomes can be formed from a variety of phospholipids, containing cholesterol, stearylamine or phosphatidylcholines. In some embodiments, a film of lipid components is hydrated with an aqueous solution of drug to a form lipid layer encapsulating the drug, as described for instance in U.S. Pat. No. 5,262,564, the contents of which are hereby incorporated by reference.

[0438] Disclosed compounds can also be delivered by the use of monoclonal antibodies as individual carriers to which the disclosed compounds are coupled. The disclosed compounds can also be coupled with soluble polymers as targetable drug carriers. Such polymers can include polyvinylpyrrolidone, pyran copolymer, polyhydroxypropylmethacrylamide-phenol, polyhydroxyethylaspanamidephenol, or polyethyleneoxidepolylysine substituted with palmitoyl residues. Furthermore, the disclosed compounds can be coupled to a class of biodegradable polymers useful in achieving controlled release of a drug, for example, polylactic acid, polyepsilon caprolactone, polyhydroxy butyric acid, polyorthoesters, polyacetals, polydihydropyrans, polycyanoacrylates and cross-linked or amphipathic block copolymers of hydrogels. In one embodiment, disclosed compounds are not covalently bound to a polymer, e.g., a polycarboxylic acid polymer, or a polyacrylate.

[0439] Parental injectable administration is generally used for subcutaneous, intramuscular or intravenous injections and infusions. Injectables can be prepared in conventional forms, either as liquid solutions or suspensions or solid forms suitable for dissolving in liquid prior to injection.

[0440] Another aspect of the disclosure relates to a pharmaceutical composition comprising a compound, or a pharmaceutically acceptable salt of tautomer thereof, of the present disclosure and a pharmaceutically acceptable carrier. The pharmaceutically acceptable carrier can further include an excipient, diluent, or surfactant.

[0441] Compositions can be prepared according to conventional mixing, granulating or coating methods, respectively, and the present pharmaceutical compositions can contain from about 0.1% to about 99%, from about 5% to about 90%, or from about 1% to about 20% of the disclosed compound by weight or volume.

[0442] In embodiments of the pharmaceutical compositions, the pharmaceutical composition may include a second agent (e.g. therapeutic agent). In embodiments of the pharmaceutical compositions, the pharmaceutical composition may include a second agent (e.g. therapeutic agent) in a therapeutically effective amount. In embodiments, the second agent is an anti-cancer agent. In embodiments, the second agent is an immunotherapeutic agent. In embodiments, the second agent is an immune-oncological agent. In embodiments, the second agent is an anti-autoimmune disease agent. In embodiments, the second agent is an anti-inflammatory disease agent. In embodiments, the second agent is an anti-neurodegenerative disease agent. In embodiments, the second agent is an anti-metabolic disease agent. In embodiments, the second agent is an anti-cardiovascular disease agent. In embodiments, the second agent is an anti-aging agent. In embodiments, the second agent is a longevity agent. In embodiments, the second agent is an agent for treating or preventing transplant rejection. In embodiments, the second agent is an agent for treating or preventing fungal infection. In embodiments, the second agent is immune system repressor. In embodiments, the second agent is an mTOR modulator. In embodiments, the second agent is an mTOR inhibitor. In embodiments, the second agent is an active site mTOR inhibitor. In embodiments, the second agent is a rapamycin. In embodiments, the second agent is a rapamycin analog. In embodiments, the second agent is an mTORCl pathway inhibitor.

mTOR and Methods of Treatment

[0443] The term “mTOR” may refer to the protein “mechanistic target of rapamycin (serine/threonine kinase)” or “mammalian target of rapamycin.” The term “mTOR” may refer to the nucleotide sequence or protein sequence of human mTOR (e.g., Entrez 2475, Uniprot P42345, RefSeq NM_004958, or RefSeq NP_004949) (SEQ ID NO: 1). The term “mTOR” may include both the wild-type form of the nucleotide sequences or proteins as well as any mutants thereof. In some embodiments, “mTOR” is wild-type mTOR. In some embodiments, “mTOR” is one or more mutant forms. The term “mTOR” XYZ may refer to a nucleotide sequence or protein of a mutant mTOR wherein the Y numbered amino acid of mTOR that normally has an X amino acid in the wildtype, instead has a Z amino acid in the mutant. In embodiments, an mTOR is the human mTOR. In embodiments, the mTOR has the nucleotide sequence corresponding to reference number GL206725550 (SEQ ID NO:2). In embodiments, the mTOR has the nucleotide sequence corresponding to RefSeq NM_004958.3 (SEQ ID NO:2). In embodiments, the mTOR has the protein sequence corresponding to reference number GL4826730 (SEQ ID NO: 1). In embodiments, the mTOR has the protein sequence corresponding to RefSeq NP_004949.1 (SEQ ID NO: 1). In embodiments, the mTOR has the following amino acid sequence:

TABLE-US-00002 (SEQ ID NO: 1) MLGTGPAAATTAATTSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVT MELREMSQEESTRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEG GNATRIGRFANYLRNLLPSNDPWMEMASKAIGRLAMAGDTFTAEYVEFE VKRALEWLGADRNEGRRHAAVLVLRELAISVPTFFFQQVQPFFDNIFVA VWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEEAEKGFD ETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLV HDKYCKDLMGFGTKPRHITPFTSFQAVQPQQSNALVGLLGYSSHQGLMG FGTSPSPAKSTLVESRCCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTIL NLLPRLAAFRPSAFTDTQYLQDTMNHVLSCVKKEKERTAAFQALGLLSV AVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAMQVDATVFTCISMLAR AMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL KMLSLVLMHKPLRHPGMPKGLAHQLASPGLTTLPEASDVGSITLALRTL GSFEFEGHSLTQFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSIHLIS GHAHVVSQTAVQVVADVLSKLLWGITDPDPDIRYCVLASLDERFDAHLA QAENLQALFVALNDQVFEIRELAICTVGRLSSMNPAFVMPFLRKMLIQI LTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALILKLKDP DPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLA KRQVALWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREA IRVLGLLGALDPYKHKVNIGMIDQSRDASAVSLSESKSSQDSSDYSTSE MLVNMGNLPLDEFYPAVSMVALMRIFRDQSLSHHHTMVVQAITFIFKSL GLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLVSFVKSHIRPYM DEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLR VFMHDNSPGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEAPL PSRKAALETVDRLTESLDFTDYASRIIHPIVRTLDQSPELRSTAMDTLS SLVFQLGKKYQIFIPMVNKVLVRHRINHQRYDVLICRIVKGYTLADEEE DPLIYQHRMLRSGQGDALASGPVETGPMKKLHVSTINLQKAWGAARRVS KDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNAAFVSC WSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPL RDDNGIVLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKL QQPEAAAGVLEYAMKHFGELEIQATWYEKLHEWEDALVAYDKKMDTNKD DPELMLGRMRCLEALGEWGQLHQQCCEKWTLVNDETQAKMARMAAAAAW GLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLAQQCIDKARDL LDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIW WERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLAL AHKTLVLLLGVDPSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHM QHFVQTMQQQAQHAIATEDQQHKQELHKLMARCFLKLGEWQLNLQGINE STIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEAVLHYKHQNQARDEKK KLRHASGANITNATTAATTAATATTTASTEGSNSESEAESTENSPTPSP LQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDY GHWPDVNEALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLT DIGRYHPQALIYPLTVASKSTTTARHNAANKILKNMCEHSNTLVQQAMM VSEELIRVAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMER GPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFR RISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAP SLQVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNT LLANDPTSLRKNLSIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREK KKILLNIEHRIMLRMAPDYDHLTLMQKVEVFEHAVNNTAGDDLAKLLWL KSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRLSGKIL HIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITCHTV MEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAG QSVEILDGVELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQII NRVRDKLTGRDFSHDDTLDVPTQVELLIKQATSHENLCQCYIGWCPFW

[0444] In embodiments, the mTOR is a mutant mTOR. In embodiments, the mutant mTOR is associated with a disease that is not associated with wildtype mTOR. In embodiments, the mTOR may include at least one amino acid mutation (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 mutations) compared to the sequence above.

[0445] The term “mTORC1” may refer to the protein complex including mTOR and Raptor (regulatory-associated protein of mTOR). mTORC1 may also include MLST8 (mammalian lethal with SEC 13 protein 8), PRAS40, and/or DEPTOR. mTORC1 may function as a nutrient/energy/redox sensor and regulator of protein synthesis. The term “mTORC1 pathway” or “mTORC1 signal transduction pathway” may refer to a cellular pathway including mTORC1. An mTORC1 pathway includes the pathway components upstream and downstream from mTORC1. An mTORC1 pathway is a signaling pathway that is modulated by modulation of mTORC1 activity. In embodiments, an mTORC1 pathway is a signaling pathway that is modulated by modulation of mTORC1 activity but not by modulation of mTORC2 activity. In embodiments, an mTORC1 pathway is a signaling pathway that is modulated to a greater extent by modulation of mTORC1 activity than by modulation of mTORC2 activity.

[0446] The term “mTORC2” may refer to the protein complex including mTOR and RICTOR (rapamycin-insensitive companion of mTOR). mTORC2 may also include GβL, mSIN1 (mammalian stress-activated protein kinase interacting protein 1), Protor ½, DEPTOR, TTI1, and/or TEL2. mTORC2 may regulate cellular metabolism and the cytoskeleton. The term “mTORC2 pathway” or “mTORC2 signal transduction pathway” may refer to a cellular pathway including mTORC2. An mTORC2 pathway includes the pathway components upstream and downstream from mTORC2. An mTORC2 pathway is a signaling pathway that is modulated by modulation of mTORC2 activity. In embodiments, an mTORC2 pathway is a signaling pathway that is modulated by modulation of mTORC2 activity but not by modulation of mTORC1 activity. In embodiments, an mTORC2 pathway is a signaling pathway that is modulated to a greater extent by modulation of mTORC2 activity than by modulation of mTORC1 activity.

[0447] The term “rapamycin” or “sirolimus” may refer to a macrolide produced by the bacteria Streptomyces hygroscopicus. Rapamycin may prevent the activation of T cells and B cells. Rapamycin has the IUPAC name (3S,6R,7E,9R, 10R, 12R, 14S, 15E, 17E, 19E,21S,23S,26R,27R,34aS)-9, 10, 12, 13, 14,21,22,23,24,25,26,27,32,33,34,34a-hexadecahydro-9,27-dihydroxy-3-[(1R)-2-[(1 S,3R,4R)-4-hydroxy-3-methoxycyclohexyl]-1-methylethyl]-10,21-dimethoxy-6,8, 12, 14,20,26-hexamethyl-23,27-epoxy-3H-pyrido[2, 1-c][1,4]-oxaazacyclohentriacontine-1,5,11,28,29(4H,6H,31H)-pentone. Rapamycin has the CAS number 53123-88-9. Rapamycin may be produced synthetically (e.g., by chemical synthesis) or through use of a production method that does not include use of Streptomyces hygroscopicus.

[0448] “Analog” is used in accordance with its plain ordinary meaning within chemistry and biology and may refer to a chemical compound that is structurally similar to another compound (i.e., a so-called “reference” compound) but differs in composition, e.g., in the replacement of one atom by an atom of a different element, or in the presence of a particular functional group, or the replacement of one functional group by another functional group, or the absolute stereochemistry of one or more chiral centers of the reference compound, including isomers thereof. Accordingly, an analog is a compound that is similar or comparable in function and appearance but not in structure or origin to a reference compound.

[0449] The term “rapamycin analog” or “rapalog” may refer to analogs or derivatives (e.g., prodrugs) of rapamycin.

[0450] The terms “active site mTOR inhibitor” and “ATP mimetic” may refer to a compound that inhibits the activity of mTOR (e.g., kinase activity) and binds to the active site of mTOR (e.g., the ATP binding site, overlapping with the ATP binding site, blocking access by ATP to the ATP binding site of mTOR). Examples of active site mTOR inhibitors may include, but are not limited to, ΓNK128, PP242, PP121, MLN0128, AZD8055, AZD2014, NVP-BEZ235, BGT226, SF1126, Torin 1, Torin 2, WYE 687, WYE 687 salt (e.g., hydrochloride), PF04691502, PI-103, CC-223, OSI-027, XL388, KU-0063794, GDC-0349, and PKI-587. In embodiments, an active site mTOR inhibitor is an asTORi. In some embodiments, “active site inhibitor” may refer to “active site mTOR inhibitor.”

[0451] The term “FKBP” may refer to the protein Peptidyl-prolyl cis-trans isomerase. For non-limiting examples of FKBP, see Cell Mol Life Sci. 2013 September; 70(18):3243-75. In embodiments, “FKBP” may refer to “FKBP-12” or “FKBP 12” or “FKBP 1 A.” In embodiments, “FKBP” may refer to the human protein. Included in the term “FKBP” is the wildtype and mutant forms of the protein. In embodiments, “FKBP” may refer to the wildtype human protein. In embodiments, “FKBP” may refer to the wildtype human nucleic acid. In embodiments, the FKBP is a mutant FKBP. In embodiments, the mutant FKBP is associated with a disease that is not associated with wildtype FKBP. In embodiments, the FKBP includes at least one amino acid mutation (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 mutations) compared to wildtype FKBP.

[0452] The term “FKBP-12” or “FKBP 12” or “FKBP1A” may refer to the protein “Peptidyl-prolyl cis-trans isomerase FKBP 1 A.” In embodiments, “FKBP-12” or “FKBP 12” or “FKBP 1 A” may refer to the human protein. Included in the term “FKBP-12” or “FKBP 12” or “FKBP 1 A” are the wildtype and mutant forms of the protein. In embodiments, “FKBP-12” or “FKBP 12” or “FKBP 1 A” may refer to the protein associated with Entrez Gene 2280, OMIM 186945, UniProt P62942, and/or RefSeq (protein) NP_000792 (SEQ ID NO:3). In embodiments, the reference numbers immediately above may refer to the protein, and associated nucleic acids, known as of the date of filing of this application. In embodiments, “FKBP-12” or “FKBP 12” or “FKBP 1 A” may refer to the wildtype human protein. In embodiments, “FKBP-12” or “FKBP 12” or “FKBP1A” may refer to the wildtype human nucleic acid. In embodiments, the FKBP-12 is a mutant FKBP-12. In embodiments, the mutant FKBP-12 is associated with a disease that is not associated with wildtype FKBP-12. In embodiments, the FKBP-12 may include at least one amino acid mutation (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 mutations) compared to wildtype FKBP-12. In embodiments, the FKBP-12 has the protein sequence corresponding to reference number GI:206725550. In embodiments, the FKBP-12 has the protein sequence corresponding to RefSeq NP_000792.1 (SEQ ID NO:3).

[0453] The term “4E-BP1” or “4EBP1” or “EIF4EBP1” may refer to the protein “Eukaryotic translation initiation factor 4E-binding protein 1.” In embodiments, “4E-BP1” or “4EBP1” or “EIF4EBP 1” may refer to the human protein. Included in the term “4E-BP 1” or “4EBP 1” or “EIF4EBP1” are the wildtype and mutant forms of the protein. In embodiments, “4E-BP1” or “4EBP1” or “EIF4EBP1” may refer to the protein associated with Entrez Gene 1978, OMIM 602223, UniProt Q13541, and/or RefSeq (protein) NP_004086 (SEQ ID NO:4). In embodiments, the reference numbers immediately above may refer to the protein, and associated nucleic acids, known as of the date of filing of this application. In embodiments, “4E-BP 1” or “4EBP1” or “EIF4EBP1” may refer to the wildtype human protein. In embodiments, “4E-BP1” or “4EBP1” or “EIF4EBP1” may refer to the wildtype human nucleic acid. In embodiments, the 4EBP1 is a mutant 4EBP1. In embodiments, the mutant 4EBP1 is associated with a disease that is not associated with wildtype 4EBP1. In embodiments, the 4EBP1 may include at least one amino acid mutation (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 mutations) compared to wildtype 4EBP1. In embodiments, the 4EBP1 has the protein sequence corresponding to reference number GL4758258. In embodiments, the 4EBP1 has the protein sequence corresponding to RefSeq NP_004086.1 (SEQ ID NO:4).

[0454] The term “Akt” may refer to the serine/threonine specific protein kinase involved in cellular processes such as glucose metabolism, apoptosis, proliferation, and other functions, also known as “protein kinase B” (PKB) or “Akt1.” In embodiments, “Akt” or “AM” or “PKB” may refer to the human protein. Included in the term “Akt” or “Akt1” or “PKB” are the wildtype and mutant forms of the protein. In embodiments, “Akt” or “Akt1” or “PKB” may refer to the protein associated with Entrez Gene 207, OMIM 164730, UniProt P31749, and/or RefSeq (protein) NP_005154 (SEQ ID NO:5). In embodiments, the reference numbers immediately above may refer to the protein, and associated nucleic acids, known as of the date of filing of this application. In embodiments, “Akt” or “Akt1” or “PKB” may refer to the wildtype human protein. In embodiments, “Akt” or “Akt1” or “PKB” may refer to the wildtype human nucleic acid. In embodiments, the Akt is a mutant Akt. In embodiments, the mutant Akt is associated with a disease that is not associated with wildtype Akt. In embodiments, the Akt may include at least one amino acid mutation (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 mutations) compared to wildtype Akt. In embodiments, the Akt has the protein sequence corresponding to reference number GI: 62241011. In embodiments, the Akt has the protein sequence corresponding to RefSeq NP_005154.2 (SEQ ID NO:5).

[0455] The present disclosure provides a method of treating a disease or disorder mediated by mTOR comprising administering to the subject suffering from or susceptible to developing a disease or disorder mediated by mTOR a therapeutically effective amount of one or more disclosed compositions or compounds. The present disclosure provides a method of preventing a disease or disorder mediated by mTOR comprising administering to the subject suffering from or susceptible to developing a disease or disorder mediated by mTOR a therapeutically effective amount of one or more disclosed compositions or compounds. The present disclosure provides a method of reducing the risk of a disease or disorder mediated by mTOR comprising administering to the subject suffering from or susceptible to developing a disease or disorder mediated by mTOR a therapeutically effective amount of one or more disclosed compositions or compounds.

[0456] In some embodiments, the disease is cancer or an immune-mediated disease. In some embodiments, the cancer is selected from brain and neurovascular tumors, head and neck cancers, breast cancer, lung cancer, mesothelioma, lymphoid cancer, stomach cancer, kidney cancer, renal carcinoma, liver cancer, ovarian cancer, ovary endometriosis, testicular cancer, gastrointestinal cancer, prostate cancer, glioblastoma, skin cancer, melanoma, neuro cancers, spleen cancers, pancreatic cancers, blood proliferative disorders, lymphoma, leukemia, endometrial cancer, cervical cancer, vulva cancer, prostate cancer, penile cancer, bone cancers, muscle cancers, soft tissue cancers, intestinal or rectal cancer, anal cancer, bladder cancer, bile duct cancer, ocular cancer, gastrointestinal stromal tumors, and neuro-endocrine tumors. In some embodiments, the disorder is liver cirrhosis. In some embodiments, the immune-mediated disease is selected from resistance by transplantation of heart, kidney, liver, medulla ossium, skin, cornea, lung, pancreas, intestinum tenue, limb, muscle, nerves, duodenum, small-bowel, or pancreatic-islet-cell; graft-versus-host diseases brought about by medulla ossium transplantation; rheumatoid arthritis, systemic lupus erythematosus, Hashimoto's thyroiditis, multiple sclerosis, myasthenia gravis, type I diabetes, uveitis, allergic encephalomyelitis, and glomerulonephritis.

[0457] The present disclosure provides a method of treating cancer comprising administering to the subject a therapeutically effective amount of one or more disclosed compositions or compounds. In some embodiments, the cancer is selected from brain and neurovascular tumors, head and neck cancers, breast cancer, lung cancer, mesothelioma, lymphoid cancer, stomach cancer, kidney cancer, renal carcinoma, liver cancer, ovarian cancer, ovary endometriosis, testicular cancer, gastrointestinal cancer, prostate cancer, glioblastoma, skin cancer, melanoma, neuro cancers, spleen cancers, pancreatic cancers, blood proliferative disorders, lymphoma, leukemia, endometrial cancer, cervical cancer, vulva cancer, prostate cancer, penile cancer, bone cancers, muscle cancers, soft tissue cancers, intestinal or rectal cancer, anal cancer, bladder cancer, bile duct cancer, ocular cancer, gastrointestinal stromal tumors, and neuro-endocrine tumors. In some embodiments, the disorder is liver cirrhosis.

[0458] The present disclosure provides a method of treating an immune-mediated disease comprising administering to the subject a therapeutically effective amount of one or more disclosed compositions or compounds. In some embodiments, the immune-mediated disease is selected from resistance by transplantation of heart, kidney, liver, medulla ossium, skin, cornea, lung, pancreas, intestinum tenue, limb, muscle, nerves, duodenum, small-bowel, or pancreatic-islet-cell; graft-versus-host diseases brought about by medulla ossium transplantation; rheumatoid arthritis, systemic lupus erythematosus, Hashimoto's thyroiditis, multiple sclerosis, myasthenia gravis, type I diabetes, uveitis, allergic encephalomyelitis, and glomerulonephritis.

[0459] The present disclosure provide a method of treating an age related condition comprising administering to the subject a therapeutically effective amount of one or more disclosed compositions or compounds. In certain embodiments, the age related condition is selected from sarcopenia, skin atrophy, muscle wasting, brain atrophy, atherosclerosis, arteriosclerosis, pulmonary emphysema, osteoporosis, osteoarthritis, high blood pressure, erectile dysfunction, dementia, Huntington's disease, Alzheimer's disease, cataracts, age-related macular degeneration, prostate cancer, stroke, diminished life expectancy, impaired kidney function, and age-related hearing loss, aging-related mobility disability (e.g., frailty), cognitive decline, age-related dementia, memory impairment, tendon stiffness, heart dysfunction such as cardiac hypertrophy and systolic and diastolic dysfunction, immunosenescence, cancer, obesity, and diabetes.

[0460] In certain embodiments, the disclosed compositions or compounds can be used with regard to immunosenescence. Immunosenescence may refer to a decrease in immune function resulting in impaired immune response, e.g., to cancer, vaccination, infectious pathogens, among others. It involves both the host's capacity to respond to infections and the development of long-term immune memory, especially by vaccination. This immune deficiency is ubiquitous and found in both long- and short-lived species as a function of their age relative to life expectancy rather than chronological time. It is considered a major contributory factor to the increased frequency of morbidity and mortality among the elderly. Immunosenescence is not a random deteriorative phenomenon, rather it appears to inversely repeat an evolutionary pattern and most of the parameters affected by immunosenescence appear to be under genetic control. Immunosenescence can also be sometimes envisaged as the result of the continuous challenge of the unavoidable exposure to a variety of antigens such as viruses and bacteria. Immunosenescence is a multifactorial condition leading to many pathologically significant health problems, e.g., in the aged population. Age-dependent biological changes such as depletion of hematopoietic stem cells, an increase in PD1+ lymphocytes, a decline in the total number of phagocytes and NK cells and a decline in humoral immunity contribute to the onset of immunosenescence. In one aspect, immunosenescence can be measured in an individual by measuring telomere length in immune cells (See, e.g., U.S. Pat. No. 5,741,677). Immunosenescence can also be determined by documenting in an individual a lower than normal number of naive CD4 and/or CD8 T cells, T cell repertoire, the number of PD1-expressing T cells, e.g., a lower than normal number of PD-1 negative T cells, or response to vaccination in a subject greater than or equal to 65 years of age. In certain embodiments, mTORC1 selective modulation of certain T-cell populations may improve vaccine efficacy in the aging population and enhance effectiveness of cancer immunotherapy. The present disclosure provides a method of treating immunosenescence comprising administering to the subject a therapeutically effective amount of one or more disclosed compositions or compounds.

[0461] In an aspect is provided a method of treating a disease associated with an aberrant level of mTORC1 activity in a subject in need of such treatment. The disease may be caused by an upregulation of mTORC1. The method may include administering to the subject one or more compositions or compounds described herein. The method may include administering to the subject a therapeutically effective amount of one or more compositions or compounds described herein (e.g., an mTORC1 modulator (e.g., inhibitor) as described above).

[0462] In an aspect is provided one or more compositions or compounds as described herein for use as a medicament. In embodiments, the medicament is useful for treating a disease caused by an upregulation of mTORC1. The use may include administering to the subject one or more compositions or compounds described herein. The use may include administering to the subject a therapeutically effective amount of one or more compositions or compounds described herein (e.g., an mTORC1 modulator (e.g., inhibitor) as described above).

[0463] In an aspect is provided one or more compositions or compounds as described herein for use in the treatment of a disease caused by aberrant levels of mTORC1 activity in a subject in need of such treatment. The disease may be caused by an upregulation of mTORC1. The use may include administering to the subject one or more compositions or compounds described herein. The use may include administering to the subject a therapeutically effective amount of one or more compositions or compounds described herein (e.g., an mTORC1 modulator (e.g., inhibitor) as described above).

[0464] Upregulation of mTORC1 can result in an increased amount of mTORC1 activity compared to normal levels of mTORC1 activity in a particular subject or a population of healthy subjects. The increased amount of mTORC1 activity may result in, for example, excessive amounts of cell proliferation thereby causing the disease state.

[0465] The subject of treatment for the disease is typically a mammal. The mammal treated with the compound (e.g., compound described herein, mTORC1 modulator (e.g., inhibitor)) may be a human, nonhuman primate, and/or non-human mammal (e.g., rodent, canine).

[0466] In another aspect is provided a method of treating an mTORC1 activity-associated disease in a subject in need of such treatment, the method including administering one or more compositions or compounds as described herein, including embodiments (e.g., a claim, embodiment, example, table, figure, or claim) to the subject.

[0467] In another aspect is provided one or more compositions or compounds as described herein for use as a medicament. In embodiments, the medicament may be useful for treating an mTORC1 activity-associated disease in a subject in need of such treatment. In embodiments, the use may include administering one or more compositions or compounds as described herein, including embodiments (e.g., an aspect, embodiment, example, table, figure, or claim) to the subject.

[0468] In another aspect is provided one or more compositions or compounds for use in the treatment of an mTORC1 activity-associated disease in a subject in need of such treatment. In embodiments, the use may include administering one or more compositions or compounds as described herein, including embodiments (e.g., an aspect, embodiment, example, table, figure, or claim) to the subject.

[0469] In embodiments, the mTORC1 activity-associated disease or disease associated with aberrant levels of mTORC1 activity is cancer. In embodiments, the mTORC1 activity-associated disease or disease associated with aberrant levels of mTORC1 activity is an autoimmune disease. In embodiments, the mTORC1 activity-associated disease or disease associated with aberrant levels of mTORC1 activity is an inflammatory disease. In embodiments, the mTORC1 activity-associated disease or disease associated with aberrant levels of mTORC1 activity is a neurodegenerative disease. In embodiments, the mTORC1 activity-associated disease or disease associated with aberrant levels of mTORC1 activity is a metabolic disease. In embodiments, the mTORC1 activity-associated disease or disease associated with aberrant levels of mTORC1 activity is transplant rejection. In embodiments, the mTORC1 activity-associated disease or disease associated with aberrant levels of mTORC1 activity is fungal infection. In embodiments, the mTORC1 activity-associated disease or disease associated with aberrant levels of mTORC1 activity is a cardiovascular disease.

[0470] In embodiments, the mTORC1 activity-associated disease or disease associated with aberrant levels of mTORC1 activity is aging. In embodiments, the mTORC1 activity-associated disease or disease associated with aberrant levels of mTORC1 activity is dying of an age-related disease. In embodiments, the mTORC1 activity-associated disease or disease associated with aberrant levels of mTORC1 activity is an age-related condition. In certain embodiments, the age related condition is selected from the group consisting of sarcopenia, skin atrophy, muscle wasting, brain atrophy, atherosclerosis, arteriosclerosis, pulmonary emphysema, osteoporosis, osteoarthritis, high blood pressure, erectile dysfunction, dementia, Huntington's disease, Alzheimer's disease, cataracts, age-related macular degeneration, prostate cancer, stroke, diminished life expectancy, impaired kidney function, and age-related hearing loss, aging-related mobility disability (e.g., frailty), cognitive decline, age-related dementia, memory impairment, tendon stiffness, heart dysfunction such as cardiac hypertrophy and systolic and diastolic dysfunction, immunosenescence, cancer, obesity, and diabetes. In certain embodiments, mTORC1 selective modulation of certain T-cell populations may improve vaccine efficacy in the aging population and enhance effectiveness of cancer immunotherapy. The present disclosure provides a method of treating immunosenescence comprising administering to the subject a therapeutically effective amount of one or more disclosed compounds.

[0471] In embodiments, the mTORC1 activity-associated disease or disease associated with aberrant levels of mTORC1 activity is cancer (e.g., carcinomas, sarcomas, adenocarcinomas, lymphomas, leukemias, solid cancers, lymphoid cancers; cancer of the kidney, breast, lung, bladder, colon, gastrointestinal, ovarian, prostate, pancreas, stomach, brain, head and neck, skin, uterine, esophagus, liver; testicular cancer, glioma, hepatocarcinoma, lymphoma, including B-acute lymphoblastic lymphoma, non-Hodgkin's lymphomas (e.g., Burkitt's, Small Cell, and Large Cell lymphomas), Hodgkin's lymphoma, leukemia (including AML, ALL, and CML), multiple myeloma, and breast cancer (e.g., triple negative breast cancer)).

[0472] In embodiments, the mTORC1 activity-associated disease or disease associated with aberrant levels of mTORC1 activity is Acute Disseminated Encephalomyelitis (ADEM), Acute necrotizing hemorrhagic leukoencephalitis, Addison's disease, Agammaglobulinemia, Alopecia areata, Amyloidosis, Ankylosing spondylitis, Anti-GBM/Anti-TBM nephritis, Antiphospholipid syndrome (APS), Autoimmune angioedema, Autoimmune aplastic anemia, Autoimmune dysautonomia, Autoimmune hepatitis, Autoimmune hyperlipidemia, Autoimmune immunodeficiency, Autoimmune inner ear disease (AIED), Autoimmune myocarditis, Autoimmune oophoritis, Autoimmune pancreatitis, Autoimmune retinopathy, Autoimmune thrombocytopenic purpura (ATP), Autoimmune thyroid disease, Autoimmune urticaria, Axonal or neuronal neuropathies, Balo disease, Behcet's disease, Bullous pemphigoid, Cardiomyopathy, Castleman disease, Celiac disease, Chagas disease, Chronic fatigue syndrome, Chronic inflammatory demyelinating polyneuropathy (CIDP), Chronic recurrent multifocal ostomyelitis (CRMO), Churg-Strauss syndrome, Cicatricial pemphigoid/benign mucosal pemphigoid, Crohn's disease, Cogans syndrome, Cold agglutinin disease, Congenital heart block, Coxsackie myocarditis, CREST disease, Essential mixed cryoglobulinemia, Demyelinating neuropathies, Dermatitis herpetiformis, Dermatomyositis, Devic's disease (neuromyelitis optica), Discoid lupus, Dressier's syndrome, Endometriosis, Eosinophilic esophagitis, Eosinophilic fasciitis, Erythema nodosum, Experimental allergic encephalomyelitis, Evans syndrome, Fibromyalgia, Fibrosing alveolitis, Giant cell arteritis (temporal arteritis), Giant cell myocarditis, Glomerulonephritis, Goodpasture's syndrome, Granulomatosis with Polyangiitis (GPA) (formerly called Wegener's Granulomatosis), Graves' disease, Guillain-Barre syndrome, Hashimoto's encephalitis, Hashimoto's thyroiditis, Hemolytic anemia, Henoch-Schonlein purpura, Herpes gestationis, Hypogammaglobulinemia, Idiopathic thrombocytopenic purpura (ITP), IgA nephropathy, IgG4-related sclerosing disease, Immunoregulatory lipoproteins, Inclusion body myositis, Interstitial cystitis, Juvenile arthritis, Juvenile diabetes (Type 1 diabetes), Juvenile myositis, Kawasaki syndrome, Lambert-Eaton syndrome, Leukocytoclastic vasculitis, Lichen planus, Lichen sclerosus, Ligneous conjunctivitis, Linear IgA disease (LAD), Lupus (SLE), Lyme disease, chronic, Meniere's disease, Microscopic polyangiitis, Mixed connective tissue disease (MCTD), Mooren's ulcer, Mucha-Habermann disease, Multiple sclerosis, Myasthenia gravis, Myositis, Narcolepsy, Neuromyelitis optica (Devic's), Neutropenia, Ocular cicatricial pemphigoid, Optic neuritis, Palindromic rheumatism, PANDAS (Pediatric Autoimmune Neuropsychiatry Disorders Associated with Streptococcus), Paraneoplastic cerebellar degeneration, Paroxysmal nocturnal hemoglobinuria (PNH), Parry Romberg syndrome, Parsonnage-Turner syndrome, Pars planitis (peripheral uveitis), Pemphigus, Peripheral neuropathy, Perivenous encephalomyelitis, Pernicious anemia, POEMS syndrome, Polyarteritis nodosa, Type I, II, & III autoimmune polyglandular syndromes, Polymyalgia rheumatica, Polymyositis, Postmyocardial infarction syndrome, Postpericardiotomy syndrome, Progesterone dermatitis, Primary biliary cirrhosis, Primary sclerosing cholangitis, Psoriasis, Psoriatic arthritis, Idiopathic pulmonary fibrosis, Pyoderma gangrenosum, Pure red cell aplasia, Raynauds phenomenon, Reactive Arthritis, Reflex sympathetic dystrophy, Reiter's syndrome, Relapsing polychondritis, Restless legs syndrome, Retroperitoneal fibrosis, Rheumatic fever, Rheumatoid arthritis, Sarcoidosis, Schmidt syndrome, Scleritis, Scleroderma, Sjogren's syndrome, Sperm & testicular autoimmunity, Stiff person syndrome, Subacute bacterial endocarditis (SBE), Susac's syndrome, Sympathetic ophthalmia, Takayasu's arteritis, Temporal arteritis/Giant cell arteritis, Thrombocytopenic purpura (TTP), Tolosa-Hunt syndrome, Transverse myelitis, Type 1 diabetes, Ulcerative colitis, Undifferentiated connective tissue disease (UCTD), Uveitis, Vasculitis, Vesiculobullous dermatosis, Vitiligo, Wegener's granulomatosis (i.e., Granulomatosis with Polyangiitis (GPA), traumatic brain injury, arthritis, rheumatoid arthritis, psoriatic arthritis, juvenile idiopathic arthritis, multiple sclerosis, systemic lupus erythematosus (SLE), myasthenia gravis, juvenile onset diabetes, diabetes mellitus type 1, Guillain-Barre syndrome, Hashimoto's encephalitis, Hashimoto's thyroiditis, ankylosing spondylitis, psoriasis, Sjogren's syndrome, vasculitis, glomerulonephritis, auto-immune thyroiditis, Behcet's disease, Crohn's disease, ulcerative colitis, bullous pemphigoid, sarcoidosis, ichthyosis, Graves ophthalmopathy, inflammatory bowel disease, Addison's disease, Vitiligo, asthma, allergic asthma, acne vulgaris, celiac disease, chronic prostatitis, inflammatory bowel disease, pelvic inflammatory disease, reperfusion injury, sarcoidosis, transplant rejection, interstitial cystitis, atherosclerosis, atopic dermatitis, Alexander's disease, Alper's disease, Alzheimer's disease, Amyotrophic lateral sclerosis, Ataxia telangiectasia, Batten disease (also known as Spielmeyer-Vogt-Sjogren-Batten disease), Bovine spongiform encephalopathy (BSE), Canavan disease, Cockayne syndrome, Corticobasal degeneration, Creutzfeldt-Jakob disease, frontotemporal dementia, Gerstmann-Straussler-Scheinker syndrome, Huntington's disease, HTV-associated dementia, Kennedy's disease, Krabbe's disease, kuru, Lewy body dementia, Machado-Joseph disease (Spinocerebellar ataxia type 3), Multiple sclerosis, Multiple System Atrophy, Narcolepsy, Neuroborreliosis, Parkinson's disease, Pelizaeus-Merzbacher Disease, Pick's disease, Primary lateral sclerosis, Prion diseases, Refsum's disease, Sandhoff s disease, Schilder's disease, Subacute combined degeneration of spinal cord secondary to Pernicious Anaemia, Schizophrenia, Spinocerebellar ataxia (multiple types with varying characteristics), Spinal muscular atrophy, Steele-Richardson-Olszewski disease, Tabes dorsalis, diabetes (e.g., type I or type II), obesity, metabolic syndrome, a mitochondrial disease (e.g., dysfunction of mitochondria or aberrant mitochondrial function), fungal infection, transplant rejection, or a cardiovascular disease (e.g., congestive heart failure; arrhythmogenic syndromes (e.g., paroxysomal tachycardia, delayed after depolarizations, ventricular tachycardia, sudden tachycardia, exercise-induced arrhythmias, long QT syndromes, or bidirectional tachycardia); thromboembolic disorders (e.g., arterial cardiovascular thromboembolic disorders, venous cardiovascular thromboembolic disorders, or thromboembolic disorders in the chambers of the heart); atherosclerosis; restenosis; peripheral arterial disease; coronary bypass grafting surgery; carotid artery disease; arteritis; myocarditis; cardiovascular inflammation; vascular inflammation; coronary heart disease (CHD); unstable angina (UA); unstable refractory angina; stable angina (SA); chronic stable angina; acute coronary syndrome (ACS); myocardial infarction (first or recurrent); acute myocardial infarction (AMI); myocardial infarction; non-Q wave myocardial infarction; non-STE myocardial infarction; coronary artery disease; ischemic heart disease; cardiac ischemia; ischemia; ischemic sudden death; transient ischemic attack; stroke; peripheral occlusive arterial disease; venous thrombosis; deep vein thrombosis; thrombophlebitis; arterial embolism; coronary arterial thrombosis; cerebral arterial thrombosis, cerebral embolism; kidney embolism; pulmonary embolism; thrombosis (e.g., associated with prosthetic valves or other implants, indwelling catheters, stents, cardiopulmonary bypass, hemodialysis); thrombosis (e.g., associated with atherosclerosis, surgery, prolonged immobilization, arterial fibrillation, congenital thrombophilia, cancer, diabetes, hormones, or pregnancy); or cardiac arrhythmias (e.g., supraventricular arrhythmias, atrial arrhythmias, atrial flutter, or atrial fibrillation).

[0473] In an aspect is provided a method of treating a disease including administering an effective amount of one or more compositions or compounds as described herein. In an aspect is provided one or more compositions or compounds as described herein for use as a medicament (e.g., for treatment of a disease). In an aspect is provided one or more compositions or compounds as described herein for use in the treatment of a disease (e.g., including administering an effective amount of one or more compositions or compounds as described herein). In embodiments, the disease is cancer. In embodiments, the disease is an autoimmune disease. In embodiments, the disease is an inflammatory disease. In embodiments, the disease is a neurodegenerative disease. In embodiments, the disease is a metabolic disease. In embodiments, the disease is fungal infection. In embodiments, the disease is transplant rejection. In embodiments, the disease is a cardiovascular disease.

[0474] In embodiments, the disease is cancer (e.g., carcinomas, sarcomas, adenocarcinomas, lymphomas, leukemias, solid cancers, lymphoid cancers; cancer of the kidney, breast, lung, bladder, colon, ovarian, prostate, pancreas, stomach, brain, head and neck, skin, uterine, esophagus, liver; testicular cancer, glioma, hepatocarcinoma, lymphoma, including B-acute lymphoblastic lymphoma, non-Hodgkin's lymphomas (e.g., Burkitt's, Small Cell, and Large Cell lymphomas), Hodgkin's lymphoma, leukemia (including AML, ALL, and CML), multiple myeloma, and breast cancer (e.g., triple negative breast cancer)).

[0475] In embodiments, the disease is Acute Disseminated Encephalomyelitis (ADEM), Acute necrotizing hemorrhagic leukoencephalitis, Addison's disease, Agammaglobulinemia, Alopecia areata, Amyloidosis, Ankylosing spondylitis, Anti-GBM/Anti-TBM nephritis, Antiphospholipid syndrome (APS), Autoimmune angioedema, Autoimmune aplastic anemia, Autoimmune dysautonomia, Autoimmune hepatitis, Autoimmune hyperlipidemia, Autoimmune immunodeficiency, Autoimmune inner ear disease (AIED), Autoimmune myocarditis, Autoimmune oophoritis, Autoimmune pancreatitis, Autoimmune retinopathy, Autoimmune thrombocytopenic purpura (ATP), Autoimmune thyroid disease, Autoimmune urticaria, Axonal or neuronal neuropathies, Balo disease, Behcet's disease, Bullous pemphigoid, Cardiomyopathy, Castleman disease, Celiac disease, Chagas disease, Chronic fatigue syndrome, Chronic inflammatory demyelinating polyneuropathy (CIDP), Chronic recurrent multifocal ostomyelitis (CRMO), Churg-Strauss syndrome, Cicatricial pemphigoid/benign mucosal pemphigoid, Crohn's disease, Cogans syndrome, Cold agglutinin disease, Congenital heart block, Coxsackie myocarditis, CREST disease, Essential mixed cryoglobulinemia, Demyelinating neuropathies, Dermatitis herpetiformis, Dermatomyositis, Devic's disease (neuromyelitis optica), Discoid lupus, Dressler's syndrome, Endometriosis, Eosinophilic esophagitis, Eosinophilic fasciitis, Erythema nodosum, Experimental allergic encephalomyelitis, Evans syndrome, Fibromyalgia, Fibrosing alveolitis, Giant cell arteritis (temporal arteritis), Giant cell myocarditis, Glomerulonephritis, Goodpasture's syndrome, Granulomatosis with Polyangiitis (GPA) (formerly called Wegener's Granulomatosis), Graves' disease, Guillain-Barre syndrome, Hashimoto's encephalitis, Hashimoto's thyroiditis, Hemolytic anemia, Henoch-Schonlein purpura, Herpes gestationis, Hypogammaglobulinemia, Idiopathic thrombocytopenic purpura (ITP), IgA nephropathy, IgG4-related sclerosing disease, Immunoregulatory lipoproteins, Inclusion body myositis, Interstitial cystitis, Juvenile arthritis, Juvenile diabetes (Type 1 diabetes), Juvenile myositis, Kawasaki syndrome, Lambert-Eaton syndrome, Leukocytoclastic vasculitis, Lichen planus, Lichen sclerosus, Ligneous conjunctivitis, Linear IgA disease (LAD), Lupus (SLE), Lyme disease, chronic, Meniere's disease, Microscopic polyangiitis, Mixed connective tissue disease (MCTD), Mooren's ulcer, Mucha-Habermann disease, Multiple sclerosis, Myasthenia gravis, Myositis, Narcolepsy, Neuromyelitis optica (Devic's), Neutropenia, Ocular cicatricial pemphigoid, Optic neuritis, Palindromic rheumatism, PANDAS (Pediatric Autoimmune Neuropsychiatric Disorders Associated with Streptococcus), Paraneoplastic cerebellar degeneration, Paroxysmal nocturnal hemoglobinuria (PNH), Parry Romberg syndrome, Parsonnage-Turner syndrome, Pars planitis (peripheral uveitis), Pemphigus, Peripheral neuropathy, Perivenous encephalomyelitis, Pernicious anemia, POEMS syndrome, Polyarteritis nodosa, Type I, II, & III autoimmune polyglandular syndromes, Polymyalgia rheumatica, Polymyositis, Postmyocardial infarction syndrome, Postpericardiotomy syndrome, Progesterone dermatitis, Primary biliary cirrhosis, Primary sclerosing cholangitis, Psoriasis, Psoriatic arthritis, Idiopathic pulmonary fibrosis, Pyoderma gangrenosum, Pure red cell aplasia, Raynauds phenomenon, Reactive Arthritis, Reflex sympathetic dystrophy, Reiter's syndrome, Relapsing polychondritis, Restless legs syndrome, Retroperitoneal fibrosis, Rheumatic fever, Rheumatoid arthritis, Sarcoidosis, Schmidt syndrome, Scleritis, Scleroderma, Sjogren's syndrome, Sperm & testicular autoimmunity, Stiff person syndrome, Subacute bacterial endocarditis (SBE), Susac's syndrome, Sympathetic ophthalmia, Takayasu's arteritis, Temporal arteritis/Giant cell arteritis, Thrombocytopenic purpura (TTP), Tolosa-Hunt syndrome, Transverse myelitis, Type 1 diabetes, Ulcerative colitis, Undifferentiated connective tissue disease (UCTD), Uveitis, Vasculitis, Vesiculobullous dermatosis, Vitiligo, Wegener's granulomatosis (i.e., Granulomatosis with Polyangiitis (GPA), traumatic brain injury, arthritis, rheumatoid arthritis, psoriatic arthritis, juvenile idiopathic arthritis, multiple sclerosis, systemic lupus erythematosus (SLE), myasthenia gravis, juvenile onset diabetes, diabetes mellitus type 1, Guillain-Barre syndrome, Hashimoto's encephalitis, Hashimoto's thyroiditis, ankylosing spondylitis, psoriasis, vasculitis, glomerulonephritis, auto-immune thyroiditis, Behcet's disease, Crohn's disease, ulcerative colitis, bullous pemphigoid, sarcoidosis, ichthyosis, Graves ophthalmopathy, inflammatory bowel disease, Addison's disease, Vitiligo, asthma, allergic asthma, acne vulgaris, celiac disease, chronic prostatitis, inflammatory bowel disease, pelvic inflammatory disease, reperfusion injury, sarcoidosis, transplant rejection, interstitial cystitis, atherosclerosis, atopic dermatitis, Alexander's disease, Alper's disease, Alzheimer's disease, Amyotrophic lateral sclerosis, Ataxia telangiectasia, Batten disease (also known as Spielmeyer-Vogt-Sjogren-Batten disease), Bovine spongiform encephalopathy (BSE), Canavan disease, Cockayne syndrome, Corticobasal degeneration, Creutzfeldt-Jakob disease, frontotemporal dementia, Gerstmann-Straussler-Scheinker syndrome, Huntington's disease, HTV-associated dementia, Kennedy's disease, Krabbe's disease, kuru, Lewy body dementia, Machado-Joseph disease (Spinocerebellar ataxia type 3), Multiple sclerosis, Multiple System Atrophy, Narcolepsy, Neuroborreliosis, Parkinson's disease, Pelizaeus-Merzbacher Disease, Pick's disease, Primary lateral sclerosis, Prion diseases, Refsum's disease, Sandhoff s disease, Schilder's disease, Subacute combined degeneration of spinal cord secondary to Pernicious Anaemia, Schizophrenia, Spinocerebellar ataxia (multiple types with varying characteristics), Spinal muscular atrophy, Steele-Richardson-Olszewski disease, Tabes dorsalis, diabetes (e.g., type I or type II), obesity, metabolic syndrome, a mitochondrial disease (e.g., dysfunction of mitochondria or aberrant mitochondrial function), fungal infection, transplant rejection, or a cardiovascular disease (e.g., congestive heart failure; arrhythmogenic syndromes (e.g., paroxysomal tachycardia, delayed after depolarizations, ventricular tachycardia, sudden tachycardia, exercise-induced arrhythmias, long QT syndromes, or bidirectional tachycardia); thromboembolic disorders (e.g., arterial cardiovascular thromboembolic disorders, venous cardiovascular thromboembolic disorders, or thromboembolic disorders in the chambers of the heart); atherosclerosis; restenosis; peripheral arterial disease; coronary bypass grafting surgery; carotid artery disease; arteritis; myocarditis; cardiovascular inflammation; vascular inflammation; coronary heart disease (CHD); unstable angina (UA); unstable refractory angina; stable angina (SA); chronic stable angina; acute coronary syndrome (ACS); myocardial infarction (first or recurrent); acute myocardial infarction (AMI); myocardial infarction; non-Q wave myocardial infarction; non-STE myocardial infarction; coronary artery disease; ischemic heart disease; cardiac ischemia; ischemia; ischemic sudden death; transient ischemic attack; stroke; peripheral occlusive arterial disease; venous thrombosis; deep vein thrombosis; thrombophlebitis; arterial embolism; coronary arterial thrombosis; cerebral arterial thrombosis, cerebral embolism; kidney embolism; pulmonary embolism; thrombosis (e.g., associated with prosthetic valves or other implants, indwelling catheters, stents, cardiopulmonary bypass, hemodialysis); thrombosis (e.g., associated with atherosclerosis, surgery, prolonged immobilization, arterial fibrillation, congenital thrombophilia, cancer, diabetes, hormones, or pregnancy); or cardiac arrhythmias (e.g., supraventricular arrhythmias, atrial arrhythmias, atrial flutter, or atrial fibrillation). In embodiments, the disease is a polycystic disease. In embodiments, the disease is polycystic kidney disease. In embodiments, the disease is stenosis. In embodiments, the disease is restenosis. In embodiments, the disease is neointimal proliferation. In embodiments, the disease is neointimal hyperplasia.

[0476] In another aspect is provided a method of treating aging in a subject in need of such treatment, the method including administering one or more compositions or compounds as described herein, including embodiments (e.g., a claim, embodiment, example, table, figure, or claim) to the subject. The present disclosure provides a method of treating immunosenescence comprising administering to the subject a therapeutically effective amount of one or more disclosed compounds or compositions.

[0477] In another aspect is provided one or more compositions or compounds as described herein for use as a medicament. In embodiments, the medicament may be useful for treating aging in a subject in need of such treatment. In embodiments, the use may include administering one or more compositions or compounds as described herein, including embodiments (e.g., an aspect, embodiment, example, table, figure, or claim) to the subject.

[0478] In another aspect is provided one or more compositions or compounds disclosed herein for use in the treatment of aging in a subject in need of such treatment. In embodiments, the use may include administering one or more compositions or compounds as described herein, including embodiments (e.g., an aspect, embodiment, example, table, figure, or claim) to the subject.

[0479] In another aspect is provided a method of extending life span or inducing longevity in a subject in need of such treatment, the method including administering one or more compositions or compounds as described herein, including embodiments (e.g., a claim, embodiment, example, table, figure, or claim) to the subject.

[0480] In another aspect is provided one or more compositions or compounds as described herein for use as a medicament. In embodiments, the medicament may be useful for extending life span or inducing longevity in a subject in need of such treatment. In embodiments, the use may include administering one or more compositions or compounds as described herein, including embodiments (e.g., an aspect, embodiment, example, table, figure, or claim) to the subject.

[0481] In another aspect is provided one or more compositions or compounds for use in extending life span or inducing longevity in a subject in need of such treatment. In embodiments, the use may include administering one or more compositions or compounds as described herein, including embodiments (e.g., an aspect, embodiment, example, table, figure, or claim) to the subject.

[0482] In an aspect is provided a method of treating a polycystic disease in a subject in need of such treatment. The polycystic disease may be polycystic kidney disease. The method may include administering to the subject one or more compositions or compounds described herein. The method may include administering to the subject a therapeutically effective amount of one or more compositions or compounds described herein (e.g., an mTORC1 modulator (e.g., inhibitor) as described above).

[0483] In an aspect is provided one or more compositions or compounds as described herein for use as a medicament. In embodiments, the medicament is useful for treating a polycystic disease. The polycystic disease may be polycystic kidney disease. The use may include administering to the subject one or more compositions or compounds described herein. The use may include administering to the subject a therapeutically effective amount of one or more compositions or compounds described herein (e.g., an mTORC1 modulator (e.g., inhibitor) as described above).

[0484] In an aspect is provided one or more compositions or compounds as described herein for use in the treatment of a polycystic disease in a subject in need of such treatment. The polycystic disease may be polycystic kidney disease. The use may include administering to the subject one or more compositions or compounds described herein. The use may include administering to the subject a therapeutically effective amount of one or more compositions or compounds described herein (e.g., an mTORC1 modulator (e.g., inhibitor) as described above).

[0485] In an aspect is provided a method of treating stenosis in a subject in need of such treatment. The stenosis may be restenosis. The method may include administering to the subject one or more compositions or compounds described herein. In embodiments the one or more compositions or compounds are administered in a drug eluting stent. The method may include administering to the subject a therapeutically effective amount of one or more compositions or compounds described herein (e.g., an mTORC1 modulator (e.g., inhibitor) as described above).

[0486] In an aspect is provided one or more compositions or compounds as described herein for use as a medicament. In embodiments, the medicament is useful for treating stenosis. The stenosis may be restenosis. The use may include administering to the subject one or more compositions or compounds described herein. In embodiments the compound is administered in a drug eluting stent. The use may include administering to the subject a therapeutically effective amount of one or more compositions or compounds described herein (e.g., an mTORC1 modulator (e.g., inhibitor) as described above).

[0487] In an aspect is provided one or more compositions or compounds as described herein for use in the treatment of stenosis in a subject in need of such treatment. The stenosis may be restenosis. The use may include administering to the subject one or more compositions or compounds described herein. In embodiments the one or more compositions or compounds are administered in a drug eluting stent. The use may include administering to the subject a therapeutically effective amount of one or more compositions or compounds described herein (e.g., an mTORC1 modulator (e.g., inhibitor) as described above).

[0488] In embodiments, the disease is a disease described herein and the compound is a compound described herein and the composition is a composition described herein.

EXEMPLARY EMBODIMENTS

[0489] Some embodiments of the disclosure, the embodiments are of Embodiment I, represented below.

[0490] Embodiment I-1. A compound represented by Formula (I):

##STR00355##

[0491] or a pharmaceutically acceptable salt or tautomer thereof, wherein:

[0492] R.sup.16 is selected from R.sup.1, R.sup.2, H, (C.sub.1-C.sub.6)alkyl, —OR.sup.3, —SR.sup.3, ═O, —NR.sup.3C(O)OR.sup.3, —NR.sup.3C(O)N(R.sup.3).sub.2, —NR.sup.3S(O).sub.2OR.sup.3, —NR.sup.3S(O).sub.2N(R.sup.3).sub.2, —NR.sup.3S(O).sub.2R.sup.3, (C.sub.6-C.sub.10)aryl, and 5-7 membered heteroaryl, and

##STR00356##

wherein the aryl and heteroaryl is optionally substituted with one or more substituents each independently selected from alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, and hydroxyl;

[0493] R.sup.26 is selected from ═N—R.sup.1, ═N—R.sup.2, ═O, —OR.sup.3, and ═N—OR.sup.3;

[0494] R.sup.28 is selected from R.sup.1, R.sup.2, —OR.sup.3, —OC(O)O(C(R.sup.3).sub.2).sub.n, —OC(O)N(R.sup.3).sub.2, —OS(O).sub.2N(R.sub.3).sub.2, and —N(R.sub.3)S(O).sub.2OR.sub.3;

[0495] R.sup.32 is selected from ═N—R.sup.1, ═N—R.sup.2, H, ═O, —OR.sup.3, and ═N—OR.sup.3;

[0496] R.sup.40 is selected from R.sup.1, R.sup.2, —OR.sup.3, —SR.sup.3, —N.sub.3, —N(R.sup.3).sub.2, —NR.sup.3C(O)OR.sup.3, —NR.sup.3C(O)N(R.sup.3).sub.2, —NR.sup.3S(O).sub.2OR.sup.3, —NR.sup.3S(O).sub.2N(R.sup.3).sub.2, —NR.sup.3S(O).sub.2R.sup.3, —OP(O)(OR.sup.3).sub.2, —OP(O)(R.sup.3).sub.2, —NR.sup.3C(O)R.sup.3, —S(O)R.sup.3, —S(O).sub.2R.sup.3, —OS(O).sub.2NHC(O)R.sup.3,

##STR00357##

[0497] wherein the compound comprises one R.sup.1 or one R.sup.2;

[0498] R.sup.1 is -A-L.sup.1-B;

[0499] R.sup.2 is -A-C≡CH, -A-N.sub.3, -A-COOH, or -A-NHR.sup.3; and

[0500] wherein

[0501] A is absent or selected from,

[0502] —(C(R.sup.3).sub.2).sub.n—,

[0503] —O(C(R.sup.3).sub.2).sub.n—,

[0504] —NR.sup.3(C(R.sup.3).sub.2).sub.n—,

[0505] —O(C(R.sup.3).sub.2).sub.n—[O(C(R.sup.3).sub.2).sub.n].sub.o—O(C(R.sup.3).sub.2).sub.p—,

[0506] —C(O)(C(R.sup.3).sub.2).sub.n—,

[0507] —C(O)NR.sup.3—,

[0508] —NR.sup.3C(O)(C(R.sup.3).sub.2).sub.n—,

[0509] —NR.sup.3C(O)O(C(R.sup.3).sub.2).sub.n—,

[0510] —OC(O)NR.sup.3(C(R.sup.3).sub.2).sub.n—,

[0511] —NHSO.sub.2NH(C(R.sup.3).sub.2).sub.n—,

[0512] —OC(O)NHSO.sub.2NH(C(R.sup.3).sub.2).sub.n—,

[0513] —O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-,

[0514] —O(C(R.sup.3).sub.2).sub.n-heteroarylene-,

[0515] —OC(O)NH(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-,

[0516] —O—(C.sub.6-C.sub.10)arylene-,

[0517] —O-heteroarylene-,

[0518] -heteroarylene-(C.sub.6-C.sub.10)arylene-,

[0519] —O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-(C.sub.6-C.sub.10)arylene-,

[0520] —O(C(R.sup.3).sub.2).sub.n-heteroarylene-heteroarylene-,

[0521] —O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-(C(R.sup.3).sub.2).sub.n—,

[0522] —O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-O(C(R.sup.3).sub.2).sub.n—,

[0523] —O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-NR.sup.3(C(R.sup.3).sub.2).sub.n—,

[0524] —O(C(R.sup.3).sub.2).sub.n-heteroarylene-heterocyclylene-C(O)(C(R.sup.3).sub.2).sub.n—,

[0525] -heteroarylene-(C.sub.6-C.sub.10)arylene-(C.sub.6-C.sub.10)arylene-,

[0526] -heteroarylene-(C.sub.6-C.sub.10)arylene-heteroarylene-O(C(R.sup.3).sub.2).sub.n—,

[0527] -heteroarylene-(C.sub.6-C.sub.10)arylene-heteroarylene-(C(R.sup.3).sub.2).sub.n2—O(C(R.sup.3).sub.2).sub.n—,

[0528] —O(C(R.sup.3).sub.2).sub.n-heteroarylene-heteroarylene-NR.sup.3—(C.sub.6-C.sub.10)arylene-,

[0529] —O(C(R.sup.3).sub.2).sub.n-heteroarylene-heteroarylene-heterocyclylene-(C(R.sup.3).sub.2).sub.n—,

[0530] —O(C(R.sup.3).sub.2).sub.n-heteroarylene-heteroarylene-heterocyclylene-C(O)(C(R.sup.3).sub.2).sub.n—,

[0531] —O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-(C(R.sup.3).sub.2).sub.n—,

[0532] —O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-C(O)(C(R.sup.3).sub.2).sub.n—,

[0533] —O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-SO.sub.2(C(R.sup.3).sub.2).sub.n—,

[0534] -heteroarylene-(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-(C(R.sup.3).sub.2).sub.n—,

[0535] -heteroarylene-(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-C(O)(C(R.sup.3).sub.2).sub.n—,

[0536] -heteroarylene-(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-SO.sub.2(C(R.sup.3).sub.2).sub.n—, and

[0537] —O(C(R.sup.3).sub.2).sub.n-heteroarylene-heteroarylene-heterocyclylene-S(O).sub.2NR.sup.3—(C.sub.6-C.sub.10)arylene-, [0538] wherein heteroarylene is 5-12 membered and contains 1-4 heteroatoms selected from O, N, and S; heterocyclylene is 5-12 membered and contains 1-4 heteroatoms selected from O, N, and S; [0539] wherein the arylene, heteroarylene, and heterocyclylene are optionally substituted with one or more substituents each independently selected from alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, and hydroxyl;

[0540] L′ is selected from

##STR00358## ##STR00359## ##STR00360##

[0541] wherein the bond with variable position in the triazole is in the 4-position or 5-position, and wherein the A ring is phenylene or 5-8 membered heteroarylene;

[0542] B is selected from

##STR00361## ##STR00362## ##STR00363##

as drawn, is bound to L.sup.1; and wherein the heteroaryl, heterocyclyl, and arylene are optionally substituted with alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, or hydroxyl;

[0543] each R.sup.3 is independently H or (C.sub.1-C.sub.6)alkyl;

[0544] each R.sup.4 is independently H, (C.sub.1-C.sub.6)alkyl, halogen, 5-12 membered heteroaryl, 5-12 membered heterocyclyl, (C.sub.6-C.sub.10)aryl, wherein the heteroaryl, heterocyclyl, and aryl are optionally substituted with —N(R.sup.3).sub.2, —OR.sup.3, halogen, (C.sub.1-C.sub.6)alkyl, —(C.sub.1-C.sub.6)alkylene-heteroaryl, —(C.sub.1-C.sub.6)alkylene-CN, or —C(O)NR.sup.3-heteroaryl;

[0545] each Q is independently C(R.sup.3).sub.2 or O;

[0546] each Y is independently C(R.sup.3).sub.2 or a bond;

[0547] each Z is independently H or absent;

[0548] each n is independently a number from one to 12;

[0549] each o is independently a number from zero to 12;

[0550] each p is independently a number from zero to 12;

[0551] each q is independently a number from zero to 10; and

[0552] each r is independently 1, 2, 3, or 4;

[0553] provided that when R.sup.40 is R.sup.1, wherein R.sup.1 is -A-L.sup.1-B; L.sup.1 is

##STR00364##

then A is not —O(CH.sub.2).sub.2—O(CH.sub.2)—.

[0554] Embodiment I-2. A compound represented by Formula (Ia):

##STR00365##

[0555] or a pharmaceutically acceptable salt or tautomer thereof, wherein:

[0556] R.sup.16 is R.sup.1 or R.sup.2;

[0557] R.sup.26 is selected from ═O, —OR.sup.3, and ═N—OR.sup.3;

[0558] R.sup.28 is selected from —OR.sup.3, —OC(O)O(C(R.sup.3).sub.2).sub.n, —OC(O)N(R.sup.3).sub.2, —OS(O).sub.2N(R.sub.3).sub.2, and —N(R.sub.3)S(O).sub.2OR.sub.3;

[0559] R.sup.32 is selected from H, ═O, —OR.sup.3, and ═N—OR.sup.3;

[0560] R.sup.40 is selected from —OR.sup.3, —SR.sup.3, —N.sub.3, —N(R.sup.3).sub.2, —NR.sup.3C(O)OR.sup.3, —NR.sup.3C(O)N(R.sup.3).sub.2, —NR.sup.3S(O).sub.2OR.sup.3, —NR.sup.3S(O).sub.2N(R.sup.3).sub.2, —NR.sup.3S(O).sub.2R.sup.3, —OP(O)(OR.sup.3).sub.2, —OP(O)(R.sup.3).sub.2, —NR.sup.3C(O)R.sup.3, —S(O)R.sup.3, —S(O).sub.2R.sup.3, —OS(O).sub.2NHC(O)R.sup.3,

##STR00366##

[0561] wherein R.sup.1 is -A-L.sup.1-B;

[0562] R.sup.2 is -A-C≡CH, -A-N.sub.3, -A-COOH, or -A-NHR.sup.3;

[0563] wherein

[0564] A is absent or is selected from —(C(R.sup.3).sub.2).sub.n—, —O(C(R.sup.3).sub.2).sub.n—, —NR.sup.3(C(R.sup.3).sub.2).sub.n—, —O(C(R.sup.3).sub.2).sub.n—[O(C(R.sup.3).sub.2).sub.n].sub.o—O(C(R.sup.3).sub.2).sub.p—, —C(O)(C(R.sup.3).sub.2).sub.n—, —C(O)NR.sup.3—, —NR.sup.3C(O)(C(R.sup.3).sub.2).sub.n—, —NR.sup.3C(O)O(C(R.sup.3).sub.2).sub.n—, —OC(O)NR.sup.3(C(R.sup.3).sub.2).sub.n—, —NHSO.sub.2NH(C(R.sup.3).sub.2).sub.n—,

—OC(O)NHSO.sub.2NH(C(R.sup.3).sub.2).sub.n—,
—O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-,
—O(C(R.sup.3).sub.2).sub.n-heteroarylene-,
—OC(O)NH(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-,
—O—(C.sub.6-C.sub.10)arylene-,

—O-heteroarylene-,

[0565] -heteroarylene-(C.sub.6-C.sub.10)arylene-,
—O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-(C.sub.6-C.sub.10)arylene-,
—O(C(R.sup.3).sub.2).sub.n-heteroarylene-heteroarylene-,
—O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-(C(R.sup.3).sub.2).sub.n—,
—O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-O(C(R.sup.3).sub.2).sub.n—,
—O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-NR.sup.3(C(R.sup.3).sub.2).sub.n—,
—O(C(R.sup.3).sub.2).sub.n-heteroarylene-heterocyclylene-C(O)(C(R.sup.3).sub.2).sub.n—,
-heteroarylene-(C.sub.6-C.sub.10)arylene-(C.sub.6-C.sub.10)arylene-,
-heteroarylene-(C.sub.6-C.sub.10)arylene-heteroarylene-O(C(R.sup.3).sub.2).sub.n—,
-heteroarylene-(C.sub.6-C.sub.10)arylene-heteroarylene-(C(R.sup.3).sub.2).sub.n2—O(C(R.sup.3).sub.2).sub.n—,
—O(C(R.sup.3).sub.2).sub.n-heteroarylene-heteroarylene-NR.sup.3—(C.sub.6-C.sub.10)arylene-,
—O(C(R.sup.3).sub.2).sub.n-heteroarylene-heteroarylene-heterocyclylene-(C(R.sup.3).sub.2).sub.n—,
—O(C(R.sup.3).sub.2).sub.n-heteroarylene-heteroarylene-heterocyclylene-C(O)(C(R.sup.3).sub.2).sub.n—,
—O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-(C(R.sup.3).sub.2).sub.n—,
—O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-C(O)(C(R.sup.3).sub.2).sub.n—,
—O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-SO.sub.2(C(R.sup.3).sub.2).sub.n—,
-heteroarylene-(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-(C(R.sup.3).sub.2).sub.n—,
-heteroarylene-(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-C(O)(C(R.sup.3).sub.2).sub.n—,
-heteroarylene-(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-SO.sub.2(C(R.sup.3).sub.2).sub.n—, and
—O(C(R.sup.3).sub.2).sub.n-heteroarylene-heteroarylene-heterocyclylene-S(O).sub.2NR.sup.3—(C.sub.6-C.sub.10)arylene-, [0566] wherein heteroarylene is 5-12 membered and contains 1-4 heteroatoms selected from O, N, and S; heterocyclylene is 5-12 membered and contains 1-4 heteroatoms selected from O, N, and S; [0567] wherein the arylene, heteroarylene, and heterocyclylene are optionally substituted with one or more substituents each independently selected from alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, and hydroxyl;

[0568] L.sup.1 is selected from

##STR00367## ##STR00368## ##STR00369##

[0569] wherein the bond with variable position in the triazole is in the 4-position or 5-position, and wherein the A ring is phenylene or 5-8 membered heteroarylene;

[0570] B is selected from

##STR00370## ##STR00371##

as drawn, is bound to L.sup.1; and wherein the heteroaryl, heterocyclyl, and arylene are optionally substituted with alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, or hydroxyl;

[0571] each R.sup.3 is independently H or (C.sub.1-C.sub.6)alkyl;

[0572] each R.sup.4 is independently H, (C.sub.1-C.sub.6)alkyl, halogen, 5-12 membered heteroaryl, 5-12 membered heterocyclyl, (C.sub.6-C.sub.10)aryl, wherein the heteroaryl, heterocyclyl, and aryl are optionally substituted with —N(R.sup.3).sub.2, —OR.sup.3, halogen, (C.sub.1-C.sub.6)alkyl, —(C.sub.1-C.sub.6)alkylene-heteroaryl, —(C.sub.1-C.sub.6)alkylene-CN, or —C(O)NR.sup.3-heteroaryl;

[0573] each Q is independently C(R.sup.3).sub.2 or O;

[0574] each Y is independently C(R.sup.3).sub.2 or a bond;

[0575] each Z is independently H or absent;

[0576] each n is independently a number from one to 12;

[0577] each o is independently a number from zero to 12;

[0578] each p is independently a number from zero to 12;

[0579] each q is independently a number from zero to 10; and

[0580] each r is independently 1, 2, 3, or 4.

[0581] Embodiment I-3. A compound represented by Formula (Ib):

##STR00372##

[0582] or a pharmaceutically acceptable salt or tautomer thereof, wherein:

[0583] R.sup.16 is selected from H, (C.sub.1-C.sub.6)alkyl, —SR.sup.3, ═O, —NR.sup.3C(O)OR.sup.3, —NR.sup.3C(O)N(R.sup.3).sub.2, —NR.sup.3S(O).sub.2OR.sup.3, —NR.sup.3S(O).sub.2N(R.sup.3).sub.2, —NR.sup.3S(O).sub.2R.sup.3, (C.sub.6-C.sub.10)aryl, and 5-7 membered heteroaryl, and

##STR00373##

wherein the aryl and heteroaryl is optionally substituted with one or more substituents each independently selected from alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, and hydroxyl;

[0584] R.sup.26 is ═N—R.sup.1 or ═N—R.sup.2;

[0585] R.sup.28 is selected from —OR.sup.3, —OC(O)O(C(R.sup.3).sub.2).sub.n, —OC(O)N(R.sup.3).sub.2, —OS(O).sub.2N(R.sub.3).sub.2, and —N(R.sub.3)S(O).sub.2OR.sub.3;

[0586] R.sup.32 is selected from H, ═O, —OR.sup.3, and ═N—OR.sup.3;

[0587] R.sup.40 is selected from —OR.sup.3, —SR.sup.3, —N.sub.3, —N(R.sup.3).sub.2, —NR.sup.3C(O)OR.sup.3, —NR.sup.3C(O)N(R.sup.3).sub.2, —NR.sup.3S(O).sub.2OR.sup.3, —NR.sup.3S(O).sub.2N(R.sup.3).sub.2, —NR.sup.3S(O).sub.2R.sup.3, —OP(O)(OR.sup.3).sub.2, —OP(O)(R.sup.3).sub.2, —NR.sup.3C(O)R.sup.3, —S(O)R.sup.3, —S(O).sub.2R.sup.3, —OS(O).sub.2NHC(O)R.sup.3,

##STR00374##

[0588] wherein R.sup.1 is -A-L.sup.1-B;

[0589] R.sup.2 is A-C≡CH, -A-N.sub.3, -A-COOH, or -A-NHR.sup.3;

[0590] wherein

[0591] A is absent or is selected from —(C(R.sup.3).sub.2).sub.n—, —O(C(R.sup.3).sub.2).sub.n—, —NR.sup.3(C(R.sup.3).sub.2).sub.n—, —O(C(R.sup.3).sub.2).sub.n—[O(C(R.sup.3).sub.2).sub.n].sub.o—O(C(R.sup.3).sub.2).sub.p—, —C(O)(C(R.sup.3).sub.2).sub.n—, —C(O)NR.sup.3—, —NR.sup.3C(O)(C(R.sup.3).sub.2).sub.n—, —NR.sup.3C(O)O(C(R.sup.3).sub.2).sub.n—, —OC(O)NR.sup.3(C(R.sup.3).sub.2).sub.n—, —NHSO.sub.2NH(C(R.sup.3).sub.2).sub.n—,

—OC(O)NHSO.sub.2NH(C(R.sup.3).sub.2).sub.n—,
—O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-,
—O(C(R.sup.3).sub.2).sub.n-heteroarylene-,
—OC(O)NH(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-,
—O—(C.sub.6-C.sub.10)arylene-,

—O-heteroarylene-,

[0592] -heteroarylene-(C.sub.6-C.sub.10)arylene-,
—O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-(C.sub.6-C.sub.10)arylene-,
—O(C(R.sup.3).sub.2).sub.n-heteroarylene-heteroarylene-,
—O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-(C(R.sup.3).sub.2).sub.n—,
—O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-O(C(R.sup.3).sub.2).sub.n—,
—O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-NR.sup.3(C(R.sup.3).sub.2).sub.n—,
—O(C(R.sup.3).sub.2).sub.n-heteroarylene-heterocyclylene-C(O)(C(R.sup.3).sub.2).sub.n—,
-heteroarylene-(C.sub.6-C.sub.10)arylene-(C.sub.6-C.sub.10)arylene-,
-heteroarylene-(C.sub.6-C.sub.10)arylene-heteroarylene-(C(R.sup.3).sub.2).sub.n—,
-heteroarylene-(C.sub.6-C.sub.10)arylene-heteroarylene-(C(R.sup.3).sub.2).sub.n2—O(C(R.sup.3).sub.2).sub.n—,
—O(C(R.sup.3).sub.2).sub.n-heteroarylene-heteroarylene-NR.sup.3—(C.sub.6-C.sub.10)arylene-,
—O(C(R.sup.3).sub.2).sub.n-heteroarylene-heteroarylene-heterocyclylene-(C(R.sup.3).sub.2).sub.n—,
—O(C(R.sup.3).sub.2).sub.n-heteroarylene-heteroarylene-heterocyclylene-C(O)(C(R.sup.3).sub.2).sub.n—,
—O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-(C(R.sup.3).sub.2).sub.n—,
—O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-C(O)(C(R.sup.3).sub.2).sub.n—,
—O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-SO.sub.2(C(R.sup.3).sub.2).sub.n—,
-heteroarylene-(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-(C(R.sup.3).sub.2).sub.n—,
-heteroarylene-(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-C(O)(C(R.sup.3).sub.2).sub.n—,
-heteroarylene-(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-SO.sub.2(C(R.sup.3).sub.2).sub.n—, and
—O(C(R.sup.3).sub.2).sub.n-heteroarylene-heteroarylene-heterocyclylene-S(O).sub.2NR.sup.3—(C.sub.6-C.sub.10)arylene-, [0593] wherein heteroarylene is 5-12 membered and contains 1-4 heteroatoms selected from O, N, and S; heterocyclylene is 5-12 membered and contains 1-4 heteroatoms selected from O, N, and S; [0594] wherein the arylene, heteroarylene, and heterocyclylene are optionally substituted with one or more substituents each independently selected from alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, and hydroxyl;

[0595] L.sup.1 is selected from

##STR00375## ##STR00376##

[0596] wherein the bond with variable position in the triazole is in the 4-position or 5-position, and wherein the A ring is phenylene or 5-8 membered heteroarylene;

[0597] B is selected from

##STR00377## ##STR00378##

as drawn, is bound to L.sup.1; and wherein the heteroaryl, heterocyclyl, and arylene are optionally substituted with alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, or hydroxyl;

[0598] each R.sup.3 is independently H or (C.sub.1-C.sub.6)alkyl;

[0599] each R.sup.4 is independently H, (C.sub.1-C.sub.6)alkyl, halogen, 5-12 membered heteroaryl, 5-12 membered heterocyclyl, (C.sub.6-C.sub.10)aryl, wherein the heteroaryl, heterocyclyl, and aryl are optionally substituted with —N(R.sup.3).sub.2, —OR.sup.3, halogen, (C.sub.1-C.sub.6)alkyl, —(C.sub.1-C.sub.6)alkylene-heteroaryl, —(C.sub.1-C.sub.6)alkylene-CN, or —C(O)NR.sup.3-heteroaryl;

[0600] each Q is independently C(R.sup.3).sub.2 or O;

[0601] each Y is independently C(R.sup.3).sub.2 or a bond;

[0602] each Z is independently H or absent;

[0603] each n is independently a number from one to 12;

[0604] each o is independently a number from zero to 12;

[0605] each p is independently a number from zero to 12;

[0606] each q is independently a number from zero to 10; and

[0607] each r is independently 1, 2, 3, or 4.

[0608] Embodiment I-4. A compound represented by Formula (Ic):

##STR00379##

[0609] or a pharmaceutically acceptable salt or tautomer thereof, wherein:

[0610] R.sup.16 is selected from H, (C.sub.1-C.sub.6)alkyl, —OR.sup.3, —SR.sup.3, ═O, —NR.sup.3C(O)OR.sup.3, —NR.sup.3C(O)N(R.sup.3).sub.2, —NR.sup.3S(O).sub.2OR.sup.3, —NR.sup.3S(O).sub.2N(R.sup.3).sub.2, —NR.sup.3S(O).sub.2R.sup.3, (C.sub.6-C.sub.10)aryl, and 5-7 membered heteroaryl, and

##STR00380##

wherein the aryl and heteroaryl is optionally substituted with one or more substituents each independently selected from alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, and hydroxyl;

[0611] R.sup.26 is selected from ═O, —OR.sup.3, and ═N—OR.sup.3;

[0612] R.sup.28 is R.sup.1 or R.sup.2;

[0613] R.sup.32 is selected from H, ═O, —OR.sup.3, and ═N—OR.sup.3;

[0614] R.sup.40 is selected from —OR.sup.3, —SR.sup.3, —N.sub.3, —N(R.sup.3).sub.2, —NR.sup.3C(O)OR.sup.3, —NR.sup.3C(O)N(R.sup.3).sub.2, —NR.sup.3S(O).sub.2OR.sup.3, —NR.sup.3S(O).sub.2N(R.sup.3).sub.2, —NR.sup.3S(O).sub.2R.sup.3, —OP(O)(OR.sup.3).sub.2, —OP(O)(R.sup.3).sub.2, —NR.sup.3C(O)R.sup.3, —S(O)R.sup.3,

—S(O).sub.2R.sup.3, —OS(O).sub.2NHC(O)R.sup.3,

##STR00381##

[0615] wherein the compound comprises one R.sup.1 or one R.sup.2;

[0616] wherein R.sup.1 is -A-L.sup.1-B;

[0617] R.sup.2 is -A-C≡CH, -A-N.sub.3, -A-COOH, or -A-NHR.sup.3;

[0618] wherein

[0619] A is absent or is selected from —(C(R.sup.3).sub.2).sub.n—, —O(C(R.sup.3).sub.2).sub.n—, —NR.sup.3(C(R.sup.3).sub.2).sub.n—, —O(C(R.sup.3).sub.2).sub.n—[O(C(R.sup.3).sub.2).sub.n].sub.o—O(C(R.sup.3).sub.2).sub.p—, —C(O)(C(R.sup.3).sub.2).sub.n—, —C(O)NR.sup.3—, —NR.sup.3C(O)(C(R.sup.3).sub.2).sub.n—, —NR.sup.3C(O)O(C(R.sup.3).sub.2).sub.n—, —OC(O)NR.sup.3(C(R.sup.3).sub.2).sub.n—, —NHSO.sub.2NH(C(R.sup.3).sub.2).sub.n—,

—OC(O)NHSO.sub.2NH(C(R.sup.3).sub.2).sub.n—,
—O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-,
—O(C(R.sup.3).sub.2).sub.n-heteroarylene-,
—OC(O)NH(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-,
—O—(C.sub.6-C.sub.10)arylene-,

—O-heteroarylene-,

[0620] -heteroarylene-(C.sub.6-C.sub.10)arylene-,
—O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-(C.sub.6-C.sub.10)arylene-,
—O(C(R.sup.3).sub.2).sub.n-heteroarylene-heteroarylene-,
—O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-(C(R.sup.3).sub.2).sub.n—,
—O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-O(C(R.sup.3).sub.2).sub.n—,
—O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-NR.sup.3(C(R.sup.3).sub.2).sub.n—,
—O(C(R.sup.3).sub.2).sub.n-heteroarylene-heterocyclylene-C(O)(C(R.sup.3).sub.2).sub.n—,
-heteroarylene-(C.sub.6-C.sub.10)arylene-(C.sub.6-C.sub.10)arylene-,
-heteroarylene-(C.sub.6-C.sub.10)arylene-heteroarylene-O(C(R.sup.3).sub.2).sub.n—,
-heteroarylene-(C.sub.6-C.sub.10)arylene-heteroarylene-(C(R.sup.3).sub.2).sub.n2—O(C(R.sup.3).sub.2).sub.n—,
—O(C(R.sup.3).sub.2).sub.n-heteroarylene-heteroarylene-NR.sup.3—(C.sub.6-C.sub.10)arylene-,
—O(C(R.sup.3).sub.2).sub.n-heteroarylene-heteroarylene-heterocyclylene-(C(R.sup.3).sub.2).sub.n—,
—O(C(R.sup.3).sub.2).sub.n-heteroarylene-heteroarylene-heterocyclylene-C(O)(C(R.sup.3).sub.2).sub.n—,
—O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-(C(R.sup.3).sub.2).sub.n—,
—O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-C(O)(C(R.sup.3).sub.2).sub.n—,
—O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-SO.sub.2(C(R.sup.3).sub.2).sub.n—,
-heteroarylene-(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-(C(R.sup.3).sub.2).sub.n—,
-heteroarylene-(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-C(O)(C(R.sup.3).sub.2).sub.n—,
-heteroarylene-(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-SO.sub.2(C(R.sup.3).sub.2).sub.n—, and
—O(C(R.sup.3).sub.2).sub.n-heteroarylene-heteroarylene-heterocyclylene-S(O).sub.2NR.sup.3—(C.sub.6-C.sub.10)arylene-, [0621] wherein heteroarylene is 5-12 membered and contains 1-4 heteroatoms selected from O, N, and S; heterocyclylene is 5-12 membered and contains 1-4 heteroatoms selected from O, N, and S; [0622] wherein the arylene, heteroarylene, and heterocyclylene are optionally substituted with one or more substituents each independently selected from alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, and hydroxyl;

[0623] L.sup.1 is selected from

##STR00382## ##STR00383##

[0624] wherein the bond with variable position in the triazole is in the 4-position or 5-position, and wherein the A ring is phenylene or 5-8 membered heteroarylene;

[0625] B is selected from

##STR00384## ##STR00385##

as drawn, is bound to L.sup.1;
and wherein the heteroaryl, heterocyclyl, and arylene are optionally substituted with alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, or hydroxyl;

[0626] each R.sup.3 is independently H or (C.sub.1-C.sub.6)alkyl;

[0627] each R.sup.4 is independently H, (C.sub.1-C.sub.6)alkyl, halogen, 5-12 membered heteroaryl, 5-12 membered heterocyclyl, (C.sub.6-C.sub.10)aryl, wherein the heteroaryl, heterocyclyl, and aryl are optionally substituted with —N(R.sup.3).sub.2, —OR.sup.3, halogen, (C.sub.1-C.sub.6)alkyl, —(C.sub.1-C.sub.6)alkylene-heteroaryl, —(C.sub.1-C.sub.6)alkylene-CN, or —C(O)NR.sup.3-heteroaryl;

[0628] each Q is independently C(R.sup.3).sub.2 or O;

[0629] each Y is independently C(R.sup.3).sub.2 or a bond;

[0630] each Z is independently H or absent;

[0631] each n is independently a number from one to 12;

[0632] each o is independently a number from zero to 12;

[0633] each p is independently a number from zero to 12;

[0634] each q is independently a number from zero to 10; and

[0635] each r is independently 1, 2, 3, or 4.

[0636] Embodiment I-5. A compound represented by Formula (Id):

##STR00386##

[0637] or a pharmaceutically acceptable salt or tautomer thereof, wherein:

[0638] R.sup.16 is selected from H, (C.sub.1-C.sub.6)alkyl, —OR.sup.3, —SR.sup.3, ═O, —NR.sup.3C(O)OR.sup.3, —NR.sup.3C(O)N(R.sup.3).sub.2, —NR.sup.3S(O).sub.2OR.sup.3, —NR.sup.3S(O).sub.2N(R.sup.3).sub.2, —NR.sup.3S(O).sub.2R.sup.3, (C.sub.6-C.sub.10)aryl, and 5-7 membered heteroaryl, and

##STR00387##

wherein the aryl and heteroaryl is optionally substituted with one or more substituents each independently selected from alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, and hydroxyl;

[0639] R.sup.26 is selected from ═O, —OR.sup.3, and ═N—OR.sup.3;

[0640] R.sup.28 is selected from —OR.sup.3, —OC(O)O(C(R.sup.3).sub.2).sub.n, —OC(O)N(R.sup.3).sub.2, —OS(O).sub.2N(R.sub.3).sub.2, and —N(R.sub.3)S(O).sub.2OR.sub.3;

[0641] R.sup.32 is ═N—R.sup.1 or R.sup.2;

[0642] R.sup.40 is selected from —OR.sup.3, —SR.sup.3, —N.sub.3, —N(R.sup.3).sub.2, —NR.sup.3C(O)OR.sup.3, —NR.sup.3C(O)N(R.sup.3).sub.2, —NR.sup.3S(O).sub.2OR.sup.3, —NR.sup.3S(O).sub.2N(R.sup.3).sub.2, —NR.sup.3S(O).sub.2R.sup.3, —OP(O)(OR.sup.3).sub.2, —OP(O)(R.sup.3).sub.2, —NR.sup.3C(O)R.sup.3, —S(O)R.sup.3, —S(O).sub.2R.sup.3, —OS(O).sub.2NHC(O)R.sup.3,

##STR00388##

[0643] wherein R.sup.1 is -A-L.sup.1-B;

[0644] R.sup.2 is -A-C≡CH, -A-N.sub.3, -A-COOH, or -A-NHR.sup.3;

[0645] wherein

[0646] A is absent or is selected from —(C(R.sup.3).sub.2).sub.n—, —O(C(R.sup.3).sub.2).sub.n—, —NR.sup.3(C(R.sup.3).sub.2).sub.n—, —O(C(R.sup.3).sub.2).sub.n—[O(C(R.sup.3).sub.2).sub.n].sub.o—O(C(R.sup.3).sub.2).sub.p—, —C(O)(C(R.sup.3).sub.2).sub.n—, —C(O)NR.sup.3—, —NR.sup.3C(O)(C(R.sup.3).sub.2).sub.n—, —NR.sup.3C(O)O(C(R.sup.3).sub.2).sub.n—, —OC(O)NR.sup.3(C(R.sup.3).sub.2).sub.n—, —NHSO.sub.2NH(C(R.sup.3).sub.2).sub.n—,

—OC(O)NHSO.sub.2NH(C(R.sup.3).sub.2).sub.n—,
—O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-,
—O(C(R.sup.3).sub.2).sub.n-heteroarylene-,
—OC(O)NH(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-,
—O—(C.sub.6-C.sub.10)arylene-,

—O-heteroarylene-,

[0647] -heteroarylene-(C.sub.6-C.sub.10)arylene-,
—O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-(C.sub.6-C.sub.10)arylene-,
—O(C(R.sup.3).sub.2).sub.n-heteroarylene-heteroarylene-,
—O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-(C(R.sup.3).sub.2).sub.n—,
—O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-O(C(R.sup.3).sub.2).sub.n—,
—O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-NR.sup.3(C(R.sup.3).sub.2).sub.n—,
—O(C(R.sup.3).sub.2).sub.n-heteroarylene-heterocyclylene-C(O)(C(R.sup.3).sub.2).sub.n—,
-heteroarylene-(C.sub.6-C.sub.10)arylene-(C.sub.6-C.sub.10)arylene-,
-heteroarylene-(C.sub.6-C.sub.10)arylene-heteroarylene-O(C(R.sup.3).sub.2).sub.n—,
-heteroarylene-(C.sub.6-C.sub.10)arylene-heteroarylene-(C(R.sup.3).sub.2).sub.n2—O(C(R.sup.3).sub.2).sub.n—,
—O(C(R.sup.3).sub.2).sub.n-heteroarylene-heteroarylene-NR.sup.3—(C.sub.6-C.sub.10)arylene-,
—O(C(R.sup.3).sub.2).sub.n-heteroarylene-heteroarylene-heterocyclylene-(C(R.sup.3).sub.2).sub.n—,
—O(C(R.sup.3).sub.2).sub.n-heteroarylene-heteroarylene-heterocyclylene-C(O)(C(R.sup.3).sub.2).sub.n—,
—O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-(C(R.sup.3).sub.2).sub.n—,
—O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-C(O)(C(R.sup.3).sub.2).sub.n—,
—O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-SO.sub.2(C(R.sup.3).sub.2).sub.n—,
-heteroarylene-(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-(C(R.sup.3).sub.2).sub.n—,
-heteroarylene-(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-C(O)(C(R.sup.3).sub.2).sub.n—,
-heteroarylene-(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-SO.sub.2(C(R.sup.3).sub.2).sub.n—, and
—O(C(R.sup.3).sub.2).sub.n-heteroarylene-heteroarylene-heterocyclylene-S(O).sub.2NR.sup.3—(C.sub.6-C.sub.10)arylene-, [0648] wherein heteroarylene is 5-12 membered and contains 1-4 heteroatoms selected from O, N, and S; heterocyclylene is 5-12 membered and contains 1-4 heteroatoms selected from O, N, and S; [0649] wherein the arylene, heteroarylene, and heterocyclylene are optionally substituted with one or more substituents each independently selected from alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, and hydroxyl;

[0650] L.sup.1 is selected from

##STR00389## ##STR00390##

[0651] wherein the bond with variable position in the triazole is in the 4-position or 5-position, and wherein the A ring is phenylene or 5-8 membered heteroarylene;

[0652] B is selected from

##STR00391## ##STR00392##

as drawn, is bound to L.sup.1; and wherein the heteroaryl, heterocyclyl, and arylene are optionally substituted with alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, or hydroxyl;

[0653] each R.sup.3 is independently H or (C.sub.1-C.sub.6)alkyl;

[0654] each R.sup.4 is independently H, (C.sub.1-C.sub.6)alkyl, halogen, 5-12 membered heteroaryl, 5-12 membered heterocyclyl, (C.sub.6-C.sub.10)aryl, wherein the heteroaryl, heterocyclyl, and aryl are optionally substituted with —N(R.sup.3).sub.2, —OR.sup.3, halogen, (C.sub.1-C.sub.6)alkyl, —(C.sub.1-C.sub.6)alkylene-heteroaryl, —(C.sub.1-C.sub.6)alkylene-CN, or —C(O)NR.sup.3-heteroaryl;

[0655] each Q is independently C(R.sup.3).sub.2 or O;

[0656] each Y is independently C(R.sup.3).sub.2 or a bond;

[0657] each Z is independently H or absent;

[0658] each n is independently a number from one to 12;

[0659] each o is independently a number from zero to 12;

[0660] each p is independently a number from zero to 12;

[0661] each q is independently a number from zero to 10; and

[0662] each r is independently 1, 2, 3, or 4.

[0663] Embodiment I-6. A compound represented by Formula (Ie):

##STR00393##

[0664] or a pharmaceutically acceptable salt or tautomer thereof, wherein:

[0665] R.sup.16 is selected from H, (C.sub.1-C.sub.6)alkyl, —OR.sup.3, —SR.sup.3, ═O, —NR.sup.3C(O)OR.sup.3, —NR.sup.3C(O)N(R.sup.3).sub.2, —NR.sup.3S(O).sub.2OR.sup.3, —NR.sup.3S(O).sub.2N(R.sup.3).sub.2, —NR.sup.3S(O).sub.2R.sup.3, (C.sub.6-C.sub.10)aryl, and 5-7 membered heteroaryl, and

##STR00394##

wherein the aryl and heteroaryl is optionally substituted with one or more substituents each independently selected from alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, and hydroxyl;

[0666] R.sup.26 is selected from ═O, —OR.sup.3, and ═N—OR.sup.3;

[0667] R.sup.28 is selected from —OR.sup.3, —OC(O)O(C(R.sup.3).sub.2).sub.n, —OC(O)N(R.sup.3).sub.2, —OS(O).sub.2N(R.sub.3).sub.2, and —N(R.sub.3)S(O).sub.2OR.sub.3;

[0668] R.sup.32 is selected from H, ═O, —OR.sup.3, and ═N—OR.sup.3;

[0669] R.sup.40 is R.sup.1 or R.sup.2;

[0670] wherein R.sup.1 is -A-L.sup.1-B;

[0671] R.sup.2 is A-C≡CH, -A-N.sub.3, -A-COOH, or -A-NHR.sup.3;

[0672] wherein

[0673] A is absent or is selected from —(C(R.sup.3).sub.2).sub.n—, —O(C(R.sup.3).sub.2).sub.n—, —NR.sup.3(C(R.sup.3).sub.2).sub.n—, —O(C(R.sup.3).sub.2).sub.n—[O(C(R.sup.3).sub.2).sub.n].sub.o—O(C(R.sup.3).sub.2).sub.p—, —C(O)(C(R.sup.3).sub.2).sub.n—, —C(O)NR.sup.3—, —NR.sup.3C(O)(C(R.sup.3).sub.2).sub.n—, —NR.sup.3C(O)O(C(R.sup.3).sub.2).sub.n—, —OC(O)NR.sup.3(C(R.sup.3).sub.2).sub.n—, —NHSO.sub.2NH(C(R.sup.3).sub.2).sub.n—,

—OC(O)NHSO.sub.2NH(C(R.sup.3).sub.2).sub.n—,
—O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-,
—O(C(R.sup.3).sub.2).sub.n-heteroarylene-,
—OC(O)NH(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-,
—O—(C.sub.6-C.sub.10)arylene-,

—O-heteroarylene-,

[0674] -heteroarylene-(C.sub.6-C.sub.10)arylene-,
—O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-(C.sub.6-C.sub.10)arylene-,
—O(C(R.sup.3).sub.2).sub.n-heteroarylene-heteroarylene-,
—O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-(C(R.sup.3).sub.2).sub.n—,
—O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-O(C(R.sup.3).sub.2).sub.n—,
—O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-NR.sup.3(C(R.sup.3).sub.2).sub.n—,
—O(C(R.sup.3).sub.2).sub.n-heteroarylene-heterocyclylene-C(O)(C(R.sup.3).sub.2).sub.n—,
-heteroarylene-(C.sub.6-C.sub.10)arylene-(C.sub.6-C.sub.10)arylene-,
-heteroarylene-(C.sub.6-C.sub.10)arylene-heteroarylene-O(C(R.sup.3).sub.2).sub.n—,
-heteroarylene-(C.sub.6-C.sub.10)arylene-heteroarylene-(C(R.sup.3).sub.2).sub.n2—O(C(R.sup.3).sup.2).sub.n—,
—O(C(R.sup.3).sub.2).sub.n-heteroarylene-heteroarylene-NR.sup.3—(C.sub.6-C.sub.10)arylene-,
—O(C(R.sup.3).sub.2).sub.n-heteroarylene-heteroarylene-heterocyclylene-(C(R.sup.3).sub.2).sub.n—,
—O(C(R.sup.3).sub.2).sub.n-heteroarylene-heteroarylene-heterocyclylene-C(O)(C(R.sup.3).sub.2).sub.n—,
—O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-(C(R.sup.3).sub.2).sub.n—,
—O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-C(O)(C(R.sup.3).sub.2).sub.n—,
—O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-SO.sub.2(C(R.sup.3).sub.2).sub.n—,
-heteroarylene-(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-(C(R.sup.3).sub.2).sub.n—,
-heteroarylene-(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-C(O)(C(R.sup.3).sub.2).sub.n—,
-heteroarylene-(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-SO.sub.2(C(R.sup.3).sub.2).sub.n—, and
—O(C(R.sup.3).sub.2).sub.n-heteroarylene-heteroarylene-heterocyclylene-S(O).sub.2NR.sup.3—(C.sub.6-C.sub.10)arylene-, [0675] wherein heteroarylene is 5-12 membered and contains 1-4 heteroatoms selected from O, N, and S; heterocyclylene is 5-12 membered and contains 1-4 heteroatoms selected from O, N, and S; [0676] wherein the arylene, heteroarylene, and heterocyclylene are optionally substituted with one or more substituents each independently selected from alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, and hydroxyl;

[0677] L.sup.1 is selected from

##STR00395## ##STR00396##

[0678] wherein the bond with variable position in the triazole is in the 4-position or 5-position, and wherein the A ring is phenylene or 5-8 membered heteroarylene;

[0679] B is selected from

##STR00397## ##STR00398##

as drawn, is bound to L.sup.1; and wherein the heteroaryl, heterocyclyl, and arylene are optionally substituted with alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, or hydroxyl;

[0680] each R.sup.3 is independently H or (C.sub.1-C.sub.6)alkyl;

[0681] each R.sup.4 is independently H, (C.sub.1-C.sub.6)alkyl, halogen, 5-12 membered heteroaryl, 5-12 membered heterocyclyl, (C.sub.6-C.sub.10)aryl, wherein the heteroaryl, heterocyclyl, and aryl are optionally substituted with —N(R.sup.3).sub.2, —OR.sup.3, halogen, (C.sub.1-C.sub.6)alkyl, —(C.sub.1-C.sub.6)alkylene-heteroaryl, —(C.sub.1-C.sub.6)alkylene-CN, or —C(O)NR.sup.3-heteroaryl;

[0682] each Q is independently C(R.sup.3).sub.2 or O;

[0683] each Y is independently C(R.sup.3).sub.2 or a bond;

[0684] each Z is independently H or absent;

[0685] each n is independently a number from one to 12;

[0686] each o is independently a number from zero to 12;

[0687] each p is independently a number from zero to 12;

[0688] each q is independently a number from zero to 10; and

[0689] each r is independently 1, 2, 3, or 4;

[0690] provided that when R.sup.40 is R.sup.1, wherein R.sup.1 is -A-L.sup.1-B; L.sup.1 is

##STR00399##

B is

[0691] ##STR00400##

and B.SUP.1 .is

[0692] ##STR00401##

then A is not —O(CH.sub.2).sub.2—O(CH.sub.2)—.

[0693] Embodiment I-7. The compound of any one of Embodiments I-1 to I-6, wherein the compound comprises R.

[0694] Embodiment I-8. The compound of any one of Embodiments I-1 to I-6, wherein the compound comprises R.sup.2.

[0695] Embodiment I-9. The compound of Embodiment I-8, wherein the compound comprises R.sup.2 is -A-C≡CH.

[0696] Embodiment I-10. The compound of Embodiment I-8, wherein the compound comprises R.sup.2 is -A-N.sub.3.

[0697] Embodiment I-11. The compound of Embodiment I-8, wherein the compound comprises R.sup.2 is -A-COOH.

[0698] Embodiment I-12. The compound of Embodiment I-8, wherein the compound comprises R.sup.2 is -A-NHR.sup.3.

[0699] Embodiment I-13. The compound of any one of Embodiments I-1 to I-12, wherein A is —O(C(R.sup.3).sub.2).sub.n—.

[0700] Embodiment I-14. The compound of any one of Embodiments I-1 to I-12, wherein A is —O(C(R.sup.3).sub.2).sub.n—[O(C(R.sup.3).sub.2).sub.n].sub.o—O(C(R.sup.3).sub.2).sub.p—.

[0701] Embodiment I-15. The compound of any one of Embodiments I-1 to I-12, wherein A is —O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-(C(R.sup.3).sub.2).sub.n—.

[0702] Embodiment I-16. The compound of any one of Embodiments I-1 to I-12, wherein A is -heteroarylene-(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-(C(R.sup.3).sub.2).sub.n—, -heteroarylene-(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-C(O)(C(R.sup.3).sub.2).sub.n—, -heteroarylene-(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-SO.sub.2(C(R.sup.3).sub.2).sub.n—, or —O(C(R.sup.3).sub.2).sub.n-heteroarylene-heteroarylene-heterocyclylene-S(O).sub.2NR.sup.3—(C.sub.6-C.sub.10)arylene-.

[0703] Embodiment I-17. The compound of any one of Embodiments I-1 to I-12, wherein A is —O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-(C(R.sup.3).sub.2).sub.n—, —O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-C(O)(C(R.sup.3).sub.2).sub.n—, or —O(C(R.sup.3).sub.2).sub.n—(C.sub.6-C.sub.10)arylene-heteroarylene-heterocyclylene-SO.sub.2(C(R.sup.3).sub.2).sub.n—.

[0704] Embodiment I-18. The compound of any one of Embodiments I-1 to I-12, wherein A is —O(C(R.sup.3).sub.2).sub.n-heteroarylene-heteroarylene-NR.sup.3—(C.sub.6-C.sub.10)arylene-, —O(C(R.sup.3).sub.2).sub.n-heteroarylene-heteroarylene-heterocyclylene-(C(R.sup.3).sub.2).sub.n—, or —O(C(R.sup.3).sub.2).sub.n-heteroarylene-heteroarylene-heterocyclylene-C(O)(C(R.sup.3).sub.2).sub.n—.

[0705] Embodiment I-19. The compound of any one of Embodiments I-1 to I-12, wherein A is -heteroarylene-(C.sub.6-C.sub.10)arylene-(C.sub.6-C.sub.10)arylene-, -heteroarylene-(C.sub.6-C.sub.10)arylene-heteroarylene-O(C(R.sup.3).sub.2).sub.n—, or -heteroarylene-(C.sub.6-C.sub.10)arylene-heteroarylene-(C(R.sup.3).sub.2).sub.n2—O(C(R.sup.3).sub.2).sub.n—.

[0706] Embodiment I-20. The compound of any one of Embodiments I-1 to I-7 and I-13 to I-19, wherein L.sup.1 is

##STR00402##

[0707] Embodiment I-21. The compound of any one of Embodiments I-1 to I-7 and I-13 to I-19, wherein L.sup.1 is

##STR00403##

[0708] Embodiment I-22. The compound of any one of Embodiments I-1 to I-7 and I-13 to I-19, wherein L.sup.1 is

##STR00404##

[0709] Embodiment I-23. The compound of any one of Embodiments I-1 to I-7 and I-13 to I-19, wherein L.sup.1 is

##STR00405##

[0710] Embodiment I-24. The compound of any one of Embodiments I-1 to I-7 and I-13 to I-19, wherein L.sup.1 is

##STR00406##

[0711] Embodiment I-25. The compound of any one of Embodiments I-1 to I-7 and I-13 to I-19, wherein L.sup.1 is

##STR00407##

[0712] Embodiment I-26. The compound of any one of Embodiments I-1 to I-7 and I-13 to I-19, wherein L.sup.1 is

##STR00408##

[0713] Embodiment I-27. The compound of any one of Embodiments I-1 to I-7 and I-13 to I-19, wherein L.sup.1 is

##STR00409##

[0714] Embodiment I-28. The compound of any one of Embodiments I-1 to I-7 and I-13 to I-27, wherein B is

##STR00410##

[0715] Embodiment I-29. The compound of any one of Embodiments I-1 to I-7 and I-13 to I-27, wherein B is

##STR00411##

[0716] Embodiment I-30. The compound of any one of Embodiments I-1 to I-7 and I-13 to I-29, wherein B.sup.1 is

##STR00412##

[0717] Embodiment I-31. The compound of any one of Embodiments I-1 to I-7 and I-13 to I-29, wherein B.sup.1 is

##STR00413##

[0718] Embodiment I-32. The compound of any one of Embodiments I-1 to I-7 and I-13 to I-31, wherein R.sup.4 is 5-12 membered heteroaryl, optionally substituted with —N(R.sup.3).sub.2, —OR.sup.3, halogen, (C.sub.1-C.sub.6)alkyl, —(C.sub.1-C.sub.6)alkylene-heteroaryl, —(C.sub.1-C.sub.6)alkylene-CN, or —C(O)NR.sup.3-heteroaryl.

[0719] Embodiment I-32A. A compound selected from the group consisting of:

TABLE-US-00003 Structure [00414]embedded image [00415]embedded image [00416]embedded image [00417]embedded image [00418]embedded image [00419]embedded image [00420]embedded image [00421]embedded image [00422]embedded image [00423]embedded image [00424]embedded image [00425]embedded image [00426]embedded image [00427]embedded image [00428]embedded image [00429]embedded image [00430]embedded image [00431]embedded image [00432]embedded image [00433]embedded image [00434]embedded image [00435]embedded image [00436]embedded image [00437]embedded image [00438]embedded image [00439]embedded image [00440]embedded image [00441]embedded image [00442]embedded image [00443]embedded image [00444]embedded image [00445]embedded image [00446]embedded image [00447]embedded image [00448]embedded image [00449]embedded image [00450]embedded image [00451]embedded image [00452]embedded image [00453]embedded image [00454]embedded image [00455]embedded image [00456]embedded image [00457]embedded image [00458]embedded image [00459]embedded image [00460]embedded image [00461]embedded image [00462]embedded image [00463]embedded image [00464]embedded image [00465]embedded image [00466]embedded image [00467]embedded image [00468]embedded image [00469]embedded image [00470]embedded image [00471]embedded image [00472]embedded image [00473]embedded image
or a pharmaceutically acceptable salt or isomer thereof.

[0720] Embodiment I-33. A pharmaceutical composition comprising a compound of any one of Embodiments I-1 to I-32, or a pharmaceutically acceptable salt thereof, and at least one of a pharmaceutically acceptable carrier, diluent, or excipient.

[0721] Embodiment I-34. A method of treating a disease or disorder mediated by mTOR comprising administering to the subject suffering from or susceptible to developing a disease or disorder mediated by mTOR a therapeutically effective amount of one or more compounds of any one of Embodiments I-1 to I-32, or a pharmaceutically acceptable salt thereof.

[0722] Embodiment I-35. A method of preventing a disease or disorder mediated by mTOR comprising administering to the subject suffering from or susceptible to developing a disease or disorder mediated by mTOR a therapeutically effective amount of one or more compounds of any one of Embodiments I-1 to I-32, or a pharmaceutically acceptable salt thereof.

[0723] Embodiment I-36. A method of reducing the risk of a disease or disorder mediated by mTOR comprising administering to the subject suffering from or susceptible to developing a disease or disorder mediated by mTOR a therapeutically effective amount of one or more compounds of any one of Embodiments I-1 to I-32, or a pharmaceutically acceptable salt thereof.

[0724] Embodiment I-37. The method of any one of Embodiments I-34 to I-36, wherein the disease is cancer or an immune-mediated disease.

[0725] Embodiment I-38. The method of Embodiment I-37, wherein the cancer is selected from brain and neurovascular tumors, head and neck cancers, breast cancer, lung cancer, mesothelioma, lymphoid cancer, stomach cancer, kidney cancer, renal carcinoma, liver cancer, ovarian cancer, ovary endometriosis, testicular cancer, gastrointestinal cancer, prostate cancer, glioblastoma, skin cancer, melanoma, neuro cancers, spleen cancers, pancreatic cancers, blood proliferative disorders, lymphoma, leukemia, endometrial cancer, cervical cancer, vulva cancer, prostate cancer, penile cancer, bone cancers, muscle cancers, soft tissue cancers, intestinal or rectal cancer, anal cancer, bladder cancer, bile duct cancer, ocular cancer, gastrointestinal stromal tumors, and neuro-endocrine tumors.

[0726] Embodiment I-39. The method of Embodiment I-37, wherein the immune-mediated disease is selected from resistance by transplantation of heart, kidney, liver, medulla ossium, skin, cornea, lung, pancreas, intestinum tenue, limb, muscle, nerves, duodenum, small-bowel, or pancreatic-islet-cell; graft-versus-host diseases brought about by medulla ossium transplantation; rheumatoid arthritis, systemic lupus erythematosus, Hashimoto's thyroiditis, multiple sclerosis, myasthenia gravis, type I diabetes, uveitis, allergic encephalomyelitis, and glomerulonephritis.

[0727] Embodiment I-40. A method of treating cancer comprising administering to the subject a therapeutically effective amount of one or more compounds of any one of Embodiments I-1 to I-32, or a pharmaceutically acceptable salt thereof.

[0728] Embodiment I-41. The method of Embodiment I-40, wherein the cancer is selected from brain and neurovascular tumors, head and neck cancers, breast cancer, lung cancer, mesothelioma, lymphoid cancer, stomach cancer, kidney cancer, renal carcinoma, liver cancer, ovarian cancer, ovary endometriosis, testicular cancer, gastrointestinal cancer, prostate cancer, glioblastoma, skin cancer, melanoma, neuro cancers, spleen cancers, pancreatic cancers, blood proliferative disorders, lymphoma, leukemia, endometrial cancer, cervical cancer, vulva cancer, prostate cancer, penile cancer, bone cancers, muscle cancers, soft tissue cancers, intestinal or rectal cancer, anal cancer, bladder cancer, bile duct cancer, ocular cancer, gastrointestinal stromal tumors, and neuro-endocrine tumors.

[0729] Embodiment I-42. A method of treating an immune-mediated disease comprising administering to the subject a therapeutically effective amount of one or more compounds of any one of Embodiments I-1 to I-32, or a pharmaceutically acceptable salt thereof.

[0730] Embodiment I-43. The method of Embodiment I-42, wherein the immune-mediated disease is selected from resistance by transplantation of heart, kidney, liver, medulla ossium, skin, cornea, lung, pancreas, intestinum tenue, limb, muscle, nerves, duodenum, small-bowel, or pancreatic-islet-cell; graft-versus-host diseases brought about by medulla ossium transplantation; rheumatoid arthritis, systemic lupus erythematosus, Hashimoto's thyroiditis, multiple sclerosis, myasthenia gravis, type I diabetes, uveitis, allergic encephalomyelitis, and glomerulonephritis.

[0731] Embodiment I-44. A method of treating an age related condition comprising administering to the subject a therapeutically effective amount of one or more compounds of any one of Embodiments I-1 to I-32, or a pharmaceutically acceptable salt thereof.

[0732] Embodiment I-45. The method of Embodiment I-44, wherein the age related condition is selected from sarcopenia, skin atrophy, muscle wasting, brain atrophy, atherosclerosis, arteriosclerosis, pulmonary emphysema, osteoporosis, osteoarthritis, high blood pressure, erectile dysfunction, dementia, Huntington's disease, Alzheimer's disease, cataracts, age-related macular degeneration, prostate cancer, stroke, diminished life expectancy, impaired kidney function, and age-related hearing loss, aging-related mobility disability (e.g., frailty), cognitive decline, age-related dementia, memory impairment, tendon stiffness, heart dysfunction such as cardiac hypertrophy and systolic and diastolic dysfunction, immunosenescence, cancer, obesity, and diabetes.

[0733] Embodiment I-46. A compound of any one of Embodiments I-1 to I-32, or a pharmaceutically acceptable salt thereof, for use in treating, preventing, or reducing the risk of a disease or condition mediated by mTOR.

[0734] Embodiment I-47. Use of a compound of any of Embodiments I-1 to I-32, or a pharmaceutically acceptable salt thereof, in the manufacture of a medicament for treating, preventing, or reducing the risk of a disease or disorder mediated by mTOR.

[0735] Embodiment I-48. A compound of any one of Embodiments I-1 to I-32, or a pharmaceutically acceptable salt thereof, for use in treating cancer.

[0736] Embodiment I-49. Use of a compound of any one of Embodiments I-1 to I-32, or a pharmaceutically acceptable salt thereof, in the manufacture of a medicament for treating cancer.

[0737] Embodiment I-50. A compound of any one of Embodiments I-1 to I-32, or a pharmaceutically acceptable salt thereof, for use in treating an immune-mediated disease.

[0738] Embodiment I-51. Use of a compound of any one of Embodiments I-1 to I-32, or a pharmaceutically acceptable salt thereof, in the manufacture of a medicament for treating an immune-mediated disease.

[0739] Embodiment I-52. A compound of any one of Embodiments I-1 to I-32, or a pharmaceutically acceptable salt thereof, for use in treating an age related condition.

[0740] Embodiment I-53. Use of a compound of any one of Embodiments I-1 to I-32, or a pharmaceutically acceptable salt thereof, in the manufacture of a medicament for treating an age related condition.

EXAMPLES

[0741] The disclosure is further illustrated by the following examples and synthesis examples, which are not to be construed as limiting this disclosure in scope or spirit to the specific procedures herein described. It is to be understood that the examples are provided to illustrate certain embodiments and that no limitation to the scope of the disclosure is intended thereby. It is to be further understood that resort may be had to various other embodiments, modifications, and equivalents thereof which may suggest themselves to those skilled in the art without departing from the spirit of the present disclosure and/or scope of the appended claims.

[0742] Definitions used in the following examples and elsewhere herein are: [0743] CH.sub.2Cl.sub.2, DCM Methylene chloride, Dichloromethane [0744] CH.sub.3CN, MeCN Acetonitrile [0745] DIPEA Diisopropylethyl amine [0746] DMA Dimethylacetamide [0747] DME Dimethoxyethane [0748] DMF N,N-Dimethylformamide [0749] EDCI 1-Ethyl-3-(3-dimethylaminopropyl)carbodiimide [0750] EtOAc Ethyl acetate [0751] h hour [0752] H.sub.2O Water [0753] HCl Hydrochloric acid [0754] HOBt Hydroxybenzotriazole [0755] HPLC High-performance liquid chromatography [0756] LCMS Liquid chromatography-mass spectrometry [0757] MeOH Methanol [0758] MTBE Methyl tert-butyl ether [0759] Na.sub.2SO.sub.4 Sodium sulfate [0760] PEG Polyethylene glycol [0761] TBDMS tert-butyldimethylsilyl [0762] TFA Trifluoroacetic acid [0763] THF Tetrahydrofuran [0764] TMS Tetramethyl silane

General Assembly Approaches for Bifunctional Ranalogs

[0765] With reference to the schemes below, rapamycin is Formula II,

##STR00474##

where R.sup.16 is —OCH.sub.3; R.sup.26 is ═O; R.sup.28 is —OH; R.sup.32 is ═O; and R.sup.40 is —OH. A “rapalog” may refer to an analog or derivative of rapamycin. For example, with reference to the schemes below, a rapalog can be rapamycin that is substituted at any position, such as R.sup.16, R.sup.26, R.sup.28, R.sup.32, or R.sup.40. An active site inhibitor (AS inhibitor) is active site mTOR inhibitor. In certain embodiments, AS inhibitor is depicted by B, in Formula I or Formula I-X.

Assembly of Series 1 Bifunctional Rapalogs

[0766] An assembly approach to Series 1 bifunctional rapalogs is shown in Scheme 1 below. For these types of bifunctional rapalogs, Linker Type A may include variations where q=0 to 30 or 0 to 10, such as q=1 to 7. An alkyne moiety can be attached to the rapalog at R.sup.40, R.sup.16, R.sup.28, R.sup.32, or R.sup.26 positions (Formula I or I-X). The alkyne moiety can be attached via a variety of linkage fragments including variations found in Table 1 in the Examples Section. A Type 1 mTOR active site inhibitor can attach to the linker via a primary or secondary amine, and may include variations in Table 2 in the Examples Section. This assembly sequence starts with reaction of the linker Type A with the amino terminus of an active site inhibitor, such as those in Table 2, to provide an intermediate A1. Then, the intermediate is coupled to an alkyne containing rapalog, such as those from Table 1, via 3+2 cycloadditions to provide the Series 1 bifunctional rapalogs.

##STR00475##

TABLE-US-00004 TABLE 1 Alkyne containing rapalog monomers. Alkyne containing rapalog [00476]embedded image Monomer 1 [00477]embedded image Monomer 2 [00478]embedded image Monomer 3 [00479]embedded image Monomer 4 [00480]embedded image Monomer 5 [00481]embedded image Monomoer 6 [00482]embedded image Monomer 7 [00483]embedded image Monomer 8 [00484]embedded image Monomer 9 [00485]embedded image Monomer 10 [00486]embedded image Monomer 11 [00487]embedded image Monomer 12 [00488]embedded image Monomer 13 [00489]embedded image Monomer 14 [00490]embedded image Monomer 15 [00491]embedded image Monomer 16 [00492]embedded image Monomer 17 [00493]embedded image Monomer 18 [00494]embedded image Monomer 19 [00495]embedded image Monomer 20 [00496]embedded image Monomer 21 [00497]embedded image Monomer 22 [00498]embedded image Monomer 23 [00499]embedded image Monomer 24 [00500]embedded image Monomer 25 [00501]embedded image Monomer 26 [00502]embedded image Monomer 27 [00503]embedded image Monomer 28 [00504]embedded image Monomer 29 [00505]embedded image Monomer 30 [00506]embedded image Monomer 31 [00507]embedded image Monomer 32 [00508]embedded image Monomer 33 [00509]embedded image Monomer 34 [00510]embedded image Monomer 35 [00511]embedded image Monomer 36 [00512]embedded image Monomer 37 [00513]embedded image Monomer 38 [00514]embedded image Monomer 39 [00515]embedded image Monomer 40 [00516]embedded image Monomer 41 [00517]embedded image Monomer 42 [00518]embedded image Monomer 43 [00519]embedded image Monomer 44 [00520]embedded image Monomer 45 [00521]embedded image Monomer 46 [00522]embedded image Monomer 47 [00523]embedded image Monomer 48 [00524]embedded image Monomer 49 [00525]embedded image Monomer 50 [00526]embedded image Monomer 51 [00527]embedded image Monomer 52 [00528]embedded image Monomer 53 [00529]embedded image Monomer 54 [00530]embedded image Monomer 86 [00531]embedded image Monomer 87

TABLE-US-00005 TABLE 2 Type 1 Active Site inhibitor. Active Site inhibitor [00532]embedded image Monomer A [00533]embedded image Monomer B [00534]embedded image Monomer C [00535]embedded image Monomer D [00536]embedded image Monomer E [00537]embedded image Monomer F [00538]embedded image Monomer G [00539]embedded image Monomer H [00540]embedded image Monomer I [00541]embedded image Monomer J [00542]embedded image Monomer K [00543]embedded image Monomer L [00544]embedded image Monomer M [00545]embedded image Monomer N [00546]embedded image Monomer O [00547]embedded image Monomer P [00548]embedded image Monomer Q [00549]embedded image Monomer R [00550]embedded image Monomer S [00551]embedded image Monomer T [00552]embedded image Monomer U [00553]embedded image Monomer V [00554]embedded image Monomer W [00555]embedded image Monomer X [00556]embedded image Monomer Y [00557]embedded image Monomer Z [00558]embedded image Monomer AA [00559]embedded image Monomer AB [00560]embedded image Monomer AC [00561]embedded image Monomer AD

Assembly of Series 2 Bifunctional Rapalogs

[0767] An assembly approach to Series 2 bifunctional rapalogs is shown in Scheme 2 below. For these types of bifunctional rapalogs, linker type B may include variations where q=0 to 30 or 0 to 10, such as q=1 to 8; o=0 to 8, such as o=0 to 2; and Q is CH.sub.2 or O (when o>0). The alkyne moiety can be attached to the rapalog at R.sup.40, R.sup.16, R.sup.28, R.sup.32, or R.sup.26 positions (Formula I or Formula I-X). The alkyne moiety can be attached via a variety of linkage fragments including variations in Table 1. The active site inhibitor can include variations in Table 2. This assembly sequence starts with reaction of the linker Type B with a cyclic anhydride to give Intermediate B1. The intermediate is then coupled to the amino terminus of an active site inhibitor, such as those in Table 2, to provide Intermediate B2. Then, the intermediate is coupled to an alkyne containing rapalog, such as those from Table 1, via 3+2 cycloadditions to provide the Series 2 bifunctional rapalogs.

##STR00562##

Assembly of Series 3 Bifunctional Rapalogs

[0768] An assembly approach to Series 3 bifunctional rapalogs is shown in Scheme 3 below. For these types of bifunctional rapalogs, linker type B may include variations where q=0 to 30 or 0 to 10, such as q=1 to 8. The alkyne moiety can be attached to the rapalog at R.sup.40, R.sup.16, R.sup.28, R.sup.32, or R.sup.26 positions (Formula I or Formula I-X). The alkyne moiety can be attached via a variety of linkage fragments including variations in Table 1. This assembly sequence starts with reaction of the linker Type B with a carboxylic acid of an active site inhibitor, such as those in Table 3 in the Examples Section, to provide Intermediate C1 (Scheme 3). Then, the intermediate is coupled to an alkyne containing rapalog, such as those from Table 1, via 3+2 cycloadditions to provide Series 3 bifunctional rapalogs.

##STR00563##

TABLE-US-00006 TABLE 3 Type 2 Active Site Inhibitors. Active Site Inhibitor [00564]embedded image Monomer AE [00565]embedded image Monomer AF [00566]embedded image Monomer AG [00567]embedded image Monomer AH [00568]embedded image Monomer AI [00569]embedded image Monomer AJ

Assembly of Series 4 Bifunctional Rapalogs

[0769] An assembly approach to Series 4 bifunctional rapalogs is shown in Scheme 4 below. For these types of bifunctional rapalogs, linker type C may include variations where q=0 to 30 or 0 to 10, such as q=1 to 9. The azide moiety can be attached to the rapalog at R.sup.40, R.sup.16, R.sup.28, R.sup.32, or R.sup.26 positions (Formula I or Formula I-X). The azide moiety can be attached via a variety of linkage fragments including variations in Table 4 in the Examples Section. This assembly sequence starts with reaction of the linker type C with an amine-reactive alkyne-containing pre linker, such as those in Table 5 in the Examples Section, followed by carboxylic acid deprotection to provide Intermediate D1 (Scheme 4). The intermediate is then coupled to a nucleophilic amine containing active site inhibitor, such as those in Table 2, to provide Intermediate D2. Then, the intermediate is coupled to an azide containing rapalog, such as those in Table 4, via 3+2 cycloadditions to provide Series 4 bifunctional rapalogs.

##STR00570##

TABLE-US-00007 TABLE 4 Azide containing rapalog monomers. Azide containing rapalog [00571]embedded image   Monomer 55 [00572]embedded image   Monomer 56 [00573]embedded image   Monomer 57 [00574]embedded image   Monomer 58 [00575]embedded image   Monomer 59 [00576]embedded image   Monomer 60 [00577]embedded image   Monomer 61 [00578]embedded image   Monomer 62 [00579]embedded image   Monomer 63 [00580]embedded image   Monomer 64 [00581]embedded image   Monomer 65 [00582]embedded image   Monomer 66 [00583]embedded image   Monomer 67 [00584]embedded image   Monomer 68 [00585]embedded image   Monomer 69 [00586]embedded image   Monomer 70 [00587]embedded image   Monomer 71 [00588]embedded image   Monomer 72 [00589]embedded image   Monomer 73 [00590]embedded image   Monomer 74 [00591]embedded image   Monomer 75 [00592]embedded image   Monomer 88

TABLE-US-00008 TABLE 5 Alkyne containing amine-reactive pre-linkers. Alkyne containing block [00593]embedded image   Building Block A [00594]embedded image   Building Block B [00595]embedded image   Building Block C [00596]embedded image   Building Block D [00597]embedded image   Building Block E [00598]embedded image   Building Block F [00599]embedded image   Building Block G [00600]embedded image   Building Block H [00601]embedded image   Building block 1

Assembly of Series 5 Bifunctional Rapalogs

[0770] An assembly approach to Series 5 bifunctional rapalogs is shown in Scheme 5 below. For these types of bifunctional rapalogs, linker type C may include variations where q=0 to 30 or 0 to 10, such as q=1 to 8. The azide moiety can be attached to the rapalog at R.sup.40, R.sup.16, R.sup.28, R.sup.32, or R.sup.26 positions (Formula I-X). The azide moiety can be attached via a variety of linkage fragments including variations in Table 4. This assembly sequence starts with reaction of the linker Type C with an amine-reactive alkyne-containing pre linker, such as those in Table 5 in the Examples Section, followed by carboxylic acid deprotection to provide Intermediate E1 (Scheme 5). Then, the intermediate is coupled to a Type C linker, using standard peptide forming conditions, followed by carboxylic acid deprotection to provide Intermediate E2. The intermediate is then coupled to an amine containing active site inhibitor, such as those in Table 2, using standard peptide bond forming conditions to provide Intermediate E3. Then, the intermediate is coupled to an azide containing rapalog, such as those in Table 4, via 3+2 cycloadditions to provide Series 5 bifunctional rapalogs.

##STR00602##

Assembly of Series 6 Bifunctional Rapalogs

[0771] An assembly approach to Series 6 bifunctional rapalogs is shown in Scheme 6 below. For these types of bifunctional rapalogs, linker type C may include variations where q=0 to 30 or 0 to 10, such as q=1 to 9. The azide moiety can be attached to the rapalog at R.sup.40, R.sup.16, R.sup.28, R.sup.32, or R.sup.26 positions (Formula I-X). The azide moiety can be attached via a variety of linkage fragments including variations in Table 4. This assembly sequence starts with reaction of the linker type C with an amine-reactive alkyne-containing pre linker, such as those in Table 5 in the Examples Section, followed by carboxylic acid deprotection to give Intermediate F1 (Scheme 6). The intermediate is then coupled to an amine containing post-linker, such as those found in Table 6 in the Examples Section, using standard peptide bond forming conditions followed by deprotection of the carboxylic acid to provide Intermediate F2. The intermediate is then coupled to an amine containing active site inhibitor, such as those in Table 2, using standard peptide bond forming conditions to provide Intermediate F3. Finally, the intermediate is coupled to an azide containing rapalog, such as those in Table 4, via 3+2 cycloadditions to provide Series 6 bifunctional rapalogs.

##STR00603##

TABLE-US-00009 TABLE 6 Amine containing post-linkers. Amine containing block [00604]embedded image   Building block J [00605]embedded image   Building block K

Assembly of Series 7 Bifunctional Rapalogs

[0772] An assembly approach to Series 7 bifunctional rapalogs is shown in Scheme 7 below. For these types of bifunctional rapalogs, linker type A may include variations where q=0 to 30 or 0 to 10, such as q=1 to 8, and linker type D may include variations where o=0 to 10, such as o=1 to 8. The alkyne moiety can be attached to the rapalog at R.sup.40, R.sup.16, R.sup.28, R.sup.32, or R.sup.26 positions (Formula I-X). The alkyne moiety can be attached via a variety of linkage fragments including variations in Table 1. This assembly sequence starts with reaction of the linker Type D with a carboxylic acid of an active site inhibitor, such as those in Table 3 in the Examples Section, followed by N-deprotection to give Intermediate G1 (Scheme 7). Then, the intermediate is coupled to a type A linker, to provide Intermediate G2. Finally, the intermediate is coupled to an alkyne containing rapalog, such as those in Table 1, via 3+2 cycloadditions to provide Series 7 bifunctional rapalogs.

##STR00606##

Assembly of Series 8 Bifunctional Rapalogs

[0773] An assembly approach to Series 8 bifunctional rapalogs is shown in Scheme 8 below. For these types of bifunctional rapalogs, linker type C may include variations where q=0 to 30 or 0 to 10, such as q=1 to 9. The alkyne moiety can be attached to the rapalog at R.sup.40, R.sup.16, R.sup.28, R.sup.32, or R.sup.26 positions (Formula I-X). The alkyne moiety can be attached via a variety of linkage fragments including variations in Table 1. This assembly sequence starts with reaction of the linker type C with an azide containing pre-linker, such as those in Table 7 in the Examples Section, followed by carbonxylic acid deprotection to give Intermediate H1 (Scheme 8). The intermediate is then coupled to the amine containing active site inhibitor, such as those in Table 2, using standard peptide bond forming conditions to provide Intermediate H2. Finally, the intermediate is coupled to an alkyne containing rapalog, such as those in Table 1, via 3+2 cycloadditions to provide Series 8 bifunctional rapalogs.

##STR00607##

TABLE-US-00010 TABLE 7 Azide containing amine-reactive pre-linkers. Azide containing block [00608]embedded image   Building block L [00609]embedded image   Building block M [00610]embedded image   Building block N [00611]embedded image   Building block O [00612]embedded image   Building block P

Assembly of Series 9 Bifunctional Rapalogs

[0774] An assembly approach to Series 9 bifunctional rapalogs is shown in Scheme 9 below. For these types of bifunctional rapalogs, Linker Type F may include variations where q=0 to 30 or 0 to 10, such as q=1 to 7. An azide moiety can be attached to the rapalog at R.sup.40, R.sup.16, R.sup.28, R.sup.32, or R.sup.26 positions (Formula I-X). The azide moiety can be attached via a variety of linkage fragments including variations found in Table 4 in the Examples Section. A Type 1 mTOR active site inhibitor can attach to the linker via a primary or secondary amine, and may include variations in Table 2 in the Examples Section. This assembly sequence starts with reaction of the linker Type E with the amino terminus of an active site inhibitor, such as those in Table 2, to provide an intermediate I1. Then, the intermediate is coupled to an azide containing rapalog, such as those from Table 4, via 3+2 cycloadditions to provide the Series 9 bifunctional rapalogs.

##STR00613##

Assembly of Series 10 bifunctional rapalogs

[0775] An assembly approach to Series 10 bifunctional rapalogs is shown in Scheme 10 below. For these types of bifunctional rapalogs, linker type F includes variations where q=0 to 30 or 0 to 10, such as q=1 to 8, and linker type G includes variations where o=0 to 10, such as o=1 to 8. The azide moiety can be attached to the rapalog at R.sup.40, R.sup.16, R.sup.28, R.sup.32, or R.sup.26 positions (Formula I-X). The azide moiety can be attached via a variety of linkage fragments including variations in Table 4. This assembly sequence starts with reaction of the linker Type F with the amine of an active site inhibitor, such as those in Table 2 in the Examples Section. Then, the intermediate is coupled to a type G linker, to provide Intermediate J2. Finally, the intermediate is coupled to an azide containing rapalog, such as those in Table 4, via 3+2 cycloadditions to provide Series 10 bifunctional rapalogs.

##STR00614##

Assembly of Series 11 Bifunctional Rapalogs

[0776] An assembly approach to Series 11 bifunctional rapalogs is shown in Scheme 11 below. For these types of bifunctional rapalogs, linker type A includes variations where q=0 to 30 or 0 to 10, such as q=1 to 8, and linker type C includes variations where o=0 to 10, such as o=1 to 8. The alkyne moiety can be attached to the rapalog at R.sup.40, R.sup.16, R.sup.28, R.sup.32, or R.sup.26 positions (Formula I-X). The azide moiety can be attached via a variety of linkage fragments including variations in Table 1. This assembly sequence starts with reaction of the linker Type A with the amine of a linker Type C, followed by deprotection of the carboxylic acid to provide Intermediate K1. Then, the intermediate is coupled an amine containing active site inhibitor, such as those found in Table 2, to provide Intermediate K2. Finally, the intermediate is coupled to an alkyne containing rapalog, such as those in Table 1, via 3+2 cycloadditions to provide Series 11 bifunctional rapalogs.

##STR00615##

Assembly of Series 12 Bifunctional Rapalogs

[0777] An assembly approach to Series 12 bifunctional rapalogs is shown in Scheme 12 below. For these types of bifunctional rapalogs, linker type H may include variations where q=0 to 30 or 0 to 10, such as q=1 to 9. The alkyne moiety can be attached to the rapalog at R.sup.40, R.sup.16, R.sup.28, R.sup.32, or R.sup.26 positions (Formula I-X). The alkyne moiety can be attached via a variety of linkage fragments including variations in Table 1. This assembly sequence starts with reaction of the linker type H with a nucleophilic amine containing active site inhibitor, such as those in Table 2, followed by carboxylic acid deprotection to provide Intermediate L1. Then, the intermediate is coupled with an azide containing amine prelinker, which can be composed of a primary or seconday amine, such as those in Table 8, to provide Intermediate L2. Finally, the intermediate is coupled to an alkyne containing rapalog, such as those in Table 1, via 3+2 cycloadditions to provide Series 12 bifunctional rapalogs.

##STR00616##

TABLE-US-00011 TABLE 8 Azide containing amine pre-linkers. Amine containing block [00617]embedded image   Building Block Q [00618]embedded image   Building block R [00619]embedded image   Building block S [00620]embedded image   Building block T [00621]embedded image   Building block U

Assembly of Series 13 Bifunctional Rapalogs

[0778] An assembly approach to Series 13 bifunctional rapalogs is shown in Scheme 13 below. For these types of bifunctional rapalogs, linker type I may include variations where q=0 to 30 or 0 to 10, such as q=1 to 9. The azide moiety can be attached to the rapalog at R.sup.40, R.sup.16, R.sup.28, R.sup.32, or R.sup.26 positions (Formula I or Formula I-X). The azide moiety can be attached via a variety of linkage fragments including variations in Table 4. This assembly sequence starts with reaction of the linker type I with an alkyne containing pre-linker amine, which can be composed of a primary or seconday amine, such as those in Table 9 in the Examples Section, followed by N-deprotection to give Intermediate M1. The intermediate is then coupled to the carboxylic acid containing active site inhibitor, such as those in Table 3, using standard peptide bond forming conditions to provide Intermediate M2. Then, the intermediate is coupled to an azide containing rapalog, such as those in Table 4, via 3+2 cycloadditions to provide Series 13 bifunctional rapalogs.

##STR00622##

TABLE-US-00012 TABLE 9 Alkyne containing pre-linker amines. Alkyne containing amines [00623]embedded image   Building Block V [00624]embedded image   Building Block W [00625]embedded image   Building Block X [00626]embedded image   Building Block Y [00627]embedded image   Building Block Z [00628]embedded image   Building Block AA [00629]embedded image   Building Block AB [00630]embedded image   Building Block AC

Assembly of Series 14 Bifunctional Rapalogs

[0779] An assembly approach to Series 14 bifunctional rapalogs is shown in Scheme 14 below. For this type of bifunctional rapalogs, linker type I may include variations where q=0 to 30 or 0 to 10, such as q=1 to 9. The carboxylic acid moiety can be attached to the rapalog at R.sup.40, R.sup.16, R.sup.28, R.sup.32, or R.sup.26 positions (Formula I or Formula I-X). The carboxylic acid moiety can be attached via a variety of linkage fragments including variations in Table 10. This assembly sequence starts with reaction of the linker type I with a nucleophilic amine containing active site inhibitor, such as those in Table 2, followed by N-deprotection to provide Intermediate N1. The intermediate is then coupled to a carboxylic acid containing rapalog, such as those in Table 10 in the Examples Section, to provide Series 14 bifunctional rapalogs.

##STR00631##

TABLE-US-00013 TABLE 10 Carboxylic acid containing rapalog monomers. Carboxylic acid containing rapalog [00632]embedded image   Monomer 76 [00633]embedded image   Monomer 77 [00634]embedded image   Monomer 78 [00635]embedded image   Monomer 79 [00636]embedded image   Monomer 80

Assembly of Series 15 Bifunctional Rapalogs

[0780] An assembly approach to Series 15 bifunctional rapalogs is shown in Scheme 15 below. For this type of bifunctional rapalogs, linker type J may include variations where q=0 to 30 or 0 to 10, such as q=3 to 8. The amino moiety can be attached to the rapalog at R.sup.40, R.sup.16, R.sup.28, R.sup.32, or R.sup.26 positions (Formula I or Formula I-X). The amino moiety can be attached via a variety of linkage fragments including variations in Table 11. This assembly sequence starts with reaction of the linker type J with a nucleophilic amine containing active site inhibitor, such as those in Table 2, followed by carbonxylic acid deprotection to provide

[0781] Intermediate O1. The intermediate is then coupled to an amine containing rapalog, such as those in Table 11 in the Examples Section, to provide Series 15 bifunctional rapalogs.

##STR00637##

TABLE-US-00014 TABLE 11 Amine containing rapalog monomers. Amine containing rapalog [00638]embedded image   Monomer 81 [00639]embedded image   Monomer 82 [00640]embedded image   Monomer 83 [00641]embedded image   Monomer 84 [00642]embedded image   Monomer 85

Assembly of Series 16 Bifunctional Rapalogs

[0782] An assembly approach to Series 16 bifunctional rapalogs is shown in Scheme 16 below. For these types of bifunctional rapalogs, linker Type C may include variations where q=0 to 30 or 0 to 10, such as q=1 to 9. The amine containing rapalog monomers may include those in Table 11. This assembly sequence starts with reaction of the linker Type C with a carboxylic acid of an active site inhibitor, such as those in Table 3, to provide Intermediate P1. Then, the intermediate is coupled to an amine containing rapalog, such as those in Table 11 in the Examples Section, to provide Series 16 bifunctional rapalogs.

##STR00643##

PREPARATION OF ACTIVE SITE INHIBITOR MONOMERS

Monomer A. 5-(4-amino-1-(4-(aminomethyl)benzyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]oxazol-2-amine trifluoroacetic Acid Salt

[0783] ##STR00644##

Step 1: Synthesis of tert-butyl 4-((4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)benzylcarbamate

[0784] To a solution of 3-iodo-1H-pyrazolo[3,4-d]pyrimidin-4-amine (3.8 g, 14.56 mmol, 1.0 equiv) in DMF (20 mL) was added NaH (582.27 mg, 14.56 mmol, 60% purity, 1.0 equiv) at 0° C. and the reaction solution was stirred at this temperature for 30 min, then tert-butyl 4-(bromomethyl)benzylcarbamate (4.59 g, 15.29 mmol, 1.05 equiv) was added to the reaction at 0° C. and the reaction solution was stirred at room temperature for 2 h. The solution was poured into H.sub.2O (80 mL) and the solid that precipitated out was filtered. The solid cake was washed with H.sub.2O (2×10 mL) and then dried under reduced pressure to give tert-butyl 4-((4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)benzylcarbamate (5 g, 7.68 mmol, 53% yield) as a yellow solid. LCMS (ESI) m/z: [M+Na] calcd for C.sub.18H.sub.21IN.sub.6O.sub.2: 503.07; found: 503.2.

Step 2: Synthesis of tert-butyl 4-((4-amino-3-(2-aminobenzo[d]oxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)benzylcarbamate

[0785] To a bi-phasic suspension of tert-butyl 4-((4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)benzylcarbamate (5 g, 7.68 mmol, 1.0 equiv), 5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzo[d]oxazol-2-amine (2.40 g, 9.22 mmol, 1.2 equiv) and Pd(PPh.sub.3).sub.4 (887.66 mg, 768.16 μmol, 0.1 equiv) in DME (100 mL) and H.sub.2O (50 mL) was added Na.sub.2CO.sub.3 (1.91 g, 23.04 mmol, 3.0 equiv) at room temperature under N.sub.2. The mixture was stirred at 110° C. for 3 h. The reaction mixture was cooled to room temperature and filtered, the filtrate was extracted by EtOAc (3×50 mL). The organic phases were combined and washed with brine (10 mL), dried over Na.sub.2SO.sub.4, filtered, and the filtrate was concentrated under reduced pressure to give a residue. The residue was purified by silica gel chromatography (0.fwdarw.20% MeOH/EtOAc) to give tert-butyl 4-((4-amino-3-(2-aminobenzo[d]oxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)benzylcarbamate (4.5 g, 82% yield) as a yellow solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.25H.sub.26N.sub.8O.sub.3: 487.22; found: 487.2.

Step 3: Synthesis of 5-(4-amino-1-(4-(aminomethyl)benzyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]oxazol-2-amine

[0786] To a solution of tert-butyl 4-((4-amino-3-(2-aminobenzo[d]oxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)benzylcarbamate (4.5 g, 6.29 mmol, 1.0 equiv) in DCM (50 mL) was added TFA (30.80 g, 270.12 mmol, 20 mL, 42.95 equiv) at 0° C. The reaction solution was stirred at room temperature for 2 h. The reaction solution was concentrated under reduced pressure to give a residue, which was dissolved in 10 mL of MeCN, then poured into MTBE (100 mL). The solid that precipitated was then filtered and the solid cake was dried under reduced pressure to give 5-[4-amino-1-[[4-(aminomethyl)phenyl]methyl]pyrazolo[3,4-d]pyrimidin-3-yl]-1,3-benzoxazol-2-amine (2.22 g, 71% yield, TFA) as a yellow solid. LCMS (ESI)m/z: [M+H] calcd for C.sub.20H.sub.18N.sub.8O: 387.16; found: 387.1.

Monomer B. 2-(4-amino-1-(4-aminobutyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)-1H-indol-6-ol trifluoroacetic Acid Salt

[0787] ##STR00645##

Step 1: Synthesis of tert-butyl 2-(4-amino-1-(4-((tert-butoxycarbonyl)amino)butyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)-6-(benzyloxy)-1H-indole-1-carboxylate

[0788] To a mixture of tert-butyl (4-(4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate (300 mg, 694 μmol, 1.0 equiv) and (6-(benzyloxy)-1-(tert-butoxycarbonyl)-1H-indol-2-yl)boronic acid (763 mg, 2.08 mmol, 3.0 equiv) in DMF (2.6 mL), EtOH (525 μL), and H.sub.2O (350 μL) were added Pd(OAc).sub.2 (15.5 mg, 69 μmol, 0.1 equiv), triphenylphosphine (36.1 mg, 138 μmol, 0.2 equiv), and sodium carbonate (440 mg, 4.16 mmol, 6.0 equiv). The reaction was heated at 80° C. for 20 h, cooled to room temperature, and quenched with H.sub.2O (10 mL) and EtOAc (10 mL). The mixture was transferred to a separatory funnel and the aqueous phase was extracted with EtOAc (3×20 mL). The combined organic phase was washed with sat. aq. NaCl (1×20 mL), dried over Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure. The crude material was purified by silica gel chromatography (20.fwdarw.85% EtOAc/heptane) to provide the product (201 mg, 46% yield) as an orange solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.29H.sub.33N.sub.7O.sub.3: 528.27; found 528.2.

Step 2: Synthesis of tert-butyl (4-(4-amino-3-(6-hydroxy-1H-indol-2-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate

[0789] To a solution of tert-butyl 2-(4-amino-1-(4-((tert-butoxycarbonyl)amino)butyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)-6-(benzyloxy)-1H-indole-1-carboxylate (1.0 equiv) in EtOH is added Pd/C (10 mol %). The reaction is purged with H.sub.2 and the reaction allowed to stir under an atmosphere of H2 until consumption of starting material, as determined by LCMS. The reaction is then diluted with EtOAc, filtered over Celite, and concentrated under reduced pressure. The resultant residue is purified by silica gel chromatography to afford the desired product.

Step 3: Synthesis of 2-(4-amino-1-(4-aminobutyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)-1H-indol-6-ol

[0790] To a solution of tert-butyl (4-(4-amino-3-(6-hydroxy-1H-indol-2-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate (1.0 equiv) in anhydrous DCM is added TFA (50 equiv.) dropwise at 0° C. The reaction is stirred at 0° C. and warmed to room temperature. Once the reaction is complete, as determined by LCMS, the reaction is concentrated under reduced pressure. The residue is triturated with MeCN, then dropped into MTBE over 10 min. The supernatant is removed and the precipitate is collected by filtration under N.sub.2 to give 2-(4-amino-1-(4-aminobutyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)-1H-indol-6-ol.

Monomer C. 5-(4-amino-1-((1,2,3,4-tetrahydroisoquinolin-6-yl)methyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]oxazol-2-amine trifluoroacetic Acid Salt

[0791] ##STR00646##

Step 1: Synthesis of tert-butyl 6-((4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)-3,4-dihydroisoquinoline-2(1H)-carboxylate

[0792] To a suspension of 3-iodo-1H-pyrazolo[3,4-d]pyrimidin-4-amine (5 g, 19.16 mmol, 1.0 equiv) in DMF (50.0 mL) was added NaH (766.22 mg, 19.16 mmol, 60% purity, 1.0 equiv) at 4° C. The mixture was stirred at 4° C. for 30 min. To the reaction mixture was added tert-butyl 6-(bromomethyl)-3,4-dihydroisoquinoline-2(1H)-carboxylate (6.87 g, 21.07 mmol, 1.1 equiv) in DMF (30 mL) at 4° C. The mixture was stirred at room temperature for 2 h. The mixture was then cooled to 4° C. and H.sub.2O (400 mL) was added and the mixture was stirred for 30 min. The resulting precipitate was collected by filtration to give crude tert-butyl 6-((4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)-3,4-dihydroisoquinoline-2(1H)-carboxylate (9.7 g, 76% yield) as light yellow solid. The crude product was used for the next step directly.

Step 2: Synthesis of tert-butyl 6-((4-amino-3-(2-aminobenzo[d]oxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)-3,4-dihydroisoquinoline-2(1H)-carboxylate

[0793] To a bi-phasic suspension of tert-butyl 6-((4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)-3,4-dihydroisoquinoline-2(1H)-carboxylate (9.7 g, 14.63 mmol, 1.0 equiv), 5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzo[d]oxazol-2-amine (4.57 g, 17.55 mmol, 1.2 equiv), and Na.sub.2CO.sub.3 (7.75 g, 73.14d mmol, 5.0 equiv) in DME (120.0 mL) and H.sub.2O (60 mL) was added Pd(PPh.sub.3).sub.4 (1.69 g, 1.46 mmol, 0.1 equiv) at room temperature under N.sub.2. The mixture was stirred at 110° C. for 3 h. The reaction mixture was then cooled to room temperature and partitioned between EtOAc (100 mL) and H.sub.2O (100 mL). The aqueous layer was separated and extracted with EtOAc (60 mL×2). The organic layers were combined, washed with brine (80 mL) and dried over anhydrous Na.sub.2SO.sub.4, filtered and the filtrate was concentrated under reduced pressure. The residue was purified by silica gel chromatography (1.fwdarw.100% EtOAc/petroleum ether, then 20.fwdarw.50% MeOH/EtOAc) to afford tert-butyl 6-((4-amino-3-(2-aminobenzo[d]oxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)-3,4-dihydroisoquinoline-2(1H)-carboxylate (4.5 g, 8.44 mmol, 58% yield) as light yellow solid.

Step 3: Synthesis of 5-(4-amino-1-((1,2,3,4-tetrahydroisoquinolin-6-yl)methyl)-1H-pyrazolo[3,4-d]pyramidin-3-yl)benzo[d]oxazol-2-amine

[0794] To neat TFA (32.5 mL, 438.97 mmol, 50.0 equiv) was added tert-butyl 6-((4-amino-3-(2-aminobenzo[d]oxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)-3,4-dihydroisoquinoline-2(1H)-carboxylate (4.5 g, 8.78 mmol, 1.0 equiv) at room temperature. The mixture was stirred for 30 min and then concentrated under reduced pressure. The oily residue was triturated with MeCN (8 mL), then dropped into MTBE (350 mL) over 10 min. The supernatant was removed and then the precipitate was collected by filtration under N.sub.2 to give 5-(4-amino-1-((1,2,3,4-tetrahydroisoquinolin-6-yl)methyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]oxazol-2-amine (5.72 g, 10.54 mmol, over 100% yield, TFA) as light pink solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.22H.sub.20N.sub.8O: 413.18; found 413.2.

Monomer D. 2-(4-amino-1-(4-aminobutyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)-1H-indol-7-ol trifluoroacetic Acid Salt

[0795] ##STR00647##

Step 1: Synthesis of tert-butyl 2-(4-amino-1-(4-((tert-butoxycarbonyl)amino)butyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)-7-methoxy-1H-indole-1-carboxylate

[0796] To a mixture of tert-butyl (4-(4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate (1.0 equiv) and (1-(tert-butoxycarbonyl)-7-methoxy-1H-indol-2-yl)boronic acid (3.0 equiv) in DME and H.sub.2O are added Pd(PPh.sub.3).sub.4 (0.1 equiv) and sodium carbonate (6.0 equiv). The reaction is heated at 80° C. until completion of reaction, as determined by LCMS and TLC analysis. The reaction is then quenched with H.sub.2O and EtOAc. The mixture is transferred to a separatory funnel and the aqueous phase is extracted with EtOAc. The organic phase is washed with sat. aq. NaCl, dried over Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure. The desired product is isolated after chromatography on silica gel.

Step 2: Synthesis of tert-butyl 2-(4-amino-1-(4-((tert-butoxycarbonyl)amino)butyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)-7-hydroxy-1H-indole-1-carboxylate

[0797] To a solution of tert-butyl 2-(4-amino-1-(4-((tert-butoxycarbonyl)amino)butyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)-7-methoxy-1H-indole-1-carboxylate (1.0 equiv) in DCM at −10° C. is added BBr.sub.3 (2.0 equiv). The reaction is allowed to stir until consumption of starting material as determined by LCMS. The reaction is quenched by slow addition of sat. aq. NaHCO.sub.3, transferred to a separatory funnel and the mixture is extracted with DCM. The organic phase was washed with sat. aq. NaCl, dried over Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure. The desired product is isolated after chromatography on silica gel.

Step 3: Synthesis of 2-(4-amino-1-(4-aminobutyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)-1H-indol-7-ol

[0798] To a solution of tert-butyl 2-(4-amino-1-(4-((tert-butoxycarbonyl)amino)butyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)-7-hydroxy-1H-indole-1-carboxylate (1.0 equiv) in DCM at 0° C. is added TFA dropwise. The reaction is stirred at 0° C. and warmed to room temperature. Once the reaction is complete, as determined by LCMS, the reaction is concentrated under reduced pressure. The residue is triturated with MeCN, then dropped into MTBE over 10 min. The supernatant is removed and the precipitate is collected by filtration under N.sub.2 to give 2-(4-amino-1-(4-aminobutyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)-1H-indol-7-ol.

Monomer E. 5-(4-amino-1-(piperidin-4-ylmethyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]oxazol-2-amine trifluoroacetic Acid Salt

[0799] ##STR00648##

Step 1: Synthesis of tert-butyl 4-((4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)piperidine-1-carboxylate

[0800] To a solution of 3-iodo-1H-pyrazolo[3,4-d]pyrimidin-4-amine (3 g, 11.49 mmol, 1.0 equiv) in DMA (30 mL) was added tert-butyl 4-(bromomethyl)piperidine-1-carboxylate (3.36 g, 12.07 mmol, 1.05 equiv) and K.sub.2CO.sub.3 (4.77 g, 34.48 mmol, 3.0 equiv), then the reaction was stirred at 80° C. for 3 h. The reaction mixture was filtered to remove K.sub.2CO.sub.3 and the filtrate was poured into H.sub.2O (200 mL), a solid precipitated that was then filtered to give Cert-butyl 4-((4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)piperidine-1-carboxylate (3 g, 6.55 mmol, 57% yield) as light yellow solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.16H.sub.23IN.sub.6O.sub.2: 459.10; found 459.1.

Step 2: Synthesis of tert-butyl 4-((4-amino-3-(2-aminobenzo[d]oxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)piperidine-1-carboxylate

[0801] To a bi-phasic suspension of tert-butyl 4-((4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)piperidine-1-carboxylate (3 g, 6.55 mmol, 1.0 equiv) and 5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzo[d]oxazol-2-amine (2.04 g, 7.86 mmol, 1.2 equiv) and Na.sub.2CO.sub.3 (3.47 g, 32.73 mmol, 5.0 equiv) in DME (60 mL) and H.sub.2O (30 mL) was added Pd(PPh.sub.3).sub.4 (756.43 mg, 654.60 μmol, 0.1 equiv) at room temperature under N.sub.2. The mixture was stirred at 110° C. for 3 h. Two batches were combined together. The reaction mixture was cooled and partitioned between EtOAc (500 mL) and H.sub.2O (500 mL). The aqueous layer was separated and extracted with EtOAc (3×300 mL). All the organic layers were combined, washed with brine (20 mL), dried over anhydrous Na.sub.2SO.sub.4, filtered, and the filtrate was concentrated under reduced pressure to give tert-butyl 4-((4-amino-3-(2-aminobenzo[d]oxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)piperidine-1-carboxylate (4.5 g, 74% yield) as a yellow solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.23H.sub.28N.sub.8O.sub.3: 465.24; found 465.2.

Step 3: Synthesis of 5-(4-amino-1-(piperidin-4-ylmethyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]oxazol-2-amine

[0802] A solution of tert-butyl 4-((4-amino-3-(2-aminobenzo[d]oxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)piperidine-1-carboxylate (2.5 g, 5.38 mmol, 1.0 equiv) in TFA (25 mL) was stirred at room temperature for 30 min. The reaction solution was concentrated under reduced pressure to remove TFA. The residue was added to MTBE (400 mL) and a solid precipitated, which was then filtered to give 5-(4-amino-1-(piperidin-4-ylmethyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]oxazol-2-amine (2.7 g, over 100% yield, TFA) as a yellow solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.18H.sub.20N.sub.8O: 365.18; found 365.1.

Monomer F. 2-(4-amino-1-(4-aminobutyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)-1H-indol-5-ol trifluoroacetic Acid Salt

[0803] ##STR00649##

Step 1: Synthesis of tert-butyl (4-(4-amino-3-(5-((tert-butyldimethylsilyl)oxy)-1H-indol-2-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate

[0804] To a solution of tert-butyl (4-(4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate (1.0 g, 2.31 mmol, 1.0 equiv) in dioxane (10.5 mL) and H.sub.2O (3.5 mL) was added (1-(tert-butoxycarbonyl)-5-((tert-butyldimethylsilyl)oxy)-1H-indol-2-yl)boronic acid (1.54 g, 2.78 mmol, 1.2 equiv), K.sub.3PO.sub.4 (1.47 g, 6.94 mmol, 3.0 equiv), Pd.sub.2(dba).sub.3 (211.84 mg, 231.34 μmol, 0.1 equiv), and SPhos (189.95 mg, 462.69 μmol, 0.2 equiv) at room temperature under N.sub.2. The sealed tube was heated at 150° C. for 20 min in a microwave. This was repeated for 9 additional batches. The 10 batches were combined and the reaction mixture was cooled and partitioned between EtOAc (60 mL) and H.sub.2O (80 mL). The aqueous layer was separated and extracted with EtOAc (2×50 mL). The organic layers were combined, washed with brine (60 mL) and dried over anhydrous Na.sub.2SO.sub.4. The suspension was filtered and the filtrate was concentrated under reduced pressure. The crude material was purified by silica gel chromatography (1.fwdarw.75% EtOAc/petroleum ether). The desired fractions were combined and evaporated under reduced pressure to give tert-butyl (4-(4-amino-3-(5-((tert-butyldimethylsilyl)oxy)-1H-indol-2-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate (10 g, 60% yield) as a light yellow solid.

Step 2: Synthesis of tert-butyl (4-(4-amino-3-(5-hydroxy-1H-indol-2-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate

[0805] To a mixture of tert-butyl (4-(4-amino-3-(5-((tert-butyldimethylsilyl)oxy)-1H-indol-2-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate (10 g, 18.12 mmol, 1.0 equiv) in THF (100 mL) was added TBAF.3H.sub.2O (1 M, 54.37 mL, 3.0 equiv) in one portion at room temperature under N.sub.2. The mixture was stirred for 1 h and then H.sub.2O (100 mL) was added to the reaction mixture. The layers were separated and the aqueous phase was extracted with EtOAc (2×80 mL). The combined organic phase was washed with brine (100 mL), dried with anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (1.fwdarw.67% EtOAc/petroleum ether) to afford tert-butyl (4-(4-amino-3-(5-hydroxy-1H-indol-2-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate (7 g, 87% yield) as a light pink solid.

Step 3: Synthesis of 2-[4-amino-1-(4-aminobutyl)pyrazolo[3,4-d]pyrimidin-3-yl]-1H-indol-5-ol

[0806] To TFA (50.0 mL, 675.26 mmol, 38.9 equiv) was added tert-butyl (4-(4-amino-3-(5-hydroxy-1H-indol-2-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate (7.6 g, 17.37 mmol, 1.0 equiv) at room temperature. The mixture was stirred for 40 min and was then concentrated under reduced pressure. The oily residue was triturated with MeCN (20 mL), then added dropwise into MTBE (300 mL) for 10 min. The supernatant was removed and then the precipitate was collected by filtration under N.sub.2 to give 2-[4-amino-1-(4-aminobutyl)pyrazolo[3,4-d]pyrimidin-3-yl]-1H-indol-5-ol (7.79 g, 91% yield, TFA) as light yellow solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.17H.sub.19N.sub.7O: 338.17; found 338.2.

Monomer G. 5-(4-amino-1-(azetidin-3-ylmethyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]oxazol-2-amine trifluoroacetic Acid Salt

[0807] ##STR00650##

Step 1: Synthesis of tert-butyl 3-((4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl) methyl)azetidine-1-carboxylate

[0808] To a solution of 3-iodo-1H-pyrazolo[3,4-d]pyrimidin-4-amine (4 g, 15.32 mmol, 1.0 equiv), tert-butyl 3-(hydroxymethyl)azetidine-1-carboxylate (3.01 g, 16.09 mmol, 1.05 equiv) and PPh.sub.3 (6.03 g, 22.99 mmol, 1.5 equiv) in THF (80 mL) cooled to 0° C. was added DIAD (4.47 mL, 22.99 mmol, 1.5 equiv), dropwise. After the addition was complete, the reaction was stirred at room temperature for 14 h. The reaction was poured into H.sub.2O (200 mL) and then extracted with EtOAc (3×50 mL). The organic layers were combined and washed with brine (2×50 mL). The organic phase was dried over Na.sub.2SO.sub.4, filtered, the filtrate was concentrated under reduced pressure to give a residue. The residue was purified by silica gel chromatography (0.fwdarw.100% EtOAc/petroleum ether) to give tert-butyl 3-((4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl) azetidine-1-carboxylate (4.2 g, 64% yield) as a white solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.14H.sub.19IN.sub.6O.sub.2: 431.07; found: 431.0.

Step 2: Synthesis of tert-butyl 3-((4-amino-3-(2-aminobenzo[d]oxazol-5-yl)-1H-pyrazolo [3,4-d]pyrimidin-1-yl)methyl)azetidine-1-carboxylate

[0809] To a bi-phasic suspension of tert-butyl 3-((4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl) methyl)azetidine-1-carboxylate (4 g, 9.30 mmol, 1.0 equiv), 5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzo[d]oxazol-2-amine (2.90 g, 11.16 mmol, 1.2 equiv) and Na.sub.2CO.sub.3 (4.93 g, 46.49 mmol, 5.0 equiv) in DME (100 mL) and H.sub.2O (50 mL) was added Pd(PPh.sub.3).sub.4 (1.07 g, 929.71 μmol, 0.1 equiv) at room temperature under N.sub.2. The mixture was stirred at 110° C. for 3 h. The reaction mixture was then cooled to room temperature and filtered, and the filtrate was extracted by EtOAc (3×50 mL). The organic layers were combined and washed with brine (10 mL), dried over Na.sub.2SO.sub.4, filtered and the filtrate was concentrated under reduced pressure to give a residue. The residue was purified by silica gel chromatography (0.fwdarw.20% MeOH/EtOAc) to give tert-butyl 3-((4-amino-3-(2-aminobenzo[d]oxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)azetidine-1-carboxylate (3.5 g, 80% yield) as a yellow solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.21H.sub.24N.sub.8O.sub.3: 437.20; found: 437.2.

Step 3: Synthesis of 5-(4-amino-1-(azetidin-3-ylmethyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]oxazol-2-amine

[0810] To a solution of tert-butyl 3-((4-amino-3-(2-aminobenzo[d]oxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)azetidine-1-carboxylate (3.29 g, 6.87 mmol, 1.0 equiv) in DCM (20 mL) was added TFA (7.50 mL, 101.30 mmol, 14.7 equiv) at 0° C. The reaction was warmed to room temperature and stirred for 2 h. The reaction solution was concentrated under reduced pressure to give a residue. The residue was dissolved in MeCN (6 mL) and then poured into MTBE (80 mL). A solid precipitated, which was filtered and the solid cake was dried under reduced pressure to give 5-[4-amino-1-(azetidin-3-ylmethyl)pyrazolo[3,4-d]pyrimidin-3-yl]-1,3-benzoxazol-2-amine (4.34 g, over 100% yield, TFA) as a yellow solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.16H.sub.16N.sub.8O: 337.15; found: 337.1.

Monomer H. 5-(4-amino-1-(4-aminobutyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]-oxazol-2-amine trifluoroacetic Acid Salt

[0811] ##STR00651##

[0812] Monomer H was synthesized following the procedures outlined in Nature 2015, 534, 272-276, which is incorporated by reference in its entirety.

Monomer I. 5-(4-amino-1-(pyrrolidin-3-ylmethyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]oxazol-2-amine trifluoroacetic Acid Salt

[0813] ##STR00652##

Step 1: Synthesis of tert-butyl 3-((4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl) methyl)pyrrolidine-1-carboxylate

[0814] A suspension of 3-iodo-1H-pyrazolo[3,4-d]pyrimidin-4-amine (4.5 g, 17.24 mmol, 1.0 equiv), tert-butyl 3-(bromomethyl)pyrrolidine-1-carboxylate (4.78 g, 18.10 mmol, 1.05 equiv) and K.sub.2CO.sub.3 (7.15 g, 51.72 mmol, 3.0 equiv) in DMA (40 mL) was heated to 85° C. The reaction was stirred at 85° C. for 3 h, at which point the solution was cooled to room temperature. Then, H.sub.2O (80 mL) was added to the reaction, and a solid precipitated out. The mixture was filtered, and the solid cake was washed with H.sub.2O (2×40 mL), and then dried under reduced pressure to give tert-butyl 3-((4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl) methyl)pyrrolidine-1-carboxylate (6 g, 78% yield) as a yellow solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.15H.sub.21IN.sub.6O.sub.2: 445.08; found: 445.1.

Step 2: Synthesis of tert-butyl 3-[[4-amino-3-(2-amino-1,3-benzoxazol-5-yl)pyrazolo[3,4-d] pyrimidin-1-yl]methyl]pyrrolidine-1-carboxylate

[0815] To a bi-phasic suspension of tert-butyl 3-((4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl) methyl)pyrrolidine-1-carboxylate (4 g, 9.00 mmol, 1.0 equiv), 5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzo[d]oxazol-2-amine (2.81 g, 10.80 mmol, 1.2 equiv) and Na.sub.2CO.sub.3 (4.77 g, 45.02 mmol, 5.0 equiv) in DME (120 mL) and H.sub.2O (60 mL) was added Pd(PPh.sub.3).sub.4 (1.04 g, 900.35 μmol, 0.1 equiv) at room temperature under N.sub.2. The mixture was stirred at 110° C. for 3 h. The reaction mixture was cooled to room temperature and filtered and the filtrate was extracted with EtOAc (3×50 mL). The organic phases were combined and washed with brine (50 mL), dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give a residue. The residue was purified by silica gel chromatography (0.fwdarw.20% MeOH/EtOAc) to give tert-butyl 3-((4-amino-3-(2-aminobenzo[d]oxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl) methyl)pyrrolidine-1-carboxylate (3 g, 64% yield) as a yellow solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.22H.sub.26N.sub.8O.sub.3: 451.21, found: 451.2.

Step 3: Synthesis of 5-(4-amino-1-(pyrrolidin-3-ylmethyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]oxazol-2-amine

[0816] To a solution of tert-butyl 3-((4-amino-3-(2-aminobenzo[d]oxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)pyrrolidine-1-carboxylate (3 g, 6.66 mmol, 1.0 equiv) in DCM (40 mL) was added TFA (20 mL) at 0° C., dropwise. The reaction mixture was warmed to room temperature and stirred for 2 h. The reaction solution was then concentrated under reduced pressure to give a residue. The residue was dissolved in MeCN (4 mL), then poured into MTBE (100 mL), and a solid precipitated out. The solid was filtered and the cake was dried under reduced pressure to give 5-(4-amino-1-(pyrrolidin-3-ylmethyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]oxazol-2-amine (4.00 g, over 100% yield, TFA) as a yellow solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.17H.sub.18N.sub.8O: 351.17; found: 351.2.

Monomer J. 1-(4-aminobutyl)-3-(7-methoxy-1H-indol-2-yl)-1H-pyrazolo[3,4-d]pyrimidin-4-aminetrifluoroacetic Acid Salt

[0817] ##STR00653##

Step 1: Synthesis of tert-butyl 2-(4-amino-1-(4-((tert-butoxycarbonyl)amino)butyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)-7-methoxy-1H-indole-1-carboxylate

[0818] To a mixture of tert-butyl (4-(4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate (1.0 equiv) and (1-(tert-butoxycarbonyl)-7-methoxy-1H-indol-2-yl)boronic acid (3.0 equiv) in DME and H.sub.2O are added Pd(PPh.sub.3).sub.4 (0.1 equiv) and sodium carbonate (6.0 equiv). The reaction is heated at 80° C. until completion of reaction, as determined by LCMS and TLC analysis. The reaction is then quenched with H.sub.2O and EtOAc. The mixture is transferred to a separatory funnel and the aqueous phase is extracted with EtOAc. The organic phase is washed with sat. aq. NaCl, dried over Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure. The desired product is isolated after chromatography on silica gel.

Step 2: Synthesis of 1-(4-aminobutyl)-3-(7-methoxy-1H-indol-2-yl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine

[0819] To a solution of tert-butyl 2-(4-amino-1-(4-((tert-butoxycarbonyl)amino)butyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)-7-hydroxy-1H-indole-1-carboxylate (1.0 equiv) in DCM at 0° C. is added TFA dropwise. The reaction is stirred at 0° C. and warmed to room temperature. Once the reaction is complete, as determined by LCMS, the reaction is concentrated under reduced pressure. The residue is triturated with MeCN, then dropped into MTBE over 10 min. The supernatant is removed and the precipitate is collected by filtration under N.sub.2 to give 1-(4-aminobutyl)-3-(7-methoxy-1H-indol-2-yl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine.

Monomer K 1-(4-aminobutyl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine trifluoroacetic Acid Salt

[0820] ##STR00654##

Step 1: Synthesis of tert-butyl (4-(4-amino-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate

[0821] To a mixture of tert-butyl (4-(4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate (300 mg, 694 μmol, 1.0 equiv) in MeOH (14 mL) at 0° C. was added zinc dust (226 mg, 3.46 mmol, 5.0 equiv). Sat. aq. NH.sub.4Cl (14 mL) was added to the reaction mixture and the reaction was warmed to room temperature and stirred for 18 h. The reaction was quenched by EtOAc (40 mL) and H.sub.2O (10 mL) and the mixture was transferred to a separatory funnel. The aqueous phase was extracted with EtOAc (3×20 mL) and the combined organic phases were washed with sat. aq. NaHCO.sub.3 (15 mL), dried over Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure to provide the product (210 mg, 99% yield) as a light yellow solid that was used without further purification. LCMS (ESI) m/z: [M+H] calcd for C.sub.14H.sub.22N.sub.6O.sub.2: 307.19; found 307.1.

Step 2: Synthesis of 1-(4-aminobutyl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine

[0822] To a solution of tert-butyl (4-(4-amino-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate (210 mg, 691 μmol) in DCM (3.5 mL) at 0° C. was added TFA (3.5 mL), dropwise. After 3 h, the reaction was warmed to room temperature and concentrated under reduced pressure to provide the trifluoroacetate salt of the product (220 mg, 99% yield) as a brown oil, which was used without further purification. LCMS (ESI) m/z: [M+H] calcd for C.sub.9H.sub.14N.sub.6: 207.13; found 207.1.

Monomer L. 1-[4-(piperazin-1-yl)-3-(trifluoromethyl)phenyl]-9-(quinolin-3-yl)-1H,2H-benzo[h]1,6-naphthyridin-2-one

[0823] ##STR00655##

[0824] The preparation of this monomer has been previously reported in the literature. See the following references: i) Liu, Qingsong; Chang, Jae Won; Wang, Jinhua; Kang, Seong A.; Thoreen, Carson C.; Markhard, Andrew; Hur, Wooyoung; Zhang, Jianming; Sim, Taebo; Sabatini, David M.; et al From Journal of Medicinal Chemistry (2010), 53(19), 7146-7155. ii) Gray, Nathanael; Chang, Jae Won; Zhang, Jianming; Thoreen, Carson C.; Kang, Seong Woo Anthony; Sabatini, David M.; Liu, Qingsong From PCT Int. Appl. (2010), WO 2010044885A2, which are incorporated by reference in their entirety.

Monomer M. 5-(1-(4-aminobutyl)-4-(dimethylamino)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]oxazol-2-amine trifluoroacetic Acid Salt

[0825] ##STR00656##

Step 1: Synthesis of 3-iodo-1-trityl-1H-pyrazolo[3,4-d]pyrimidin-4-amine

[0826] A suspension of 3-iodo-1H-pyrazolo[3,4-d]pyrimidin-4-amine (10.5 g, 40.23 mmol, 1.0 equiv) in DMF (170.0 mL) was treated with Cs.sub.2CO.sub.3 (19.7 g, 60.34 mmol, 1.5 equiv) and [chloro(diphenyl)methyl]benzene (13.5 g, 48.27 mmol, 1.2 equiv) at room temperature. The reaction mixture was stirred at 70° C. for 4 h under a nitrogen atmosphere. The reaction mixture was added to H.sub.2O (1200 mL). The precipitate was filtered and washed with H.sub.2O. The residue was purified by silica gel chromatography (0.fwdarw.60% EtOAc/petroleum ether) to afford 3-iodo-1-trityl-1H-pyrazolo[3,4-d]pyrimidin-4-amine (15.40 g, 73.5% yield) as a white solid.

Step 2: Synthesis of 3-iodo-N,N-dimethyl-1-trityl-1H-pyrazolo[3,4-d]pyrimidin-4-amine

[0827] To a suspension of NaH (2.98 g, 74.50 mmol, 60% purity, 2.5 equiv) in DMF (150 mL) was added the solution of 3-iodo-1-trityl-1H-pyrazolo[3,4-d]pyrimidin-4-amine (15.0 g, 29.80 mmol, 1.0 equiv) in DMF (50 mL) at 0° C. The mixture was stirred at 0° C. for 10 min. To the reaction mixture was then added iodomethane (16.92 g, 119.20 mmol, 7.42 mL, 4.0 equiv) at 0° C. The mixture was stirred at room temperature for 2 h, at which point H.sub.2O (1400 mL) was added at 0° C. The mixture was stirred for an additional 10 min at 0° C. The resulting precipitate was collected by filtration to give crude product, which was purified by silica gel chromatography (1%.fwdarw.25% EtOAc/petroleum ether) twice to afford 3-iodo-N,N-dimethyl-1-trityl-1H-pyrazolo[3,4-d]pyrimidin-4-amine (9.0 g, 89.0% yield) as a white solid.

Step 3: Synthesis of 3-iodo-N,N-dimethyl-1H-pyrazolo[3,4-d]pyrimidin-4-amine

[0828] To a cooled solution of TFA (19.1 mL, 258.1 mmol, 15.0 equiv) in DCM (100.0 mL) was added 3-iodo-N,N-dimethyl-1-trityl-1H-pyrazolo[3,4-d]pyrimidin-4-amine (9.10 g, 17.12 mmol, 1.0 equiv) at 4° C. The mixture was stirred at room temperature for 1 h. The residue was poured into H.sub.2O (100 mL) and the aqueous phase was extracted with DCM (2×50 mL). To the aqueous phase was then added a saturated aqueous solution of NaHCO.sub.3 until the solution was pH 8. The resulting precipitate was collected by filtration to give 3-iodo-N,N-dimethyl-1H-pyrazolo[3,4-d]pyrimidin-4-amine (3.40 g, 68.7% yield) as a white solid.

Step 4: Synthesis of tert-butyl (4-(4-(dimethylamino)-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate

[0829] To a suspension of 3-iodo-N,N-dimethyl-1H-pyrazolo[3,4-d]pyrimidin-4-amine (1.7 g, 5.88 mmol, 1.0 equiv) in DMF (20 mL) was added Na (247 mg, 6.17 mmol, 60% purity, 1.05 equiv) at 4° C. The mixture was stirred at 4° C. for 30 min. To the reaction mixture was then added tert-butyl N-(4-bromobutyl)carbamate (2.22 g, 8.82 mmol, 1.81 mL, 1.5 equiv) in DMF (10 mL) at 4° C. The mixture was stirred at room temperature for 2 h. To the mixture was then added H.sub.2O (100 mL) at 4° C. The mixture was stirred for an additional 30 min at 4° C. and the resulting precipitate was collected by filtration to give crude product. The residue was purified by silica gel chromatography (0.fwdarw.75% EtOAc/petroleum ether) to afford tert-butyl(4-(4-(dimethylamino)-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate (2.0 g, 56% yield) as a white solid.

Step 5: Synthesis of tert-butyl (4-(3-(2-aminobenzo[d]oxazol-5-yl)-4-(dimethylamino)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate

[0830] To a bi-phasic suspension of tert-butyl (4-(4-(dimethylamino)-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate (4.0 g, 8.69 mmol, 1.0 equiv), 5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzo[d]oxazol-2-amine (3.4 g, 13.03 mmol, 1.5 equiv), and Na.sub.2CO.sub.3 (4.6 g, 43.45 mmol, 5.0 equiv) in DME (80.0 mL) and H.sub.2O (40.0 mL) was added Pd(PPh.sub.3).sub.4 (1.0 g, 868.98 μmol, 0.1 equiv) at room temperature under N.sub.2. The mixture was stirred at 110° C. for 3 h. The reaction mixture was then cooled and partitioned between EtOAc (300 mL) and H.sub.2O (600 mL). The aqueous layer was separated and extracted with EtOAc (2×100 mL). The organic layers were combined, washed with brine (2×60 mL) and dried over anhydrous Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure. The crude material was purified by silica gel column chromatography (50% EtOAc/hexanes followed by 20% MeOH/EtOAc). The desired fractions were combined and concentrated under reduced pressure to give tert-butyl (4-(3-(2-aminobenzo[d]oxazol-5-yl)-4-(dimethylamino)-1H-pyrazolo[3,4-d]pyramidin-1-yl)butyl)carbamate (3.2 g, 78.9% yield) as a light brown solid.

Step 6: Synthesis of 5-(1-(4-aminobutyl)-4-(dimethylamino)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]oxazol-2-amine

[0831] To TFA (20.82 mL, 281.27 mmol, 36.5 equiv) was added tert-butyl (4-(3-(2-aminobenzo[d]oxazol-5-yl)-4-(dimethylamino)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate (3.6 g, 7.72 mmol, 1.0 equiv) at room temperature. The mixture was stirred for 30 min, at which point the mixture was concentrated under reduced pressure. The oily residue was triturated with MeCN (8 mL) and MTBE (60 mL) for 10 min. The supernatant was removed and then the precipitate was collected by filtration under N.sub.2 to give 5-(1-(4-aminobutyl)-4-(dimethylamino)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]oxazol-2-amine (4.0 g, crude, TFA) as a light brown solid.

[0832] To 1M NaOH (107.2 mL, 14.7 equiv) was added 5-(1-(4-aminobutyl)-4-(dimethylamino)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]oxazol-2-amine (3.5 g, crude, TFA) at room temperature. The mixture was stirred for 10 min and then the aqueous phase was extracted with DCM (3×50 mL). The combined organic phase was washed with brine (50 mL), dried with anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. TFA (539.37 μL, 7.28 mmol, 1.0 equiv) was added and concentrated under reduced pressure. MeCN (10 mL) was then added, followed by MTBE (150 mL). The resulting precipitate was collected by filtration to give 5-(1-(4-aminobutyl)-4-(dimethylamino)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]oxazol-2-amine (1.3 g, 36.6% yield, TFA) as a light brown product. LCMS (ESI) m/z: [M+H] calcd for C.sub.18H.sub.22N.sub.8O: 367.19; found 367.1.

Monomer N. 6-(4-amino-1-(4-aminobutyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo-[d]isoxazol-3-amine trifluoroacetic Acid Salt

[0833] ##STR00657##

Step 1: Synthesis of tert-butyl (6-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzo[d]isoxazol-3-yl)carbamate

[0834] To a solution of tert-butyl (6-bromobenzo[d]isoxazol-3-yl)carbamate (1.0 equiv) in dioxane are added Pd(PPh.sub.3).sub.4 (0.1 equiv), sodium carbonate (6.0 equiv), and bis(pinacolato)diboron (3.0 equiv). The reaction mixture is stirred and heated until completion of reaction, as determined by LCMS and TLC analysis. The reaction is cooled to room temperature, quenched with sat. aq. NaHCO.sub.3, and the mixture transferred to a separatory funnel. The aqueous phase is extracted with EtOAc and the organic phase is washed with sat. aq. NaCl, dried over Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure. The desired product was isolated after purification by silica gel chromatography.

Step 2: Synthesis of tert-butyl (4-(4-amino-3-(3-((tert-butoxycarbonyl)amino)benzo[d]isoxazol-6-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate

[0835] To a mixture of tert-butyl (4-(4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate (1.0 equiv) and tert-butyl (6-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzo[d]isoxazol-3-yl)carbamate (3.0 equiv) in DME and H.sub.2O are added Pd(PPh.sub.3).sub.4 (0.1 equiv) and sodium carbonate (6.0 equiv). The reaction is heated at 80° C. until completion of reaction, as determined by LCMS and TLC analysis. The reaction is then quenched with H.sub.2O and EtOAc. The mixture is transferred to a separatory funnel and the aqueous phase is extracted with EtOAc. The organic phase is washed with sat. aq. NaCl, dried over Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure. The desired product is isolated after chromatography on silica gel.

Step 3: Synthesis of 6-(4-amino-1-(4-aminobutyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo-[d]isoxazol-3-amine

[0836] To a solution of tert-butyl (4-(4-amino-3-(3-((tert-butoxycarbonyl)amino)benzo[d]isoxazol-6-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate (1.0 equiv) in DCM at 0° C. is added TFA, dropwise. The reaction is stirred at 0° C. and warmed to room temperature. Once the reaction is complete, as determined by LCMS, the reaction is concentrated under reduced pressure. The residue is triturated with MeCN, then added dropwise into MTBE over 10 min. The supernatant is removed and the precipitate is collected by filtration under N.sub.2 to give 6-(4-amino-1-(4-aminobutyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo-[d]isoxazol-3-amine.

Monomer O. 4-(5-(4-morpholino-1-(1-(pyridin-3-ylmethyl)piperidin-4-yl)-1H-pyrazolo[3,4-d]pyrimidin-6-yl)-1H-indol-1-yl)butan-1-amine trifluoroacetic Acid Salt

[0837] ##STR00658##

[0838] The synthesis of this monomer proceeds by alkylation of WAY-600 (CAS #1062159-35-6) with tert-butyl (4-bromobutyl)carbamate under basic conditions, followed by Boc-deprotection using TFA to produce the TFA salt.

[0839] Reference for preparation of WAY-600: Discovery of Potent and Selective Inhibitors of the Mammalian Target of Rapamycin (mTOR) Kinase: Nowak, P.; Cole, D. C.; Brooijmans, N.; Bursavich, M. G.; Curran, K. J.; Ellingboe, J. W.; Gibbons, J. J.; Hollander, I.; Hu, Y.; Kaplan, J.; Malwitz, D. J.; Toral-Barza, L.; Verheijen, J. C.; Zask, A.; Zhang, Yu, K. 2009; Journal of Medicinal Chemistry Volume 52, Issue 22, 7081-89, which is incorporated by reference in its entirety.

Monomer P. 2-(4-(8-(6-(aminomethyl)quinolin-3-yl)-3-methyl-2-oxo-2,3-dihydro-1H-imidazo[4,5-c]quinolin-1-yl)phenyl)-2-methylpropanenitrile trifluoroacetic Acid Salt

[0840] ##STR00659## ##STR00660##

[0841] The synthesis of this monomer proceeds first by synthesis of the Suzuki reaction coupling partner (3-(4,4,5,5-tetramethyl-1,3,2-dioxaborolane)quinolin-6-yl)-N-boc-methanamine starting from methyl 3-bromoquinoline-6-carboxylate. Reduction of the methyl ester with lithium aluminum hydride followed by Mitsunobu reaction with phthalimide and hydrazine cleavage provides the benzylic amine. Protection of the benzylic amine with di-tert-butyl dicarbonate followed by a Miyaura borylation reaction provides (3-(4,4,5,5-tetramethyl-1,3,2-dioxaborolane)quinolin-6-yl)-N-boc-methanamine.

[0842] An S.sub.NAr reaction of 2-(4-aminophenyl)-2-methylpropanenitrile with 6-bromo-4-chloro-3-nitroquinoline provides the substituted amino-nitro-pyridine. Reduction of the nitro group with Raney-Ni under a hydrogen atmosphere followed by cyclization with trichloromethyl chloroformate provides the aryl-substituted urea. Substitution of the free N—H of the urea with methyl iodide mediated by tetrabutylammonium bromide and sodium hydroxide followed by Suzuki coupling of (3-(4,4,5,5-tetramethyl-1,3,2-dioxaborolane)quinolin-6-yl)-N-boc-methanamine and then Boc-deprotection using TFA produces the TFA salt.

[0843] Reference for preparation of 2-[4-(8-bromo-3-methyl-2-oxo-2,3-dihydro-imidazo [4,5-c]quinolin-1-yl)-phenyl]-2-methyl-propionitrile: Vannucchi, A. M.; Bogani, C.; Bartalucci, N. 2016. JAK PI3K/mTOR combination therapy. U.S. Pat. No. 9,358,229. Novartis Pharma AG, Incyte Corporation, which is incorporated by reference in its entirety.

Monomer Q. 8-(6-methoxypyridin-3-yl)-3-methyl-1-[4-(piperazin-1-yl)-3-(trifluoromethyl)phenyl]-1H,2H,3H-imidazo[4,5-c]quinolin-2-one

[0844] ##STR00661##

[0845] This monomer is a commercially available chemical known as BGT226(CAS #1245537-68-1). At the time this application was prepared, it was available for purchase from several vendors as the free amine.

Monomer R. 3-(4-amino-1-(4-aminobutyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)-N-(4,5-dihydrothiazol-2-yl)benzamide trifluoroacetic Acid Salt

[0846] ##STR00662##

Step 1: Synthesis of Cert-butyl (4-(4-amino-3-(3-((4,5-dihydrothiazol-2-yl)carbamoyl)phenyl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate

[0847] To a solution of (3-((4,5-dihydrothiazol-2-yl)carbamoyl)phenyl)boronic acid (500 mg, 1.15 mmol, 1.0 equiv) and tert-butyl (4-(4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate (575 mg, 2.30 mmol, 2.0 equiv) in dioxane (19.1 mL), EtOH (3.8 mL), and H.sub.2O (2.3 mL) was added Pd(PPh.sub.3).sub.4 (265 mg, 230 μmol, 0.2 equiv) and sodium carbonate (730 mg, 6.89 mmol, 6.0 equiv). The reaction mixture was sonicated until formation of a clear, yellow solution, which was subsequently heated at 80° C. for 14 h. The reaction was then diluted with sat. aq. NaCl (30 mL) and the mixture transferred to a separatory funnel. The aqueous phase was extracted with DCM (3×25 mL). The combined organic phases were dried over Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure: The desired product was isolated as a yellow solid (324 mg, 53% yield) after silica gel chromatography (0.fwdarw.15% MeOH/DCM). LCMS (ESI) m/z: [M+H] calcd for C.sub.24H.sub.30N.sub.8O.sub.3S: 511.22; found 511.2.

Step 2: Synthesis of 3-(4-amino-1-(4-aminobutyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)-N-(4,5-dihydrothiazol-2-yl)benzamide

[0848] To a solution of tert-butyl (4-(4-amino-3-(3-((4,5-dihydrothiazol-2-yl)carbamoyl)phenyl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate (324 mg, 614 μmol) in DCM (4.1 mL) at 0° C. was added TFA (1.5 mL), dropwise. After 1 h, the reaction was warmed to room temperature and concentrated under reduced pressure to provide the trifluoroacetate salt of the product as a yellow solid (320 mg, 99% yield). Used without further purification. LCMS (ESI) m/z: [M+H] calcd for C.sub.19H.sub.22N.sub.8OS: 411.16; found 411.1.

Monomer S. 2-(5-(4-morpholino-1-(1-(pyridin-3-ylmethyl)piperidin-4-yl)-1H-pyrazolo[3,4-d]pyrimidin-6-yl)-1H-indol-3-yl)ethan-1-amine

[0849] ##STR00663##

[0850] The synthesis of this monomer proceeds by condensation of 2,4,6-trichloropyrimidine-5-carbaldehyde with 3-((4-hydrazineylpiperidin-1-yl)methyl)pyridine hydrochloride. Reaction of the product with morpholine followed by a Suzuki reaction with boronic ester gives the Boc-protected amine. Final deprotection with TFA gives the monomer. This synthesis route follows closely to the reported preparation of highly related structures in the following references: i) Nowak, Pawel; Cole, Derek C.; Brooijmans, Natasja; Curran, Kevin J.; Ellingboe, John W.; Gibbons, James J.; Hollander, Irwin; Hu, Yong Bo; Kaplan, Joshua; Malwitz, David J.; et al From Journal of Medicinal Chemistry (2009), 52(22), 7081-7089. ii) Zask, Arie; Nowak, Pawel Wojciech; Verheijen, Jeroen; Curran, Kevin J.; Kaplan, Joshua; Malwitz, David; Bursavich, Matthew Gregory; Cole, Derek Cecil; Ayral-Kaloustian, Semiramis; Yu, Ker; et al From PCT Int. Appl. (2008), WO 2008115974 A2 20080925, which are incorporated by reference in their entirety.

Monomer T. 1-(4-aminobutyl)-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-4-amine trifluoroacetic Acid Salt

[0851] ##STR00664##

[0852] To a mixture of tert-butyl (4-(4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate (496 mg, 1.14 mmol, 1.0 equiv) in DCM (5.7 mL) at 0° C. was added TFA (1.5 mL) dropwise. The reaction was allowed to stir at 0° C. for 1 h, at which time the reaction was concentrated under reduced pressure to provide a yellow solid (505 mg, 99% yield) which was taken on without further purification. LCMS (ESI) m/z: [M+H] calcd for C.sub.9H.sub.13IN.sub.6: 333.02; found 332.9.

Monomer U. 5-(4-amino-1-(4-(methylamino)butyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]oxazol-2-amine trifluoroacetic Acid Salt

[0853] ##STR00665##

Step 1: Synthesis of tert-butyl (4-hydroxybutyl)(methyl)carbamate

[0854] To a solution of 4-(methylamino)butan-1-ol (0.5 g, 4.85 mmol, 104.2 mL, 1.0 equiv) in DCM (10 mL) at room temperature was added Boc.sub.2O (1.06 g, 4.85 mmol, 1.11 mL, 1.0 equiv). The mixture was stirred for 3 h at room temperature and then the mixture was concentrated under reduced pressure at 30° C. The residue was purified by silica gel chromatography (100/1 to 3/1 petroleum ether/EtOAc) to afford Cert-butyl (4-hydroxybutyl)(methyl)carbamate (0.9 g, 91.4% yield) as a colorless oil.

Step 2: Synthesis of tert-butyl (4-bromobutyl)(methyl)carbamate

[0855] To a solution of tert-butyl (4-hydroxybutyl)(methyl)carbamate (0.9 g, 4.43 mmol, 1.0 equiv) in THF (20 mL) at room temperature was added PPh.sub.3 (2.21 g, 8.41 mmol, 1.9 equiv) and CBr.sub.4 (2.79 g, 8.41 mmol, 1.9 equiv). The mixture was stirred for 1 h and then the reaction mixture was filtered and concentrated. The residue was purified by silica gel chromatography (1/0 to 4/1 petroleum ether/EtOAc) to afford tert-butyl (4-bromobutyl)(methyl) carbamate (1.1 g, 93.3% yield) as a colorless oil.

Step 3: Synthesis of tert-butyl (4-(4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl) butyl) (methyl)carbamate

[0856] To a suspension of 3-iodo-1H-pyrazolo[3,4-d]pyrimidin-4-amine (0.9 g, 3.45 mmol, 1.0 equiv) in DMF (10 mL) at 4° C. was added NaH (137.92 mg, 3.45 mmol, 60% purity, 1.0 equiv). The mixture was stirred at 4° C. for 30 min and then a solution of tert-butyl (4-bromobutyl)(methyl)carbamate (1.01 g, 3.79 mmol, 25.92 mL, 1.1 equiv) in DMF (3 mL) was added. The mixture was stirred at room temperature for 3 h, at which point H.sub.2O (100 mL) was added. The aqueous phase was extracted with EtOAc (3×30 mL) and the combined organic phases were washed with brine (20 mL), dried with anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (1/0 to 0/1 petroleum ether/EtOAc) to afford tert-butyl (4-(4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl) (methyl) carbamate (1.2 g, 78% yield) as a white solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.15H.sub.23IN.sub.6O.sub.2: 447.10; found 447.1.

Step 4: Synthesis of tert-butyl (4-(4-amino-3-(2-aminobenzo[d]oxazol-5-yl)-1H-pyrazolo[3,4-d] pyrimidin-1-yl)butyl)(methyl)carbamate

[0857] To a bi-phasic suspension of tert-butyl (4-(4-amino-3-iodo-1H-pyrazolo[3,4-d] pyrimidin-1-yl)butyl)(methyl)carbamate (1.2 g, 2.69 mmol, 1.0 equiv), 5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzo[d]oxazol-2-amine (1.19 g, 3.23 mmol, 1.2 equiv), and Na.sub.2CO.sub.3 (1.42 g, 13.44 mmol, 5.0 equiv) in DME (20 mL) and H.sub.2O (10 mL) at room temperature was added Pd(PPh.sub.3).sub.4 (310.71 mg, 268.89 μmol, 0.1 equiv) under N.sub.2. The mixture was stirred at 110° C. for 3 h and then the reaction mixture was cooled and partitioned between EtOAc (20 mL) and H.sub.2O (15 mL). The aqueous layer was separated and extracted with EtOAc (3×20 mL). The combined organic layers were washed with brine (2×20 mL), dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The crude product was purified by silica gel chromatography (1/0 to 4/1 EtOAc/MeOH) to give tert-butyl (4-(4-amino-3-(2-aminobenzo[d]oxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)(methyl) carbamate (0.78 g, 62.5% yield) as an orange solid

Step 5: Synthesis of 5-(4-amino-1-(4-(methylamino)butyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl) benzo[d]oxazol-2-amine

[0858] A solution of tert-butyl(4-(4-amino-3-(2-aminobenzo[d]oxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)(methyl)carbamate (0.78 g, 1.72 mmol, 1.0 equiv) in TFA (5 mL) at room temperature was stirred for 30 min. The solution was concentrated under reduced pressure and the oily residue was triturated with MeCN (1 mL) and then added to MTBE (100 mL). The supernatant was removed and then the precipitate was collected by filtration under N.sub.2 to give 5-(4-amino-1-(4-(methylamino) butyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]oxazol-2-amine bis-trifluorosulfonate (0.959 g, 93% yield) as an orange solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.17H.sub.20N.sub.8O: 353.18; found 353.1.

Monomer V. 1-(4-(4-(5-(aminomethyl)pyrimidin-2-yl)piperazin-1-yl)-3-(trifluoromethyl)phenyl)-8-(6-methoxypyridin-3-yl)-3-methyl-1,3-dihydro-2H-imidazo[4,5-c]quinolin-2-one

[0859] ##STR00666##

Step 1: Synthesis of tert-butyl N-tert-butoxycarbonyl-N-[(2-chloropyrimidin-5-yl)methyl]carbamate

[0860] To a solution of tert-butyl N-tert-butoxycarbonylcarbamate (7.33 g, 33.74 mmol, 1.0 equiv) in DMF (80 mL) was added NaH (1.62 g, 40.49 mmol, 60% purity, 1.2 equiv) at 0° C. The mixture was stirred at 0° C. for 30 min and then 5-(bromomethyl)-2-chloro-pyrimidine (7 g, 33.74 mmol, 1 equiv) was added. The reaction mixture was stirred at room temperature for 1.5 h and then the mixture was poured into sat. NH.sub.4Cl (300 mL) and stirred for 5 min. The aqueous phase was extracted with EtOAc (3×80 mL) and the combined organic phases were washed with brine (50 mL), dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (20:1 to 1:1 petroleum ether/EtOAc) to afford tert-butyl N-tert-butoxycarbonyl-N-[(2-chloro pyrimidin-5-yl)methyl]carbamate (7.0 g, 60.3% yield) as a white solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.15H.sub.22ClN.sub.3O.sub.4: 344.14; found 344.2.

Step 2: Synthesis of tert-butyl N-tert-butoxycarbonyl-N-[[2-[4-[4-[8-(6-methoxy-3-pyridyl)-3-methyl-2-oxo-imidazo[4,5-c]quinolin-1-yl]-2-(trifluoromethyl)phenyl]piperazin-1-yl]pyrimidin-5-yl]methyl]carbamate

[0861] To a solution of 8-(6-methoxy-3-pyridyl)-3-methyl-1-[4-piperazin-1-yl-3-(trifluoromethyl)phenyl]imidazo[4,5-c]quinolin-2-one (0.4 g, 748.32 μmol, 1.0 equiv) in MeCN (7 mL) was added tert-butyl N-tert-butoxycarbonyl-N-[(2-chloropyrimidin-5-yl)methyl]carbamate (514.55 mg, 1.50 mmol, 2.0 equiv) and K.sub.2CO.sub.3 (413.69 mg, 2.99 mmol, 4 equiv) at room temperature. The reaction mixture was stirred at 80° C. for 14 h and then the mixture was cooled to room temperature, filtered and concentrated to dryness. The residue was purified by washing with MTBE (5 mL) to give tert-butyl N-tert-butoxycarbonyl-N-[[2-[4-[4-[8-(6-methoxy-3-pyridyl)-3-methyl-2-oxo-imidazo[4,5-c]quinolin-1-yl]-2-(trifluoromethyl)phenyl]Piperazin-1-yl]pyrimidin-5-yl]methyl]carbamate (0.57 g, 90.5% yield) as a light yellow solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.43H.sub.46F.sub.3N.sub.9O.sub.6: 842.36; found 842.7.

Step 3: Synthesis of 1-[4-[4-[5-(aminomethyl)pyrimidin-2-yl]piperazin-1-yl]-3-(trifluoromethyl) phenyl]-8-(6-methoxy-3-pyridyl)-3-methyl-imidazo[4,5-c]quinolin-2-one

[0862] A solution of tert-butyl N-tert-butoxycarbonyl-N-[[2-[4-[4-[8-(6-methoxy-3-pyridyl)-3-methyl-2-oxo-imidazo[4,5-c]quinolin-1-yl]-2-(trifluoromethyl)phenyl]piperazin-1-yl]pyrimidin-5-yl]methyl]carbamate (0.95 g, 1.13 mmol, 1 equiv) in TFA (10 mL) was stirred at room temperature for 1 h, at which point the solvent was concentrated. The residue was dissolved in MeCN (10 mL) and then the solution was added to MTBE (150 mL), dropwise. The precipitate was collected to give 1-[4-[4-[5-(aminomethyl)pyrimidin-2-yl]piperazin-1-yl]-3-(trifluoromethyl)phenyl]-8-(6-methoxy-3-pyridyl)-3-methyl-imidazo[4,5-c]quinolin-2-one trifluoromethanesulfonate (0.778 g, 84.8% yield) as a yellow solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.33H.sub.30F.sub.3N.sub.9O.sub.2: 642.26; found 642.4.

Monomer W. 1-(4-aminobutyl)-3-(1H-pyrrolo[2,3-b]pyridin-5-yl)pyrazolo[3,4-d]pyrimidin-4-amine

[0863] ##STR00667##

Step 1: Synthesis of tert-butyl N-[4-[4-amino-3-(1H-indol-5-yl)pyrazolo[3,4-d]pyrimidin-1-yl]butyl]carbamate

[0864] To a bi-phasic suspension of tert-butyl N-[4-(4-amino-3-iodo-pyrazolo[3,4-d]pyrimidin-1-yl)butyl]carbamate (8 g, 18.51 mmol, 1 equiv), 5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrrolo[2,3-b]pyridine (5.42 g, 22.21 mmol, 1.2 equiv) and Na.sub.2CO.sub.3 (9.81 g, 92.54 mmol, 5 equiv) in diglyme (160 mL) and H.sub.2O (80 mL) was added Pd(PPh.sub.3).sub.4 (2.14 g, 1.85 mmol, 0.1 equiv) at room temperature under N.sub.2. The mixture was stirred at 110° C. for 3 h. The reaction mixture was cooled to room temperature, filtered and the filtrate was partitioned between EtOAc (500 mL) and H.sub.2O (500 mL). The aqueous layer was separated and extracted with EtOAc (3×300 mL). The organic layers were combined, washed with brine (20 mL) and dried over anhydrous Na.sub.2SO.sub.4, then filtered and the filtrate was concentrated under reduced pressure. The residue was purified by silica gel chromatography (1/0 to 0/1 petroleum ether/EtOAc then 4/1 EtOAc/MeOH) to give tert-butyl N-[4-[4-amino-3-(1H-indol-5-yl)pyrazolo[3,4-d]pyrimidin-1-yl]butyl]carbamate (6.6 g, 84.6% yield) as a yellow solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.22H.sub.27N.sub.7O.sub.2: 422.22; found 423.3.

Step 2: Synthesis of 1-(4-aminobutyl)-3-(1H-pyrrolo[2,3-b]pyridin-5-yl)pyrazolo[3,4-d]pyrimidin-4-amine

[0865] To tert-butyl N-[4-[4-amino-3-(1H-indol-5-yl)pyrazolo[3,4-d]pyrimidin-1-yl]butyl]carbamate (6.6 g, 15.66 mmol, 1 equiv) was added TFA (66 mL), which was then stirred at room temperature for 30 min. The reaction solution was concentrated under reduced pressure to remove TFA and then MTBE (400 mL) was added to the residue. The suspension was stirred for 15 min, at which point the yellow solid was filtered, and the solid cake dried under reduced pressure to give 1-(4-aminobutyl)-3-(1H-pyrrolo[2,3-b]pyridin-5-yl)pyrazolo[3,4-d]pyrimidin-4-amine (10.2 g, 97.1% yield) as a yellow solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.16H.sub.18N.sub.8: 323.17; found 323.1.

Monomer X. 2-(4-amino-1-((1,2,3,4-tetrahydroisoquinolin-6-yl)methyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)-1H-indol-5-ol 2,2,2-trifluoroacetate

[0866] ##STR00668##

Step 1: Synthesis of tert-butyl 6-((4-amino-3-(5-((tert-butyldimethylsilyl)oxy)-1H-indol-2-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)-3,4-dihydroisoquinoline-2(1H)-carboxylate

[0867] To a solution of tert-butyl 6-((4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)-3,4-dihydroisoquinoline-2(1H)-carboxylate (1 g, 1.97 mmol, 1.0 equiv) in dioxane (10.5 mL) and H.sub.2O (3.5 mL) was added (1-(tert-butoxycarbonyl)-5-((tert-butyldimethylsilyl)oxy)-1H-indol-2-yl)boronic acid (1.16 g, 2.96 mmol, 1.5 equiv), K.sub.3PO.sub.4 (1.26 g, 5.92 mmol, 3.0 equiv), Pd.sub.2(dba).sub.3 (180.85 mg, 197.50 μmol, 0.1 equiv), and SPhos (162.16 mg, 394.99 μmol, 0.2 equiv) at room temperature under N.sub.2. The sealed tube was heated at 150° C. for 20 min under microwave. The reaction mixture was then cooled and 6 separate batches were combined together. The reaction mixture was partitioned between EtOAc (100 mL) and H.sub.2O (100 mL). The aqueous layer was separated and extracted with EtOAc (3×80 mL). The organic layers were combined, washed with brine (100 mL) and dried over anhydrous Na.sub.2SO.sub.4. The solution was filtered and the filtrate was concentrated under reduced pressure. The crude material was purified by silica gel column chromatography (100/1 to 1/4 petroleum ether/EtOAc) to give tert-butyl 6-((4-amino-3-(5-((tert-butyldimethylsilyl)oxy)-1H-indol-2-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)-3,4-dihydroisoquinoline-2(1H)-carboxylate (6.17 g, 82.9% yield) as a light yellow solid.

Step 2: Synthesis of tert-butyl 6-((4-amino-3-(5-hydroxy-1H-indol-2-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)-3,4-dihydroisoquinoline-2(1H)-carboxylate

[0868] To a mixture of tert-butyl 6-((4-amino-3-(5-((tert-butyldimethylsilyl)oxy)-1H-indol-2-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)-3,4-dihydroisoquinoline-2(1H)-carboxylate (6.17 g, 9.86 mmol, 1.0 equiv) in THF (100 mL) was added tetrabutylammonium fluoride trihydrate (1 M, 10.84 mL, 1.1 equiv) in one portion at 0° C. under N.sub.2. The mixture was stirred at 0° C. for 1 h and was then added to H.sub.2O (100 mL). The aqueous phase was extracted with EtOAc (3×80 mL) and the combined organic phase was washed with brine (2×80 mL), dried with anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (1/1 to 0/1 petroleum ether/EtOAc) to afford tert-butyl 6-((4-amino-3-(5-hydroxy-1H-indol-2-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)-3,4-dihydroisoquinoline-2(1H)-carboxylate (4 g, 79.3% yield) as a light pink solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.28H.sub.29N.sub.7O.sub.3: 512.24; found 512.3.

Step 3: Synthesis of 2-(4-amino-1-((1,2,3,4-tetrahydroisoquinolin-6-yl)methyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)-1H-indol-5-ol 2,2,2-trifluoroacetate

[0869] To a solution of tert-butyl 6-((4-amino-3-(5-hydroxy-1H-indol-2-yl)-1H-pyrazolo [3,4-d]pyrimidin-1-yl)methyl)-3,4-dihydroisoquinoline-2(1H)-carboxylate (4.5 g, 8.80 mmol, 1.0 equiv) in MeOH (50 mL) was added HCl in MeOH (4 M, 50 mL, 22.7 equiv) at room temperature. The mixture was stirred at room temperature overnight and was then concentrated under reduced pressure. To the crude product was added EtOAc (100 mL) and the resulting precipitate was collected by filtration under N.sub.2 to give 2-(4-amino-1-((1,2,3,4-tetrahydroisoquinolin-6-yl)methyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)-1H-indol-5-ol 2,2,2-trifluoroacetate (4.1 g, 85.0% yield, 3HCl) as a light yellow solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.23H.sub.21N.sub.7O: 412.19; found 412.1.

Monomer Y. 3-(1H-pyrrolo[2,3-b]pyridin-5-yl)-1-((1,2,3,4-tetrahydroisoquinolin-6-yl)methyl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine 2,2,2-trifluoroacetate

[0870] ##STR00669##

Step 1: Synthesis of tert-butyl 6-(bromomethyl)-3,4-dihydroisoquinoline-2(1H)-carboxylate

[0871] A solution of NBS (34.07 g, 191.39 mmol, 4 equiv) in THF (200 mL) was added in portions to a solution of tert-butyl 6-(hydroxymethyl)-3,4-dihydroisoquinoline-2(1H)-carboxylate (12.6 g, 47.85 mmol, 1.0 equiv) and triphenylphosphine (37.65 g, 143.55 mmol, 3.0 equiv) in THF (200 mL) at 0° C. After the addition was complete, the mixture was stirred for 1 h at room temperature. EtOAc (150 mL) was added and the mixture was washed with H.sub.2O (200 mL) and brine (150 mL), dried over anhydrous Na.sub.2SO.sub.4 and concentrated under reduced pressure. The residue was purified by silica gel chromatography (100/1 to 10/1 petroleum ether/EtOAc) to afford tert-butyl 6-(bromomethyl)-3,4-dihydroisoquinoline-2(1H)-carboxylate (8.56 g, 54.8% yield) as a light yellow solid.

Step 2: Synthesis of tert-butyl 6-((4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl) methyl)-3,4-dihydroisoquinoline-2(1H)-carboxylate

[0872] To a suspension of 3-iodo-1H-pyrazolo[3,4-d]pyrimidin-4-amine (9.5 g, 36.40 mmol, 1.0 equiv) in DMF (110 mL) was added NaH (1.46 g, 36.40 mmol, 60% purity, 1.0 equiv) at 0° C. The mixture was stirred at 0° C. for 30 min at which point a solution of tert-butyl 6-(bromomethyl)-3,4-dihydroisoquinoline-2(1H)-carboxylate (12.47 g, 38.22 mmol, 1.05 equiv) in DMF (40 mL) was added at 0° C. The mixture was stirred at room temperature for 1 h and then H.sub.2O (1000 mL) was added at 0° C. The mixture stirred at 0° C. for 30 min and then the resulting precipitate was collected by filtration to give tert-butyl 6-((4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)-3,4-dihydroisoquinoline-2(1H)-carboxylate (17.8 g, 76.3% yield) as a light yellow solid, which was used the next step directly. LCMS (ESI) m/z: [M+H] calcd for C.sub.20H.sub.23IN.sub.6O.sub.2: 507.10; found 507.1.

Step 3: Synthesis of tert-butyl 6-((4-amino-3-(1H-pyrrolo[2,3-b]pyridin-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)-3,4-dihydroisoquinoline-2(1H)-carboxylate

[0873] To a bi-phasic suspension of tert-butyl 6-((4-amino-3-iodo-1H-pyrazolo[3,4-d] pyrimidin-1-yl)methyl)-3,4-dihydroisoquinoline-2(1H)-carboxylate (6.5 g, 10.14 mmol, 1.0 equiv), 5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrrolo[2,3-b]pyridine (2.97 g, 12.16 mmol, 1.2 equiv), and Na.sub.2CO.sub.3 (5.37 g, 50.68 mmol, 5.0 equiv) in diglyme (100 mL) and H.sub.2O (50 mL) was added Pd(PPh.sub.3).sub.4 (1.17 g, 1.01 mmol, 0.1 equiv) at room temperature under N.sub.2. The mixture was stirred at 110° C. for 3 h. The reaction mixture was then cooled and partitioned between EtOAc (100 mL) and H.sub.2O (100 mL). The aqueous layer was separated and extracted with EtOAc (2×100 mL). The combined organic phase was washed with brine (100 mL), dried with anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (0/1 to 1/4 MeOH/EtOAc) to afford tert-butyl 6-((4-amino-3-(1H-pyrrolo[2,3-b]pyridin-5-yl)-1H-pyrazolo[3,4-d]pyramid in-1-yl) methyl)-3,4-dihydroisoquinoline-2(1H)-carboxylate (3.77 g, 72.1% yield) as a light yellow solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.27H.sub.28N.sub.8O.sub.2: 497.24; found 497.3.

Step 4: Synthesis of 3-(1H-pyrrolo[2,3-b]pyridin-5-yl)-1-((1,2,3,4-tetrahydroiso quinolin-6-yl)methyl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine 2,2,2-trifluoroacetate

[0874] tert-Butyl 6-((4-amino-3-(1H-pyrrolo[2,3-b]pyridin-5-yl)-1H-pyrazolo[3,4-d] pyrimidin-1-yl)methyl)-3,4-dihydroisoquinoline-2(1H)-carboxylate (3.77 g, 7.59 mmol, 1.0 equiv) was added to TFA (85.36 mL, 1.15 mol, 151.8 equiv) at room temperature. The reaction mixture was stirred for 1 h. It was then concentrated under reduced pressure and the oily residue was triturated with MeCN (3 mL), then dropped into MTBE (200 mL) for 5 min. The supernatant was removed and then the precipitate was collected by filtration under N.sub.2 to give the product, which was dissolved in MeCN (20 mL), and finally concentrated under reduced pressure to give 3-(1H-pyrrolo[2,3-b]pyridin-5-yl)-1-((1,2,3,4-tetrahydroisoquinolin-6-yl)methyl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine 2,2,2-trifluoroacetate (4.84 g, 85.0% yield, 3TFA) as a light yellow solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.22H.sub.20N.sub.8: 397.19; found 397.2.

Monomer Z. (4-((2-aminoethyl)sulfonyl)-3-fluoro-2-methylphenyl)(7-(6-aminopyridin-3-yl)-2,3-dihydrobenzo[f][1,4]oxazepin-4(5H)-yl)methanone 2,2,2-trifluoroacetate

[0875] ##STR00670## ##STR00671##

Step 1: Synthesis of methyl 3,4-difluoro-2-methylbenzoate

[0876] To a solution of 3,4-difluoro-2-methylbenzoic acid (2 g, 11.62 mmol, 1.0 equiv) in DMF (20 mL) was added K.sub.2CO.sub.3 (4.82 g, 34.86 mmol, 3.0 equiv) and iodomethane (3.26 mL, 52.29 mmol, 4.5 equiv) at room temperature. The mixture was stirred at room temperature for 3 h. The solution of methyl 3,4-difluoro-2-methylbenzoate in DMF (20 mL) was used directly in the next step.

Step 2: Synthesis of methyl 4-((2-((tert-butoxycarbonyl)amino)ethyl)thio)-3-fluoro-2-methylbenzoate

[0877] To a solution of methyl 3,4-difluoro-2-methylbenzoate (2.16 g, 11.28 mmol, 1.0 equiv) in DMF (20 mL) was added tert-butyl (2-mercaptoethyl)carbamate (2.0 g, 11.28 mmol, 1 equiv) and K.sub.2CO.sub.3 (3.12 g, 22.56 mmol, 2.0 equiv) at room temperature. The reaction was stirred at 110° C. for 12 h, at which point the mixture was added to H.sub.2O (50 mL). The aqueous solution was then extracted with EtOAc (3×30 mL) and the organic phase was combined and concentrated under reduced pressure. The residue was purified by silica gel chromatography (1/0 to 3/1 petroleum ether/EtOAc) to afford methyl 4-((2-((tert-butoxycarbonyl)amino)ethyl)thio)-3-fluoro-2-methylbenzoate (3.0 g, 76.0% yield) as light yellow solid.

Step 3: Synthesis of methyl 4-((2-((tert-butoxycarbonyl)amino)ethyl)sulfonyl)-3-fluoro-2-methylbenzoate

[0878] To a solution of methyl 4-((2-((tert-butoxycarbonyl)amino)ethyl)thio)-3-fluoro-2-methylbenzoate (3.3 g, 9:61 mmol, 1.0 equiv), NaOH (2 M, 4.80 mL, 1.0 equiv), and NaHCO.sub.3(2.42 g, 28.83 mmol, 3.0 equiv) in acetone (30 mL) was added potassium peroxymonosulfate (12.35 g, 20.08 mmol, 2.1 equiv). The mixture was stirred for 12 h at room temperature and then the mixture was acidified to pH 5 by addition of 1N HCl. The aqueous layer was extracted with EtOAc (3×30 mL) and the combined organic phase was washed with brine (20 mL), dried with anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (1/0 to 3/1 petroleum ether/EtOAc) to afford methyl 4-((2-((tert-butoxycarbonyl)amino)ethyl)sulfonyl)-3-fluoro-2-methylbenzoate (2.1 g, 58.2% yield) as a yellow solid. LCMS (ESI) m/z: [M-56+H] calcd for C.sub.16H.sub.22FNO.sub.6S: 320.12; found 320.1.

Step 4: Synthesis of 4-((2-((tert-butoxycarbonyl)amino)ethyl)sulfonyl)-3-fluoro-2-methylbenzoic Acid

[0879] To a solution of methyl 4-((2-((tert-butoxycarbonyl)amino)ethyl)sulfonyl)-3-fluoro-2-methylbenzoate (2.1 g, 5.59 mmol, 1.0 equiv) in THF (20 mL), MeOH (10 mL) and H.sub.2O (10 mL) was added LiOH.H.sub.2O (704.16 mg, 16.78 mmol, 3.0 equiv) at room temperature. The reaction mixture was stirred at 40° C. for 4 h. The mixture was then concentrated under reduced pressure to remove THF and MeOH. The aqueous phase was neutralized with 0.5N HCl and was then extracted with EtOAc (5×20 mL). The combined organic phase was washed with brine (2×20 mL), dried with anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give 4-((2-((tert-butoxycarbonyl)amino)ethyl)sulfonyl)-3-fluoro-2-methylbenzoic acid (2.01 g, 97.1% yield) as a white solid. LCMS (ESI) m/z: [M-100+H] calcd for C.sub.15H.sub.20FNO.sub.6S: 262.11; found 262.1.

Step 5: Synthesis of (4-(tert-butoxycarbonyl)-2,3,4,5-tetrahydrobenzo[f][1,4] oxazepin-7-yl)boronic Acid

[0880] To a solution of tert-butyl 7-bromo-2,3-dihydrobenzo[f][1,4]oxazepine-4(5H)-carboxylate (4 g, 12.19 mmol, 1.0 equiv) in THF (80 mL) at −60° C. was added B(OiPr).sub.3 (4.58 g, 24.38 mmol, 5.60 mL, 2.0 equiv) followed by dropwise addition of n-BuLi (2.5 M, 12.19 mL, 2.5 equiv) in n-hexane. The reaction was stirred at −65° C. for 1 h. The reaction mixture was quenched with 1N HCl (12.25 mL) and allowed to warm to room temperature. The reaction mixture was extracted with EtOAc (3×30 mL), dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give (4-(tert-butoxycarbonyl)-2,3,4,5-tetrahydrobenzo[f][1,4]oxazepin-7-yl)boronic acid (3.5 g, crude) as light yellow oil, which was used to the next step directly. LCMS (ESI) m/z: [M-100+H] calcd for C.sub.14H.sub.20BNO.sub.5: 194.15; found 194.2.

Step 6: Synthesis of tert-butyl 7-(6-aminopyridin-3-yl)-2,3-dihydrobenzo[f][1,4] oxazepine-4(5H)-carboxylate

[0881] To a solution of (4-(tert-butoxycarbonyl)-2,3,4,5-tetrahydrobenzo[f][1,4]oxazepin-7-yl)boronic acid (4.2 g, 14.33 mmol, 1.0 equiv) in H.sub.2O (20 mL) and dioxane (60 mL) was added 5-bromopyridin-2-amine (2.48 g, 14.33 mmol, 1.0 equiv), Pd(dppf)Cl.sub.2.DCM (1.17. g, 1.43 mmol, 0.1 equiv) and TEA (4.35 g, 42.99 mmol, 5.98 mL, 3.0 equiv) at room temperature. The mixture was stirred at 85° C. for 12 h. The mixture was then cooled to room temperature and the residue was poured into H.sub.2O (15 mL). The aqueous phase was extracted with EtOAc (3×40 mL) and the combined organic phase was washed with brine (2×40 mL), dried with anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (1/0 to 1/8 petroleum ether/EtOAc) to afford tert-butyl 7-(6-aminopyridin-3-yl)-2,3-dihydrobenzo[f][1,4]oxazepine-4(5H)-carboxylate (3.3 g, 65.0% yield) as light yellow solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.19H.sub.23N.sub.3O.sub.3: 342.18; found 342.2.

Step 7: Synthesis of 5-(2,3,4,5-tetrahydrobenzo[f][1,4]oxazepin-7-yl)pyridin-2-amine

[0882] To a solution of tert-butyl 7-(6-aminopyridin-3-yl)-2,3-dihydrobenzo[f][1,4] oxazepine-4(5H)-carboxylate (3.3 g, 9.67 mmol, 1.0 equiv) in THF (40 mL) was added HCl in EtOAc (4 M, 100 mL, 41.38 equiv) at room temperature. The mixture was stirred for 3 h. The reaction mixture was filtered and the filter cake was washed with EtOAc (3×15 mL) and then dried under reduced pressure to give 5-(2,3,4,5-tetrahydrobenzo [f][1,4]oxazepin-7-yl)pyridin-2-amine (3 g, 95.1% yield, 2HCl) as a light yellow solid.

Step 8: Synthesis of tert-butyl (2-((4-(7-(6-aminopyridin-3-yl)-2,3,4,5-tetrahydrobenzo[f][1,4]oxazepine-4-carbonyl)-2-fluoro-3-methylphenyl)sulfonyl)ethyl)carbamate

[0883] To a solution of 4-((2-((tert-butoxycarbonyl)amino)ethyl)sulfonyl)-3-fluoro-2-methylbenzoic acid (690.08 mg, 1.91 mmol, 1.0 equiv) in DMF (10 mL) was added HATU (1.09 g, 2.86 mmol, 1.5 equiv) and DIPEA (1.66 mL, 9.55 mmol, 5 equiv). The reaction was stirred at room temperature for 30 min and then 5-(2,3,4,5-tetrahydrobenzo[f][1,4]oxazepin-7-yl)pyridin-2-amine (0.6 g, 1.91 mmol, 1.0 equiv, 2HCl) was added. The mixture was stirred for 2 h, at which point H.sub.2O (40 mL) was added. The mixture was stirred for 5 min and the resulting precipitate was collected by filtration to give the crude product. The residue was purified by silica gel chromatography (1/0 to 10/1 EtOAc/MeOH) to afford tert-butyl (2-((4-(7-(6-aminopyridin-3-yl)-2,3,4,5-tetrahydrobenzo[f][1,4] oxazepine-4-carbonyl)-2-fluoro-3-methylphenyl)sulfonyl)ethyl)carbamate (0.538 g, 47.4% yield) as a light yellow solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.29H.sub.33FN.sub.4O.sub.6S: 585.22; found 585.3.

Step 9: Synthesis of (4-((2-aminoethyl)sulfonyl)-3-fluoro-2-methylphenyl)(7-(6-aminopyridin-3-yl)-2,3-dihydrobenzo[f][1,4]oxazepin-4(5H)-yl)methanone 2,2,2-trifluoroacetate

[0884] A solution tert-butyl (2-((4-(7-(6-aminopyridin-3-yl)-2,3,4,5-tetrahydrobenzo[f][1,4] oxazepine-4-carbonyl)-2-fluoro-3-methylphenyl)sulfonyl)ethyl)carbamate (0.538 g, 920.20 μmol, 1.0 equiv) in TFA (10.35 mL, 139.74 mmol, 151.85 equiv) was stirred at room temperature for 2 h. The solution was then concentrated under reduced pressure. The oily residue was triturated with MeCN (1 mL) and then dropped into MTBE (30 mL) for 10 min. The supernatant was removed and then the precipitate was collected by filtration under N.sub.2 to give (4-((2-aminoethyl)sulfonyl)-3-fluoro-2-methylphenyl)(7-(6-aminopyridin-3-yl)-2,3-dihydrobenzo[f][1,4]oxazepin-4(5H)-yl)methanone 2,2,2-trifluoroacetate (0.50 g, 87.4% yield, TFA) as light brown solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.24H.sub.25FN.sub.4O.sub.4S: 485.17; found 485.1.

Monomer AA. 5-(4-amino-1-(6-(piperazin-1-yl)pyrimidin-4-yl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]oxazol-2-amine trifluoroacetic Acid Salt

[0885] ##STR00672##

Step 1: Synthesis of 1-(6-chloropyrimidin-4-yl)-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-4-amine

[0886] To a suspension of 3-iodo-1H-pyrazolo[3,4-d]pyrimidin-4-amine (5 g, 19.16 mmol, 1.0 equiv) in DMF (60 mL) was added NaH (804.53 mg, 20.11 mmol, 60% purity, 1.05 equiv) at 0° C. The mixture was stirred at 0° C. for 30 min. To the reaction mixture was then added 4,6-dichloropyrimidine (3.42 g, 22.99 mmol, 1.2 equiv) at 0° C. The mixture was stirred at room temperature for 2.5 h, at which point the reaction mixture was added to H.sub.2O (600 mL). The suspension was then filtered to give the product (7.1 g, 99.2% yield) as yellow solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.9H.sub.5ClIN.sub.7: 373.94; found 373.9.

Step 2: Synthesis of tert-butyl 4-(6-(4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)pyrimidin-4-yl)piperazine-1-carboxylate

[0887] To a solution of 1-(6-chloropyrimidin-4-yl)-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-4-amine (5 g, 13.39 mmol, 1.0 equiv) and tert-butyl piperazine-1-carboxylate (2.99 g, 16.06 mmol, 1.2 equiv) in DMF (50 mL) was added K.sub.2CO.sub.3 (3.70 g, 26.77 mmol, 2.0 equiv). The reaction mixture was stirred at 100° C. for 4 h, at which point it was added to H.sub.2O (500 mL). The suspension was then filtered to give the product (6.2 g, 88.5% yield) as yellow solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.18H.sub.22IN.sub.9O.sub.2: 524.09; found 524.2.

Step 3: Synthesis of tert-butyl 4-(6-(4-amino-3-(2-aminobenzo[d]oxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)pyrimidin-4-yl)piperazine-1-carboxylate

[0888] To a bi-phasic suspension of 5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzo[d]oxazol-2-amine (3.08 g, 11.85 mmol, 1.0 equiv), tert-butyl 4-(6-(4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)pyrimidin-4-yl)piperazine-1-carboxylate (6.2 g, 11.85 mmol, 1.0 equiv) and Na.sub.2CO.sub.3 (6.28 g, 59.24 mmol, 5.0 equiv) in H.sub.2O (100 mL) and DME (200 mL) was added Pd(PPh.sub.3).sub.4 (1.37 g, 1.18 mmol, 0.1 equiv) at room temperature under N.sub.2. The mixture was stirred at 110° C. for 24 h and then the mixture was filtered to give a solid cake. The solid was added to dioxane (20 mL) and stirred at 110° C. for 60 min, then filtered to give the product (3.5 g, 55.8% yield) as brown solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.25H.sub.27N.sub.11O.sub.3: 530.24; found 530.3.

Step 4: Synthesis of 5-(4-amino-1-(6-(piperazin-1-yl)pyrimidin-4-yl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]oxazol-2-amine trifluoroacetic Acid Salt

[0889] A solution of tert-butyl 4-(6-(4-amino-3-(2-aminobenzo[d]oxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)pyrimidin-4-yl)piperazine-1-carboxylate (3.5 g, 6.61 mmol, 1.0 equiv) in TFA (35 mL) was stirred at room temperature for 1 h. The reaction solution was concentrated under reduced pressure and the resulting crude material was dissolved in MeCN (20 mL) and added dropwise to MTBE (500 mL). The resulting solid was then filtered to give the product (5.5 g, 91.9% yield, 4TFA) as brown solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.20H.sub.19N.sub.11O: 430.19; found 430.1.

Monomer AB. 8-(6-methoxypyridin-3-yl)-3-methyl-1-(4-(4-(5,6,7,8-tetrahydropyrido[4,3-d]pyrimidin-2-yl)piperazin-1-yl)-3-(trifluoromethyl)phenyl)-1H-imidazo[4,5-c]quinolin-2(3H)-one trifluoroacetic Acid Salt

[0890] ##STR00673##

Step 1: Synthesis of tert-butyl 2-(4-(4-(8-(6-methoxypyridin-3-yl)-3-methyl-2-oxo-2,3-dihydro-1H-imidazo[4,5-c]quinolin-1-yl)-2-(trifluoromethyl)phenyl)piperazin-1-yl)-7,8-dihydropyrido[4,3-d]pyrimidine-6(5H)-carboxylate

[0891] To a mixture, of 8-(6-methoxypyridin-3-yl)-3-methyl-1-(4-(piperazin-1-yl)-3-(trifluoromethyl)phenyl)-1H-imidazo[4,5-c]quinolin-2(3H)-one (0.3 g, 561.24 μmol, 1.0 equiv) and tert-butyl 2-chloro-7,8-dihydropyrido[4,3-d]pyrimidine-6(5H)-carboxylate (151.38 mg, 561.24 μmol, 1.0 equiv) in DMF (5 mL) was added K.sub.2CO.sub.3 (193.92 mg, 1.40 mmol, 2.5 equiv). The mixture was stirred at 100° C. for 14 h, at which point H.sub.2O (20 mL) was added. The aqueous layer was extracted with EtOAc (3×40 mL) and the combined organic layers were concentrated under reduced pressure. The crude material was was purified by column chromatography (30/1 to 15/1 DCM/MeOH) to give the product (0.30 g, 69.6% yield) as a light-yellow solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.40H.sub.40F.sub.3N.sub.9O.sub.4: 768.33; found 768.5.

Step 2: Synthesis of 8-(6-methoxypyridin-3-yl)-3-methyl-1-(4-(4-(5,6,7,8-tetrahydropyrido[4,3-d]pyrimidin-2-yl)piperazin-1-yl)-3-(trifluoromethyl)phenyl)-1H-imidazo[4,5-c]quinolin-2(3H)-one

[0892] A solution of Cert-butyl 2-(4-(4-(8-(6-methoxypyridin-3-yl)-3-methyl-2-oxo-2,3-dihydro-1H-imidazo[4,5-c]quinolin-1-yl)-2-(trifluoromethyl)phenyl)piperazin-1-yl)-7,8-dihydropyrido[4,3-d]pyrimidine-6(5H)-carboxylate (0.8 g, 1.04 mmol, 1.0 equiv) in TFA (8 mL) was stirred at room temperature for 2 h. The solvent was concentrated and the residue was dissolved in MeCN (5 mL), then the solution was added dropwise to MTBE (150 mL). The precipitate was filtered and the solid was dried under reduced pressure to give the product (600 mg, 70.6% yield, TFA) as a yellow solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.35H.sub.32F.sub.3N.sub.9O.sub.2: 668.27; found 668.3.

Monomer AC. 5-(4-amino-1-(piperidin-4-ylmethyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]oxazol-2-amine trifluoroacetic Acid Salt

[0893] ##STR00674##

Step 1: Synthesis of tert-butyl 4-((methylsulfonyl)oxy)piperidine-1-carboxylate

[0894] To a solution of tert-butyl 4-hydroxypiperidine-1-carboxylate (4 g, 19.87 mmol, 1.0 equiv) and TEA (3.87 mL, 27.82 mmol, 1.4 equiv) in DCM (40 mL) was added MsCl (2.15 mL, 27.82 mmol, 1.4 equiv) at 0° C. Then the reaction mixture was stirred at room temperature for 1 h. H.sub.2O (50 mL) was added and the aqueous phase was extracted with DCM (3×50 mL). The combined organic phase was washed with brine, dried with anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the product (5.62 g, 101% crude yield) as yellow solid which was used directly in the next step.

Step 2: Synthesis of tert-butyl 4-(4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)piperidine-1-carboxylate

[0895] To a suspension of 3-iodo-1H-pyrazolo[3,4-d]pyrimidin-4-amine (5 g, 19.16 mmol, 1.0 equiv) and tert-butyl 4-((methylsulfonyl)oxy)piperidine-1-carboxylate (5.62 g, 20.11 mmol, 1.05 equiv) in DMF (100 mL) was added K.sub.2CO.sub.3 (5.29 g, 38.31 mmol, 2.0 equiv). The mixture was stirred at 80° C. for 12 h. The reaction mixture was then added to H.sub.2O (400 mL) at 0° C. The resulting precipitate was filtered to give the product (5.0 g, 58.8% yield) as yellow solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.15H.sub.21IN.sub.6O.sub.2: 445.09; found 445.1.

Step 3: Synthesis of tert-butyl 4-(4-amino-3-(2-aminobenzo[d]oxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)piperidine-1-carboxylate

[0896] To a suspension of tert-butyl 4-(4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)piperidine-1-carboxylate (5 g, 11.25 mmol, 1.0 equiv), 5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzo[d]oxazol-2-amine (3.51 g, 13.51 mmol, 1.2 equiv) and Na.sub.2CO.sub.3 (5.96 g, 56.27 mmol, 5.0 equiv) in H.sub.2O (50 mL) and DME (100 mL) was added Pd(PPh.sub.3).sub.4 (1.30 g, 1.13 mmol, 0.1 equiv) at room temperature under N.sub.2. The mixture was stirred at 110° C. for 3 h. The reaction mixture was then cooled to room temperature and filtered. The filtrate was partitioned between EtOAc (100 mL) and H.sub.2O (100 mL) and then the aqueous layer was separated and extracted with EtOAc (3×100 mL). The combined organic layer was washed with brine (20 mL) and dried over anhydrous Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure. The residue was triturated with EtOAc (30 mL) and filtered to give the product (3.6 g, 71.0% yield) as yellow solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.22H.sub.26N.sub.8O.sub.3: 451.22; found 451.3.

Step 4: Synthesis of 5-(4-amino-1-(piperidin-4-yl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]oxazol-2-amine trifluoroacetic Acid Salt

[0897] A solution of tert-butyl 4-(4-amino-3-(2-aminobenzo[d]oxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)piperidine-1-carboxylate (1.4 g, 3.11 mmol, 1.0 equiv) in TFA (10 mL) was stirred at room temperature for 30 min. The reaction solution was concentrated under reduced pressure and the crude solid was dissolved in MeCN (20 mL). The solution was added dropwise to MTBE (100 mL) and the resulting solid was filtered to give the product (1.6 g, 85.8% yield, 2TFA) as yellow solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.17H.sub.18N.sub.8O.sub.3: 351.17; found 351.1.

Monomer AD. 1-(piperidin-4-yl)-3-(1H-pyrrolo[2,3-b]pyridin-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine trifluoroacetic Acid Salt

[0898] ##STR00675##

Step 1: Synthesis of tert-butyl 4-(4-amino-3-(1H-pyrrolo[2,3-b]pyridin-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)piperidine-1-carboxylate

[0899] To a suspension of 5-(4,4,5-trimethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrrolo[2,3-b]pyridine (857.12 mg, 3.51 mmol, 1.2 equiv), tert-butyl 4-(4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)piperidine-1-carboxylate (1.3 g, 2.93 mmol, 1.0 equiv) and Na.sub.2CO.sub.3 (1.55 g, 14.63 mmol, 5.0 equiv) in DME (20 mL) and H.sub.2O (10 mL) was added Pd(PPh.sub.3).sub.4 (338.13 mg, 292.62 μmol, 0.1 equiv) at room temperature under N.sub.2. The mixture was stirred at 110° C. for 3 h. The reaction mixture was then cooled to room temperature and filtered. The filtrate was partitioned between EtOAc (50 mL) and H.sub.2O (50 mL) and the aqueous layer was separated and extracted with EtOAc (3×50 mL). The combined organic layer were washed with brine, dried over anhydrous Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure. The residue was triturated with EtOAc (10 mL), filtered, the solid cake was dried under reduced pressure to give the product (1.0 g, 78.7% yield) as yellow solid.

Step 2: Synthesis of 1-(piperidin-4-yl)-3-(1H-pyrrolo[2,3-b]pyridin-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine trifluoroacetic Acid Salt

[0900] A solution of tert-butyl 4-(4-amino-3-(1H-pyrrolo[2,3-b]pyridin-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)piperidine-1-carboxylate (1.5 g, 3.45 mmol, 1.0 equiv) in TFA (10 mL) was stirred at room temperature for 30 min. The reaction solution was concentrated under reduced pressure and the crude residue was dissolved in MeCN (20 mL). The solution was added dropwise to MTBE (100 mL) and the resulting solid was filtered to give the product (1.19 g, 74.2% yield, TFA) as light yellow solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.17H.sub.18N.sub.8: 335.18; found 335.1.

Monomer AE. 4-amino-5-(2-aminobenzo[d]oxazol-5-yl)-5H-pyrimido[5,4-b]indole-7-carboxylic Acid

[0901] ##STR00676##

[0902] This monomer can be prepared from 7-methyl-5H-pyrimido[5,4-b]indol-4-ol by benzylic oxidation to the carboxylic acid, conversion to the ethyl ester, followed by O-ethylation with triethyloxonium tetrafluoroboroate. Palladium-mediated arylation followed by ester hydrolysis and final ammonia-olysis provides the monomer.

Monomer AF. 4-amino-5-(2-aminobenzo[d]oxazol-5-yl)-5H-pyrimido[5,4-b]indole-8-carboxylic Acid

[0903] ##STR00677##

[0904] This monomer can be prepared following a similar route as that to prepare the previous monomer, but using the isomeric starting material from 8-methyl-5H-pyrimido[5,4-b]indol-4-ol. Benzylic oxidation to the carboxylic acid, conversion to the ethyl ester, followed by O-ethylation with triethyloxonium tetrafluoroboroate and palladium-mediated arylation, followed by ester hydrolysis and final ammonia-olysis provides the monomer.

Monomer AG. 3-(2,4-bis((S)-3-methylmorpholino)-4a,8a-dihydropyrido[2,3-d]pyrimidin-7-yl)benzoic Acid

[0905] ##STR00678##

Step 1: Synthesis of (3S)-4-[7-chloro-2-[(3S)-3-methylmorpholin-4-yl]pyrido[2,3-d]pyrimidin-4-yl]3-methyl-morpholine

[0906] To a solution of 2,4,7-trichloropyrido[2,3-d]pyrimidine (4.0 g, 17.06 mmol, 1.0 equiv) in DMA (10 mL) was added (3S)-3-methylmorpholine (4.31 g, 42.65 mmol, 2.5 equiv) and DIPEA (5.51 g, 42.65 mmol, 7.43 mL, 2.5 equiv). The reaction solution was heated to 70° C. for 48 h. The reaction suspension was cooled to room temperature, poured into cold H.sub.2O (50 mL) to precipitate out a solid. The solid was filtered and the filter cake was rinsed with H.sub.2O, and dried under reduced pressure to give the crude product, which was purified by column chromatography on silica gel (0.fwdarw.100% petroleum ether/EtOAc) to give (3S)-4-[7-chloro-2-[(3S)-3-methylmorpholin-4-yl]pyrido[2,3-d]pyrimidin-4-yl] 3-methyl-morpholine (3.5 g, 56.4% yield) as a yellow solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.17H.sub.22ClN.sub.5O.sub.2: 364.15; found 364.2.

Step 2: Synthesis of 3-[2,4-bis[(3S)-3-methylmorpholin-4-yl]pyrido[2,3-d]pyrimidin-7-yl]benzoic acid

[0907] To a solution of (3S)-4-[7-chloro-2-[(3S)-3-methylmorpholin-4-yl]pyrido[2,3-d]pyrimidin-4-yl]-3-methyl-morpholine (2 g, 5.50 mmol, 1.0 equiv) and 3-boronobenzoic acid (1.09 g, 6.60 mmol, 1.2 equiv) in 1,4-dioxane (40 mL) was added a solution of K.sub.2CO.sub.3 (911.65 mg, 6.60 mmol, 1.2 equiv) in H.sub.2O (4 mL), followed by Pd(PPh.sub.3).sub.4 (317.60 mg, 274.85 μmol, 0.05 equiv). The solution was degassed for 10 min and refilled with N2, then the reaction mixture was heated to 100° C. under N.sub.2 for 5 h. The reaction was cooled to room temperature and filtered. The filtrate was acidified by HCl (2N) to pH 3, and the aqueous layer was washed with EtOAc (3×20 mL). Then, the aqueous phase was concentrated under reduced pressure to give a residue, which was purified by column chromatography on silica gel (50%.fwdarw.100% petroleum ether/EtOAc) to give 3-[2,4-bis[(3S) -3-methylmorpholin-4-yl]pyrido[2,3-d]pyrimidin-7-yl]benzoic acid hydrochloride (2.5 g, 89.9% yield) as a yellow solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.24H.sub.27N.sub.5O.sub.4: 450.21; found 450.2.

[0908] Reference for preparation of this monomer: Menear, K.; Smith, G. C. M.; Malagu, K.; Duggan, H. M. E.; Martin, N. M. B.; Leroux, F. G. M. 2012. Pyrido-, pyrazo- and pyrimido-pyrimidine derivatives as mTOR inhibitors. U.S. Pat. No. 8,101,602. Kudos Pharmaceuticals, Ltd, which is incorporated by reference in its entirety.

Monomer AH. (1r,4r)-4-[4-amino-5-(7-methoxy-1H-indol-2-yl)imidazo[4,3-f][1,2,4]triazin-7-yl]cyclohexane-1-carboxylic Acid

[0909] ##STR00679##

[0910] This monomer, also known as OSI-027 (CAS #=936890-98-1), is a commercially available compound. At the time this application was prepared, it was available for purchase from several vendors.

Monomer AI. 2-(4-(4-(8-(6-methoxypyridin-3-yl)-3-methyl-2-oxo-2,3-dihydro-1H-imidazo[4,5-c]quinolin-1-yl)-2-(trifluoromethyl)phenyl)piperazin-1-yl)pyrimidine-5-carboxylic Acid

[0911] ##STR00680##

[0912] Preparation of this monomer proceeds by reaction of BGT226 with methyl 2-chloropyrimidine-5-carboxylate, followed by ester hydrolysis, to give the titled Monomer.

Monomer AJ. 4-amino-5-{1H-pyrrolo[2,3-b]pyridin-5-yl}-5H-pyrimido[5,4-b]indole-8-carboxylic Acid

[0913] ##STR00681##

[0914] This monomer can be prepared from 7-methyl-5H-pyrimido[5,4-b]indol-4-ol by benzylic oxidation to the carboxylic acid, conversion to the ethyl ester, followed by O-ethylation with triethyloxonium tetrafluoroboroate. Palladium-mediated arylation followed by ester hydrolysis and final ammonia-olysis provides the monomer.

Preparation of Pre- and Post-Linkers

[0915] Building Block A. 2-(4-(5-ethynylpyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylic acid.

##STR00682##

Step 1: Synthesis of ethyl 2-(4-(5-bromopyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylate

[0916] To a solution of 5-bromo-2-(piperazin-1-yl)pyrimidine hydrochloride (7.5 g, 26.83 mmol, 1.0 equiv) and TEA (16.29 g, 160.96 mmol, 22.40 mL, 6.0 equiv) in dioxane (100 mL) was added ethyl 2-chloropyrimidine-5-carboxylate (5.01 g, 26.83 mmol, 1.0 equiv) at room temperature and then the reaction mixture was heated to 85° C. for 18 h. The mixture was cooled to room temperature, filtered and the solid cake was washed with H.sub.2O (2×50 mL). The residue was triturated with H.sub.2O (150 mL) and filtered, at which point the solid cake was washed with H.sub.2O (3×30 mL) to afford ethyl 2-(4-(5-bromopyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylate (8.18 g, 77.5% yield) as a white solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.15H.sub.17BrN.sub.6O.sub.2: 393.06; found 393.2.

Step 2: Synthesis of ethyl 2-(4-(5-((trimethylsilyl)ethynyl)pyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylate

[0917] To a solution of ethyl 2-(4-(5-bromopyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylate (5 g, 12.71 mmol, 1.0 equiv) in DMF (200 mL) was added CuI (242.16 mg, 1.27 mmol, 0.1 equiv), Pd(PPh.sub.3).sub.2Cl.sub.2 (892.46 mg, 1.27 mmol, 0.1 equiv), TEA (6.43 g, 63.57 mmol, 8.85 mL, 5.0 equiv) and ethynyltrimethylsilane (6.24 g, 63.57 mmol, 8.81 mL, 5.0 equiv) at room temperature under N.sub.2. The reaction mixture was stirred at 80° C. for 4 h then the mixture was cooled to room temperature. The reaction mixture was filtered, and the resulting solid cake was washed EtOAc (3×30 mL) and dried under reduced pressure to give ethyl 2-(4-(5-((trimethylsilyl)ethynyl)pyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylate (4.2 g, 80.5% yield) as a light gray solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.20H.sub.26N.sub.6O.sub.2Si: 411.20; found 411.3.

Step 3: Synthesis of 2-(4-(5-ethynylpyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylic Acid

[0918] To a solution of ethyl 2-(4-(5-((trimethylsilyl)ethynyl)pyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylate (4.2 g, 10.23 mmol, 1.0 equiv) in H.sub.2O (30 mL) and EtOH (30 mL) was added LiOH.H.sub.2O (2.15 g, 51.15 mmol, 5.0 equiv) at room temperature. The reaction mixture was stirred at 75° C. for 1.5 h and then the mixture was cooled to room temperature and concentrated under reduced pressure at 45° C. The reaction mixture was acidified with 1 N HCl and the resulting precipitate was collected by filtration to give 2-(4-(5-ethynylpyrimidin-2-yl) piperazin-1-yl)pyrimidine-5-carboxylic acid hydrochloride (3.0 g, 84.6% yield) as a brown solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.15H.sub.14N.sub.6O.sub.2: 311.13; found: 311.2.

Building Block J. ethyl 2-(4-(5-(aminomethyl)pyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylate

[0919] ##STR00683##

Step 1: Synthesis of ethyl 2-(4-(5-(((tert-butoxycarbonyl)amino)methyl)pyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylate

[0920] To a 250 mL round bottom flask was added dichloro(dimethoxyethane) nickel (11.17 mg, 50.86 μmol, 0.02 equiv), 4,4′-di-tert-butyl-2,2′-bipyridine (13.65 mg, 50.86 μmol, 0.02 equiv), and THF (1.5 mL). The vial was capped and the resulting suspension was sonicated until the nickel and ligand were fully dissolved, yielding a pale green solution. The solvent was then removed under reduced pressure to give a fine coating of the ligated nickel complex. Once dry, ethyl 2-(4-(5-bromopyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylate (1 g, 2.54 mmol, 1.0 equiv), potassium (tert-butoxycarbonyl)amino)methyl)trifluoroborate (904.30 mg, 3.81 mmol, 1.5 equiv), Ir[dFCF.sub.3ppy].sub.2(bpy)PF.sub.6 (28.53 mg, 25.43 μmol, 0.01 equiv) and Cs.sub.2CO.sub.3 (1.24 g, 3.81 mmol, 1.5 equiv) were added in succession. The vial was then capped and purged and evacuated four times. Under an Ar atmosphere, dioxane (100 mL) was introduced. The vial containing all the reagents was further sealed with parafilm and stirred for 4 h, approximately 4 cm away from three 7 W fluorescent light bulbs at room temperature. The three batches were combined together, the reaction mixture was filtered, and the solution was concentrated to dryness. The residue was purified by silica gel chromatography (10/1 to 0/1 petroleum ether/EtOAc) to afford ethyl 2-(4-(5-(((tert-butoxycarbonyl)amino)methyl)pyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylate (3.6 g, 80.4% yield) as a light yellow solid LCMS (ESI) m/z: [M+H] calcd for C.sub.21H.sub.29N.sub.7O.sub.4: 444.23; found 444.2.

Step 2: Synthesis of ethyl 2-(4-(5-(aminomethyl)pyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylate

[0921] To a mixture of ethyl 2-(4-(5-(((tert-butoxycarbonyl)amino)methyl)pyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylate (6.9 g, 15.56 mmol, 1.0 equiv) in DCM (100 mL) was added HCl/EtOAc (4 M, 80 mL, 20.6 equiv) in one portion at room temperature under N.sub.2. The mixture was stirred for 1.5 h and then the solution was then concentrated to dryness under reduced pressure. To the residue was added MTBE (100 mL) and the precipitate was collected by filtration under N.sub.2 to give ethyl 2-(4-(5-(aminomethyl)pyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylate hydrochloride (5.9 g, 99.8% yield) as a white solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.16H.sub.21N.sub.7O.sub.2: 344.18; found 344.1.

Building Block K. ethyl 2-(piperazin-1-yl)pyrimidine-5-carboxylate

[0922] ##STR00684##

Step 1: Synthesis of ethyl 2-(4-(tert-butoxycarbonyl)piperazin-1-yl)pyrimidine-5-carboxylate

[0923] To a solution of tert-butyl piperazine-1-carboxylate (11.94 g, 53.59 mmol, 1.0 equiv, HCl) and ethyl 2-chloropyrimidine-5-carboxylate (10 g, 53.59 mmol, 1.0 equiv) in MeCN (100 mL) was added K.sub.2CO.sub.3 (7.41 g, 53.59 mmol, 1.0 equiv). The mixture was stirred at 80° C. for 17 h and then poured into H.sub.2O (200 mL). The mixture was filtered and the filter cake was washed with H.sub.2O (80 mL) and dried under reduced pressure to give the product (15.76 g, 82% yield) as a white solid.

Step 2: Synthesis of ethyl 2-(piperazin-1-yl)pyrimidine-5-carboxylate

[0924] To a solution of ethyl 2-(4-(tert-butoxycarbonyl)piperazin-1-yl)pyrimidine-5-carboxylate (15.7 g, 46.67 mmol, 1.0 equiv) in EtOAc (150 mL) was added HCl/EtOAc (150 mL) at 0° C. The resulting mixture was stirred at room temperature for 9 h. The reaction mixture was filtered and the filter cake was washed with EtOAc (100 mL). The solid was dried under reduced pressure to give the product (12.55 g, 96% yield, HCl) as a white solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.11H.sub.16N.sub.4O.sub.2: 237.14; found 237.3.

Building Block L. 2-(4-(5-azidopyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylic acid

[0925] ##STR00685##

Step 1: Synthesis of ethyl 2-(4-(5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylate

[0926] To a solution of ethyl 2-(4-(5-bromopyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylate (25 g, 63.57 mmol, 1.0 equiv) in DMSO (500 mL) was added B.sub.2pin.sub.2 (32.29 g, 127.15 mmol, 2.0 equiv), KOAc (18.72 g, 190.72 mmol, 3.0 equiv) and Pd(dppf)Cl.sub.2 (4.65 g, 6.36 mmol, 0.1 equiv) at room temperature. The mixture was stirred at 75° C. for 3 h, at which point the mixture was cooled to room temperature. DCM (500 mL) was added to the reaction mixture and the solution was filtered and concentrated. To the crude mixture was added H.sub.2O (1000 mL), then the precipitate was collected by filtration under N.sub.2 to give the crude product. The residue was triturated with (10/1 petroleum ether/EtOAc, 400 mL) and filtered to afford ethyl 2-(4-(5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylate (25 g, 89.3% yield) as a brown solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.21H.sub.29BN.sub.6O.sub.4: 441.23; found 441.1.

Step 2: Synthesis of ethyl 2-(4-(5-azidopyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylate

[0927] To a solution of ethyl 2-(4-(5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylate (16 g, 36.34 mmol, 1.0 equiv) in DMSO (400 mL) was added NaN.sub.3 (3.54 g, 54.51 mmol, 1.5 equiv) and Cu(OAc).sub.2 (660.03 mg, 3.63 mmol, 0.1 equiv). The solution was vigorously stirred at 55° C. under O.sub.2 (1 atm) for 1 h. To the mixture was added to H.sub.2O (2500 mL), and the resulting precipitate was collected by filtration to give the chide product as a black-brown solid. The residue was purified by silica gel chromatography (1/10 to 5/1 DCM/MeOH) to afford ethyl 2-(4-(5-azidopyrimidin-2-yl) piperazin-1-yl)pyrimidine-5-carboxylate (2.76 g, 21.4% yield) as a light yellow solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.15H.sub.17N.sub.9O.sub.2: 356.15; found 356.2.

Step 3: Synthesis of 2-(4-(5-azidopyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylic Acid

[0928] To a solution of ethyl 2-(4-(5-azidopyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylate (3.38 g, 9.51 mmol, 1.0 equiv) in THF (60 mL), H.sub.2O (20 mL) and EtOH (20 mL) was added LiOH.H.sub.2O (598.66 mg, 14.27 mmol, 1.5 equiv) at room temperature. The reaction mixture was stirred at 65° C. for 50 min, at which point the mixture was cooled to room temperature and concentrated under reduced pressure at 45° C. to remove THF and EtOH. The mixture was acidified with 1N HCl to pH 7. The resulting precipitate was collected by filtration to give 2-(4-(5-azidopyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylic acid (3 g, 96.4% yield).

Building Block M. ethyl 2-(3-(((tert-butyldiphenylsilyl)oxy)methyl)-4-(5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylate

[0929] ##STR00686##

Step 1: Synthesis of tert-butyl 4-(5-bromopyrimidin-2-yl) -3-(hydroxymethyl) piperazine-1-carboxylate

[0930] To a solution of tert-butyl 3-(hydroxymethyl)piperazine-1-carboxylate (8.5 g, 39.30 mmol, 1.0 equiv) in DMF (120 mL) was added 5-bromo-2-chloropyrimidine (7.6 g, 39.30 mmol, 1.0 equiv) and DIPEA (20.54 mL, 117.90 mmol, 3.0 equiv). The mixture was stirred at 130° C. for 16 h. The mixture was poured into H.sub.2O (500 mL) and the aqueous phase was extracted EtOAc (3×150 mL). The combined organic phase was washed with saturated aqueous NH.sub.4Cl (2×150 mL), brine (2×150 mL), dried with anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the crude product. The residue was purified by silica gel chromatography (1/0 to 0/1 petroleum ether/EtOAc) to give the product (12.6 g, 83% yield) as the yellow. oil. LCMS (ESI) m/z: [M+H] calcd for C.sub.14H.sub.21BrN.sub.4O.sub.3: 373.09; found 373.05.

Step 2: Synthesis of tert-butyl 4-(5-bromopyrimidin-2-yl)-3-(((tert-butyldiphenylsilyl)oxy)methyl)piperazine-1-carboxylate

[0931] To a solution of tert-butyl 4-(5-bromopyrimidin-2-yl)-3-(hydroxymethyl)piperazine-1-carboxylate (12.6 g, 33.76 mmol, 1.0 equiv) in DCM (150 mL) was added tert-butyl-chloro-diphenyl-silane (9.54 mL, 37.13 mmol, 1.1 equiv) and imidazole (4.60 g, 67.52 mmol, 2.0 equiv). The mixture was stirred at room temperature for 18 h. The reaction mixture was diluted with DCM (100 mL) and washed with saturated aqueous NaHCO.sub.3(2×80 mL), brine, dried with anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (1/0 to 0/1 petroleum ether/EtOAc) to give the product (16.5 g, 66% yield) as the yellow oil. LCMS (ESI) m/z: [M+H] calcd for C.sub.30H.sub.39BrN.sub.4O.sub.3Si: 611.21; found 611.30.

Step 3: Synthesis of 5-bromo-2-(2-(((tert-butyldiphenylsilyl)oxy)methyl)piperazin-1-yl)pyrimidine

[0932] To a solution of tert-butyl 4-(5-bromopyrimidin-2-yl)-3-(((tert-butyldiphenylsilyl)oxy)methyl)piperazine-1-carboxylate (41 g, 67.03 mmol, 1.0 equiv) in EtOAc (100 mL) was added HCl/EtOAc (350 mL), dropwise. The reaction mixture was stirred at room temperature for 3 h. The reaction mixture was then filtered and the filter cake was washed with EtOAc (100 mL). The solid cake was dried under reduced pressure to give the product (30.6 g, 75% yield, HCl) as a white soild. LCMS (ESI) m/z: [M+H] calcd for C.sub.25H.sub.31BrN.sub.4OSi: 511.16; found 511.2.

Step 4: Synthesis of ethyl 2-(4-(5-bromopyrimidin-2-yl)-3-(((tert-butyldiphenylsilyl)oxy)methyl)piperazin-1-yl)pyrimidine-5-carboxylate

[0933] To a suspension of 5-bromo-2-(2-(((tert-butyldiphenylsilyl)oxy)methyl)piperazin-1-yl)pyrimidine(23.5 g, 42.88 mmol, 1.0 equiv, HCl) and ethyl 2-chloropyrimidine-5-carboxylate (8 g, 42.88 mmol, 1.0 equiv) in IPA (250 mL) was added DIPEA (22.41 mL, 128.65 mmol, 3.0 equiv), dropwise. The reaction mixture was stirred at 80° C. for 16 h. The mixture was then poured into H.sub.2O (500 mL) and the solution was filtered. The filter cake was washed with H.sub.2O (200 mL) and the solid was dried under reduced pressure. The crude product was purified by silica gel chromatography (1/0 to 0/1 petroleum ether/EtOAc) to the product (19.53 g, 68% yield) as a white solid.

Step 5: Synthesis of ethyl 2-(3-(((tert-butyldiphenylsilyl)oxy)methyl)-4-(5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylate

[0934] To a solution of ethyl 2-(4-(5-bromopyrimidin-2-yl)-3-(((tert-butyldiphenylsilyl)oxy)methyl)piperazin-1-yl)pyrimidine-5-carboxylate (15 g, 22.67 mmol, 1.0 equiv) in dioxane (150 mL) was added 4,4,4′,4′,5,5,5′,5′-octamethyl-2,2′-bi(1,3,2-dioxaborolane) (11.51 g, 45.34 mmol, 2.0 equiv), Pd(dppf)C12 (1.66 g, 2.27 mmol, 0.1 equiv) and KOAc (6.67 g, 68.01 mmol, 3 equiv). The mixture was stirred at 95° C. under N.sub.2 for 15 h. The reaction mixture was cooled to room temperature, filtered, and the filter cake was washed with EtOAc (60 mL). The resulting solution was concentrated under reduced pressure. The crude product was purified by silica gel chromatography (1/0 to 0/1 petroleum ether/EtOAc) to give the product (13 g, 76% yield) as white solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.38H.sub.49BN.sub.6O.sub.5Si: 709.37 found 709.5.

Step 6: Synthesis of ethyl 2-(4-(5-azidopyrimidin-2-yl)-3-(((tert-butyldiphenylsilyl)oxy)methyl)piperazin-1-yl)pyrimidine-5-carboxylate

[0935] To a solution of ethyl 2-(3-{[(tert-butyldiphenylsilyl)oxy]methyl}-4-[5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidin-2-yl]piperazin-1-yl)pyrimidine-5 carboxylate (750 mg, 1.05 mmol, 1.0 equiv) in DMSO (10 mL) was added copper(II) acetate (19.0 mg, 0.105 mmol, 0.1 equiv) and sodium azide (102 mg, 1.57 mmol, 1.5 equiv). The reaction mixture was placed under an O.sub.2 atmosphere (1 atm) and heated to 60° C. After 2.5 h, the reaction was cooled to room temperature and then added dropwise to H.sub.2O (125 mL) to give a fine brown solid, which was collected by filtration. The solid was washed with H.sub.2O (3×20 mL) and dried under reduced pressure to give the product (542 mg, 82% yield), which was used directly in next reaction. LCMS (ESI) m/z: [M+H] calcd for C.sub.32H.sub.37N.sub.9O.sub.3Si: 624.29; found 624.2.

Step 7: Synthesis of ethyl 2-(4-(5-azidopyrimidin-2-yl)-3-(hydroxymethyl)piperazin-1-yl)pyrimidine-5-carboxylate

[0936] To a solution of ethyl 2-[4-(5-azidopyrimidin-2-yl)-3-{[(tert-butyldiphenylsilyl)oxy]methyl}piperazin-1-yl]pyrimidine-5-carboxylate (478 mg, 0.7662 mmol, 1.0 equiv) in THF (5.1 mL) was added TBAF (1M in THF, 1.14 mmol, 1.14 mL, 1.5 equiv). The reaction mixture was stirred for 3.5 h, at which point the reaction was quenched with saturated NH.sub.4Cl (4 mL) and then diluted with EtOAc (20 mL) and H.sub.2O (20 mL). The separated organic phase was washed with H.sub.2O (3×30 mL) and the aqueous washes were extracted with EtOAc (15 mL). The combined organic phase was washed with brine (15 mL), dried with MgSO.sub.4, filtered, and concentrated to give the crude product as a brown oil. This material was combined With the crude product from a similar reaction (56 mgs) to give 490 mg of crude product which was purified by silica gel chromatography (0.fwdarw.25% EtOAc/hexanes) to give the product (166 mg, 50% yield) as a light yellow solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.16H.sub.19N.sub.9O.sub.3: 386.17; found 386.1.

Step 8: Synthesis of 2-(4-(5-azidopyrimidin-2-yl)-3-(hydroxymethyl)piperazin-1-yl)pyrimidine-5-carboxylic Acid

[0937] To a solution of ethyl 2-[4-(5-azidopyrimidin-2-yl)-3-(hydroxymethyl)piperazin-1-yl]pyrimidine-5-carboxylate (154 mg, 0.3995 mmol, 1.0 equiv) in THF (1.26 mL) and EtOH (0.42 mL) was added a solution of LiOH.H.sub.2O (28.4 mg, 0.6791 mmol, 1.7 equiv) in H.sub.2O (0.42 mL). The resulting solution stirred at 65° C. for 1 h, at which time the reaction mixture was cooled to room temperature and then concentrated under reduced pressure. The solution was adjusted to pH 7 with the addition of 1N HCl. The solution was then concentrated and the residue dried under reduced pressure. To the residue was added 10% MeOH/DCM (20 mL) and the resulting suspension was stirred for 1 h and then filtered. The filtrate was concentrated to give a powder which was dried under reduced pressure to give the product (95 mg, 66% yield), which was used without further purification. LCMS (ESI) m/z: [M+H] calcd for C.sub.14H.sub.15N.sub.9O.sub.3: 358.14; found 358.1.

Building Block N. 2-[4-(5-azidopyrimidin-2-yl)-2-[(tert-butoxy)carbonyl]piperazin-1-yl]pyrimidine-5-carboxylic Acid

[0938] ##STR00687##

[0939] This building block can be prepared by a process similar to that for Building Block L by utilizing tert-butyl piperazine-2-carboxylate.

Building Block O. 2-[(2R)-4-(5-azidopyrimidin-2-yl)-2-[bis({2-[(tert-butyldimethylsilyl)oxy]ethyl})carbamoyl]piperazin-1-yl]pyrimidine-5-carboxylic Acid

[0940] ##STR00688## ##STR00689##

[0941] This building block can be prepared by a process similar to that for Building Block L, by utilizing (2R)-1,4-bis[(benzyloxy)carbonyl]piperazine-2-carboxylic acid.

Building Block P. 2-[(2S)-4-(5-azidopyrimidin-2-yl)-2-[(dimethylamino)methyl]piperazin-1-yl]pyrimidine-5-carboxylic Acid

[0942] ##STR00690## ##STR00691##

[0943] This building block can be prepared by a process similar to that for Building Block L by utilizing dimethyl({[(2R)-piperazin-2-yl]methyl})amine.

Building Block Q. 5-azido-2-(piperazin-1-yl)pyrimidine

[0944] ##STR00692##

Step 1: Synthesis of tert-butyl 4-(5-azidopyrimidin-2-yl)piperazine-1-carboxylate

[0945] Reference for preparation of tert-butyl 4-(5-azidopyrimidin-2-yl)piperazine-1-carboxylate from tert-butyl 4-(5-aminopyrimidin-2-yl)piperazine-1-carboxylate: Dorsch, D.; Muzerelle, M.; Burg-Dorf, L.; Wucherer-Plietker, M.; Czodrowski, P.; Esdar, C. 2017. Quinoline-2-one derivatives. WO 2017/121444. Merck Patent GmbH.

Step 2: Synthesis of 5-azido-2-(piperazin-1-yl)pyrimidine hydrochloride

[0946] To a solution of tert-butyl 4-(5-azidopyrimidin-2-yl)piperazine-1-carboxylate (252 mg, 0.8253 mmol, 1.0 equiv) in dioxane (3 mL) was added 4N HCl in dioxane (3 mL). After 5 min, the reaction solution became heterogeneous and was stirred overnight at room temperature. The next day the reaction mixture was concentrated under reduced pressure and placed under high vacuum to afford 5-azido-2-(piperazin-1-yl)pyrimidine hydrochloride as a light yellow powder (215 mg, 108% yield). LCMS (ESI) m/z: [M+H] calcd for C.sub.8H.sub.11N.sub.7: 206.12; found 206.1.

Building Block R. 5-azido-2-(2-{[(tert-butyldiphenylsilyl)oxy]methyl}piperazin-1-yl)pyrimidine

[0947] ##STR00693##

[0948] This building block can be prepared by a process similar to that for Building block L by utilizing tert-butyl 4-(5-bromopyrimidin-2-yl)-3-(((tert-butyldiphenylsilyl)oxy)methyl)piperazine-1-carboxylate.

Building Block S. tert-butyl 4-(5-azidopyrimidin-2-yl)piperazine-2-carboxylate

[0949] ##STR00694##

[0950] This building block can be prepared by a process similar to that for Building block L by utilizing 1,2-di-tert-butyl 4-(5-bromopyrimidin-2-yl)piperazine-1,2-dicarboxylate.

Building Block T. (2R)-4-(5-azidopyrimidin-2-yl)-N,N-bis({2-[(tert-butyldimethylsilyl)oxy]ethyl})piperazine-2-carboxamide

[0951] ##STR00695##

[0952] This building block can be prepared by a process similar to that for Building block L by utilizing tert-butyl (2R)-2-[bis({2-[(tert-butyldimethylsilyl)oxy]ethyl})carbamoyl]-4-(5-bromopyrimidin-2-yl)piperazine-1-carboxylate.

Building Block U. (2R)-4-(5-azidopyrimidin-2-yl)-N,N-dimethylpiperazine-2-carboxamide

[0953] ##STR00696##

[0954] This building block can be prepared by a process similar to that for Building block L by utilizing tert-butyl (2R)-4-(5-bromopyrimidin-2-yl)-2-(dimethylcarbamoyl)piperazine-1-carboxylate.

Preparation of Rapamycin Monomers

Intermediate 1. Synthesis of 40 (R)—O-m-bromobenzyl rapamycin

[0955] ##STR00697##

[0956] To a dry reaction flask was added rapamycin (1.0 g, 1.09 mmol, 1.0 equiv) followed by heptanes (8.7 mL) and DCM (3.4 mL). 3-Bromobenzyl bromide (2.17 g, 8.72 mmol, 8.0 equiv) and silver(I) oxide (3.01 g, 13.0 mmol, 12.0 equiv) were added to the solution and the reaction flask was capped and heated at 60° C. until full consumption of rapamycin, as determined by LCMS analysis. The reaction was then cooled to room temperature, diluted with EtOAc (15 mL), filtered through Celite, and concentrated under reduced pressure to provide a yellow solid. Purification by chromatography on silica gel (10.fwdarw.40% EtOAc/heptanes) afforded the product (Intermediate 1) as a white solid (788 mg, 67% yield). LCMS (ESI) m/z: [M+Na] calcd for C.sub.58H.sub.84BrNO.sub.13: 1104.50; found 1104.5.

Intermediate 2. Synthesis of 40 (S)-(1-(5-(3-bromophenyl)-1,2,3-triazole)) rapamycin

[0957] ##STR00698##

[0958] To an oven-dried reaction flask was added chloro(pentamethylcyclopentadienyl) (cyclooctadiene)ruthenium(II) (627.9 mg, 1.652 mmol, 0.4 equiv) followed by toluene (42 mL). The mixture was purged with N.sub.2 before adding 40(S)-azido rapamycin (3.55 g, 3.78 mmol, 1.0 equiv) and then 1-bromo-3-ethynylbenzene (1.325 g, 7.319 mmol, 1.9 equiv). The flask was purged with N.sub.2 and stirred at room temperature overnight. After stirring for 15 h the reaction mixture was concentrated under reduced pressure to a dark brown residue, diluted with DCM (50 mL), and passed through a plug of Magnesol®. The Magnesol® pad was washed twice with DCM and the filtrates concentrated under reduced pressure. Purification (2×) by silica gel chromatography (0.fwdarw.50% EtOAc/hexanes) afforded the product (Intermediate 2) as a grey/brown residue (1.72 g, 37% yield). LCMS (ESI) m/z: [M+Na] calcd for C.sub.59H.sub.83BrN.sub.4O.sub.12: 1141.51, 1143.51; found 1141.7, 1143.6.

Monomer 1. Synthesis of 40(R)—O-1-hexynyl rapamycin

[0959] ##STR00699##

[0960] To an oven-dried reaction flask was added hex-5-yn-1-yl trifluoromethanesulfonate (5.14 g, 22.3 mmol, 4.0 equiv) followed by DCM (24.0 mL). The mixture was purged with N.sub.2 and cooled to 0° C. before adding 2,6-di-tert-butyl-4-methylpyridine (2.25 g, 11.0 mmol, 2.0 equiv) as a solid in one portion. After stirring 5 min, rapamycin (5.04 g, 5.5 mmol, 1.0 equiv) was added as a solid in one portion. The flask was purged with N.sub.2 and stirred at 0° C. for 45 min before it was warmed to room temperature and stirred for 18 h. The reaction mixture was diluted with DCM (100 mL) and washed with 100 mL each of sat. aqueous NaHCO.sub.3 and brine, then dried and concentrated to a green oil. The oil was loaded onto a frit containing silica gel (˜30 g) and eluted with 50% EtOAc in hexanes. The eluent was concentrated and purified by silica gel chromatography (0.fwdarw.10% acetone/DCM) to provide the product as a white foam (2.48 g). Re-purification by silica gel chromatography (0.fwdarw.35% EtOAc/hexanes) afforded the purified product as a white foam (1.90 g, 31% yield). LCMS (ESI) m/z: [M+Na] calcd for C.sub.57H.sub.87NO.sub.13: 1016.61; found 1016.5.

Monomer 2. Synthesis of 16-O-propargyl rapamycin

[0961] ##STR00700##

[0962] The required intermediates can be prepared using methods described in the literature. The reported monomer can be prepared following the reported methods shown.

[0963] References for this: 1) Manipulation of the Rapamycin Effector Domain. Selective Nucleophilic Substitution of the C7 Methoxy Group: Luengo, Juan I.; Konialian-Beck, Arda; Rozamus, Leonard W.; Holt, Dennis A. 1994; Journal of Organic Chemistry, Volume 59, Issue 22, pp 6512-13. 2) Holt, D. A.; Clackson, T. P.; Rozamus, L.; Yang, W.; Gilman, M. Z. 1997; Materials and method for treating or preventing pathogenic fungal infection. WO98/02441. Ariad Pharmaceuticals, Inc. 3) Clackson, T. P.; et al. 1999. Regulation of biological events using multimeric chimeric proteins. WO 99/36553. Ariad Gene Therapeutics Inc., which are incorporated by reference in their entirety.

Monomer 3. Synthesis of 32(R)-methoxy-26-O-(prop-2-yn-1-yl) oxime rapamycin

[0964] ##STR00701##

Step I: Synthesis of 32(R)-methoxy-28,40-bistriethylsilyl rapamycin

[0965] To a stirred solution of 32(R)-hydroxy-28,40-bistriethylsilyl rapamycin (3.83 g, 3.34 mmol, 1.0 equiv) in chloroform (95.8 mL) was added Proton Sponge® (7.17 g, 33.5 mmol, 10.0 equiv) along with freshly dried 4 A molecular sieves (4 g). The solution was stirred for 1 h prior to the addition of trimethyloxonium tetrafluoroborate (4.95 g, 33.5 mmol, 10.0 equiv, dried by heating under high vacuum at 50° C. for 1 h before use) at room temperature. The reaction mixture was stirred for 18 h, and then the reaction mixture was diluted with DCM and filtered through Celite. The filtrate was washed sequentially with aqueous 1 M HCl (2×), sat. aqueous NaHCO.sub.3 solution, then dried and concentrated under reduced pressure. Purification by silica gel chromatography (10.fwdarw.20% EtOAc/hexanes) afforded the desired product as a yellow oil that was contaminated with 3 wt. % Proton Sponge®. The residue was taken up in MTBE and washed with aqueous 1 M HCl, sat. aqueous NaHCO.sub.3 solution, dried, and then concentrated under reduced pressure to furnish a yellow foam (3.15 g, 81.2% yield). LCMS (ESI) m/z: [M-TES+H.sub.2O] calcd for C.sub.64H.sub.111NO.sub.13Si.sub.2: 1061.68; found 1061.9.

Step 2: Synthesis of 32(R)-methoxy rapamycin

[0966] To a stirred solution of 32(R)-methoxy-28,40-bistriethylsilyl rapamycin (1.11 g, 0.958 mmol, 1.0 equiv) in THF (12.6 mL) and pyridine (6.30 mL) in a plastic vial was added 70% HF-pyridine (2.22 mL, 76.6 mmol, 80.0 equiv) dropwise at 0° C. The reaction mixture was stirred at 0° C. for 20 min before being warmed to room temperature for 3 h, when HPLC showed complete consumption of starting material. The reaction mixture was cooled to 0° C. and poured slowly into ice cold sat. aqueous NaHCO.sub.3 solution (50 mL). The aqueous layer was extracted with EtOAc (3×) and the combined organics were washed with sat. aqueous NaHCO.sub.3 solution, brine, dried, and concentrated under reduced pressure. The yellow residue was dissolved in MeOH (5 mL) and added dropwise to H.sub.2O (50 mL) to produce a white precipitate. After stirring for 15 min the slurry was filtered on a medium porosity funnel and the cake washed with H.sub.2O (2×). The solids were then dissolved in MeCN (50 mL) and lyophilized overnight to provide the product as a white solid (780 mg, 87% yield). LCMS (ESI) m/z: [M+Na] calcd for C.sub.52H.sub.83NO.sub.13: 952.58; found 952.4.

Step 3: Synthesis of 32(R)-methoxy-26-O-(prop-2-yn-1-yl) oxime rapamycin

[0967] To a solution of 32(R)-methoxy rapamycin (780.0 mg, 0.838 mmol, 1.0 equiv) and 3-(aminooxy)prop-1-yne hydrochloride (450.9 mg, 4.192 mmol, 5.0 equiv) in pyridine (3.9 mL) was added dropwise HCl in 1,4-dioxane (4 M, 1.46 mL, 5.84 mmol, 7.0 equiv) over 1 min at room temperature. The reaction mixture was then heated at 50° C. for 36 h. Additional 3-(aminooxy)prop-1-yne hydrochloride (90.17 mg, 0.838 mmol, 1.0 equiv) and HCl in 1,4-dioxane (4 M, 1.04 mL, 4.16 mmol, 5.0 equiv) were added after the reaction had been cooled to room temperature. The reaction mixture was again heated at 50° C. and stirred for 72 h. The reaction mixture was added dropwise into H.sub.2O (70 mL) and cooled at 0° C. The resulting solid was filtered off, washed with H.sub.2O, and purified by silica gel chromatography (0.fwdarw.60% EtOAc/hexanes). The desired product was lyophilized to a white solid (414 mg, 50.2% yield, mixture of E/Z isomers). LCMS (ESI) m/z: [M+H.sub.2O] calcd for C.sub.55H.sub.86N.sub.2O.sub.13: 1000.6; found 1000.5.

Monomer 4. Synthesis of 32(R)-methoxy-26-O-(2-(2-(2-(prop-2-yn-1-yloxy)ethoxy)ethoxy)ethyl) oxime rapamycin

[0968] ##STR00702##

[0969] To a solution of 32(R)-methoxy rapamycin (120.0 mg, 0.129 mmol, 1.0 equiv) and O-(2-{2-[2-(prop-2-yn-1-yloxy)ethoxy]ethoxy}ethyl)hydroxylamine (100.0 mg, 0.492 mmol, 3.8 equiv) in pyridine (0.5 mL) was added HCl in 1,4-dioxane (4 M, 0.16 mL, 0.645 mmol, 5.0 equiv) dropwise and then the reaction mixture was heated to 50° C. for 18 h. MeOH (0.1 mL) was added to the heterogeneous solution along with additional HCl in 1,4-dioxane (4 M, 0.16 mL, 0.645 mmol, 5.0 equiv) and heating at 50° C. continued for 72 h. The reaction was cooled to room temperature, diluted with DCM, washed with sat. aqueous NaHCO.sub.3 solution, dried, and concentrated under reduced pressure. Purification by silica gel chromatography (40.fwdarw.80% EtOAc/hexanes) and lyophilization from MeCN furnished the product as a white solid (60 mg, 41% yield, mixture of E/Z isomers). LCMS (ESI) m/z: [M+Na] calcd for C.sub.61H.sub.98N.sub.2O.sub.16: 1137.68; found 1137.7.

Monomer 5. Synthesis of 40(R)—O-(7-octynyl) rapamycin

[0970] ##STR00703##

[0971] To a dry reaction vessel is added oct-7-yn-1-yl trifluoromethanesulfonate (4.0 equiv) followed by anhydrous DCM. The mixture is purged with N.sub.2 and cooled to sub-ambient temperature before addition of 2,6-di-tert-butyl-4-methylpyridine (2.0 equiv) as a solid in one portion. Rapamycin (1.0 equiv) is then added as a solid in one portion. The reaction is stirred and, upon consumption of rapamycin, diluted with DCM and washed with sat. aqueous NaHCO.sub.3 solution. The organic layer is washed with sat. aq. NaCl, dried over Na.sub.2SO.sub.4, filtered and concentrated. The crude product mixture was purified by silica gel chromatography to afford product.

Monomer 6. Synthesis of 32(R)-hydroxy-26-O-(prop-2-yn-1-yl) oxime rapamycin

[0972] ##STR00704##

[0973] To a dry reaction flask was added 32(R)-hydroxy rapamycin (2.74 g, 2.99 mmol, 1.0 equiv) and 3-(aminooxy)prop-1-yne hydrochloride (1.608 g, 14.95 mmol, 5.0 equiv), followed by pyridine (13.9 mL, 172 mmol, 57.5 equiv). 4M HCl in dioxane (7.48 mL, 29.9 mmol, 10 equiv) was added dropwise over 1 min and then the reaction was heated to 50° C. MeOH (3.5 mL, 86 mmol, 29 equiv) was added after the reaction mixture reached 50° C. and the solution was stirred for 72 h. The reaction mixture was concentrated under reduced pressure to ˜5 mL total volume before being added dropwise to H.sub.2O (50 mL). Solids precipitated from solution and then the mixture was decanted to remove the aqueous layer and the remaining material was washed with H.sub.2O (25 mL). The crude solid was dissolved in EtOAc (50 mL) and washed with 1M HCl (25 mL), sat. NaHCO.sub.3(25 mL), and brine (25 mL). The organic phase was concentrated under reduced pressure to provide a yellow foam. Purification by chromatography on silica gel (0.fwdarw.60% EtOAc/hexanes) afforded the product as a yellow foam (1.49 g, 45% yield, mixture of E/Z isomers). LCMS (ESI) m/z: [M+H] calc for C.sub.54H.sub.84N.sub.2O.sub.13: 969.61; found 969.8.

Monomer 7. Synthesis of 32(R)-hydroxy-26-O-(2-(2-(2-(prop-2-yn-1-yloxy)ethoxy)ethoxy)ethyl) oxime rapamycin

[0974] ##STR00705##

[0975] To a solution of 32(R)-hydroxy rapamycin (1.0 equiv) and O-(2-(2-(2-(prop-2-yn-1-yloxy)ethoxy)ethoxy)ethyl)hydroxylamine hydrochloride (5.0 equiv) in pyridine is added dropwise HCl in 1,4-dioxane (7.0 equiv) over 1 min. The reaction mixture is heated at 50° C. During the reaction course, additional O-(2-(2-(2-(prop-2-yn-1-yloxy)ethoxy)ethoxy) ethyl)hydroxylamine hydrochloride (1.0 equiv) and HCl in 1,4-dioxane (5.0 equiv) are added after the reaction is cooled to room temperature. The reaction mixture is again heated at 50° C. and stirred until consumption of 32(R)-hydroxy rapamycin. The reaction mixture is then added dropwise into H.sub.2O and cooled to 0° C. The resulting solid is filtered off, washed with H.sub.2O, and purified by silica gel chromatography to afford product.

Monomer 8. Synthesis of 28(R)—O-(5-hexynyl) rapamycin

[0976] ##STR00706##

[0977] The synthesis proceeds first by the alkylation of C40-O-TBDMS protected rapamycin with hex-5-yn-1-yl trifluoromethanesulfonate and DIPEA and then desilation under acidic conditions with an acetic acid/THF/H.sub.2O solution.

[0978] Reference for preparation of C40-O-TBDMS protected rapamycin: Abel, M.; Szweda, R.; Trepanier, D.; Yatscoff, R. W.; Foster, R. T. 2004. Rapamycin carbohydrate derivatives. WO 2004/101583. Isotechnica International Inc., which is incorporated by reference in its entirety.

Monomer 9. Synthesis of 40(R)—O-(3-(2-ethynylpyrimidin-5-yl)propyl) rapamycin

[0979] ##STR00707##

[0980] To a dry reaction vessel is added 3-(2-ethynylpyrimidin-5-yl)propyl trifluoromethanesulfonate (4.0 equiv) followed by anhydrous DCM. The mixture is purged with N2 and cooled to sub-ambient temperature before addition of 2,6-di-tert-butyl-4-methylpyridine (2.0 equiv) as a solid in one portion. Rapamycin (1.0 equiv) is then added as a solid in one portion. The reaction is stirred and, upon consumption of rapamycin, diluted with DCM and washed with sat. aqueous NaHCO.sub.3 solution. The organic layer is washed with sat. aq. NaCl, dried over Na.sub.2SO.sub.4, filtered and concentrated to dryness. The crude product mixture was purified by silica gel chromatography to afford product.

Monomer 10. Synthesis of 32(R)-hydroxy 26-O-(p-ethynylbenzyl) oxime rapamycin

[0981] ##STR00708##

Step 1: Synthesis of 2-[(4-ethynylbenzyl)oxy]-1H-isoindole-1,3(2H)-dione

[0982] A mixture of N-hydroxyphthalimide (1.94 g, 11.9 mmol, 1.05 equiv), triphenylphosphine (3.12 g, 11.9 mmol, 1.05 equiv), and (4-ethynylphenyl)methanol (1.50 g, 11.3 mmol, 1.0 equiv) in THF (28.2 mL) at 0° C. was treated with DIAD (2.35 mL, 11.9 mmol, 1.05 equiv) dropwise over 5 min. The reaction mixture turned yellow and became homogenous during the addition. The yellow reaction mixture was stirred for 5 min before being warmed to room temperature. A precipitate formed as the reaction proceeded. After stirring overnight, HPLC indicated the starting material had been consumed. The slurry was filtered and the resulting yellowish solid was washed twice with MTBE. The filtrate was concentrated to a solid that was triturated with MTBE. The solids were filtered off and washed again with MTBE. The combined solids were dried under reduced pressure to afford the product (2.66 g) as a yellow solid that was of sufficient purity for use in the next step. LCMS (ESI) m/z: [M+Na] calcd for C.sub.17H.sub.11NO.sub.3: 300.06; found 300.0.

Step 2: Synthesis of 1-[(aminooxy)methyl]-4-ethynylbenzene hydrochloride

[0983] A slurry of 2-[(4-ethynylbenzyl)oxy]-1H-isoindole-1,3(2H)-dione (2.66 g, 9.59 mmol, 1.0 equiv) in DCM (25.0 mL) was treated with N-methylhydrazine (0.510 mL, 9.59 mmol, 1.0 equiv) at room temperature. The reaction mixture turned dark yellow and remained a slurry. After 30 min, HPLC indicated the starting material had been consumed and a new product was present. The mixture was cooled to 0° C., stirred for 10 min, and the solids were filtered, and the filter cake was washed with cold DCM. The filtrate was concentrated and diluted with MTBE. Any solids that formed were filtered and washed with MTBE. The combined filtrate was treated with 2.0M HCl in ether (4.80 mL, 9.59 mmol) dropwise to give a thick, yellow slurry. After stirring for 5 min the HCl salt was filtered, washed with MTBE, and dried under the nitrogen press to afford the product as a light yellow solid that was suitable for use in the next step.

Step 3: Synthesis of 32(R)-hydroxy 26-O-(p-ethynylbenzyl) oxime rapamycin

[0984] A solution of 32(R)-hydroxy rapamycin (930.0 mg, 1.015 mmol, 1.0 equiv) in pyridine (4.7 mL) was treated with 1-[(aminooxy)methyl]-4-ethynylbenzene hydrochloride (745.6 mg, 4.060 mmol, 4.0 equiv) followed by pyridine hydrochloride (1.173 g, 10.15 mmol, 10.0 equiv) in one portion. The reaction mixture was heated to 45° C. for 48 h at which point HPLC indicated the starting material had been consumed. The mixture was added dropwise to H.sub.2O (50 mL), yielding a gummy mixture. The mixture was extracted with EtOAc (3×25 mL) and the combined organic phases were washed with 25 mL portions of 1M HCl, sat. NaHCO.sub.3 solution, and brine. The solution was dried over Na.sub.2SO.sub.4, filtered, and concentrated to yield the crude product. The residue was absorbed onto C18 silica gel and purified by reverse phase combiflash chromatography (150 g RP column eluting with MeCN/H.sub.2O w/0.1% formic acid, both solvents cooled in an ice bath) to yield the product as a yellow oil that was a mixture of E/Z isomers. The product was taken up in 95% aq MeCN and lyophilized to yield an off white solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.60H.sub.88N.sub.2O.sub.13: 1045.64; found 1045.5.

Monomer 11. Synthesis of 40(S)—N-propargylcarbamate rapamycin

[0985] ##STR00709##

[0986] Alkyne-containing monomer can be prepared from the previously reported rapamycin C40-epi-amine by reacting with propargyl chloroformate as shown above.

[0987] Reference for preparation of rapamycin C40-epi-amine: Or, Y. S.; Luly, J. R.; Wagner, R. 1996. Macrolide Immunomodulators. U.S. Pat. No. 5,527,907. Abbott Laboratories, which is incorporated by reference in its entirety.

Monomer 12. Synthesis of 32(R)-methoxy 26-O-(p-ethynylbenzyl) oxime rapamycin

[0988] ##STR00710##

[0989] To a solution of 32(R)-methoxy rapamycin in pyridine is added 1-[(aminooxy)methyl]-4-ethynylbenzene hydrochloride followed by solid pyridine hydrochloride in one portion. The reaction mixture is heated at 45° C. until the starting material is consumed, as indicated by HPLC analysis. The mixture is added dropwise to H.sub.2O, yielding a gummy mixture. The mixture is extracted with three portions of EtOAc and the combined organic phase is washed with 1M HCl, sat. NaHCO.sub.3 solution, and brine. The solution was dried over Na.sub.2SO.sub.4, filtered, and concentrated to yield the crude product. The residue is absorbed onto C18 silica gel and purified by reverse phase combiflash chromatography to yield the product.

Monomer 13. Synthesis of 40-O-propargyl sulfamidecarbamate rapamycin

[0990] ##STR00711##

[0991] The monomer can be prepared from the previously described chlorosulfonamide as shown above.

[0992] Reference for formation and reaction of the chlorosulfonamide derivative: Sun, C. L.; Li, X. 2009. Rapamycin analogs as anti-cancer agents. WO 2009/131631. Poinard Pharmaceuticals Inc., which is incorporated by reference in its entirety.

Monomer 14

[0993] ##STR00712##

Step 1: Synthesis of 1-(4-(5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidin-2-yl)piperazin-1-yl)pent-4-yn-1-one

[0994] Potassium t-butoxide (411 mg, 3.67 mmol, 1.2 equiv) was dissolved in MeOH (15 mL) and then 2-(piperazin-1-yl)-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidine (1 g, 3.06 mmol, 1 equiv) was added to free base the salt. The reaction stirred for 15 min and then was concentrated to a yellow solid. The solid and 4-pentynoic acid (329 mg, 3.36 mmol, 1.1 equiv) were dissolved in DMF (15.3 mL). Then DIPEA (2.65 mL, 15.3 mmol, 5 equiv) was added and the reaction was cooled to 0° C. Next diphenylphosphoryl azide (924 mg, 3.36 mmol, 1.1 equiv) was added. The reaction stirred for 1 h at 0° C. The reaction was diluted with. EtOAc, washed with brine, dried over Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure to afford the product as a white solid (1.6 g, 83% yield). LCMS (ESI) m/z: [M+H] calcd for C.sub.19H.sub.27BN.sub.4O.sub.3: 371.23; found 371.1.

Step 2: Synthesis of 1-(4-(5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidin-2-yl)piperazin-1-yl)-5-(trimethylsilyl)pent-4-yn-1-one

[0995] Zinc triflate (3.52 g, 9.71 mmol, 2.4 equiv) was placed into a vial and placed under a nitrogen balloon: Next DCM (8.10 mL) was added followed by triethylamine (2.24 mL, 16.2 mmol, 4 equiv). The reaction was heated at 30° C. for 30 min. Then 1-(4-(5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidin-2-yl)piperazin-1-yl)pent-4-yn-1-one (1.5 g, 4.05 mmol, 1 equiv) was dissolved in DCM (8.10 mL) and added to the reaction. The reaction stirred for 1 h and then chlorotrimethylsilane (2.04 mL, 16.2 mmol, 4 equiv) was added. The reaction stirred at 30° C. for 2 h. The reaction was diluted with DCM, washed with NH.sub.4Cl, Na.sub.2CO.sub.3, and brine, dried over Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure to afford the product as an orange solid (1.2 g, 66% yield). LCMS (ESI) m/z: [M+H] calcd for C.sub.22H.sub.35BN.sub.4O.sub.3Si: 443.26; found 443.2.

Step 3: Coupling of substituted pyrimidinylpiperazine to Intermediate 2

[0996] Intermediate 2 (0.35 g, 0.3120 mmol, 1 equiv) and 1-(4-(5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidin-2-yl)piperazin-1-yl)-5-(trimethylsilyl)pent-4-yn-1-one (172 mg, 0.3899 mmol, 1.25 equiv) were dissolved in dioxane (3.11 mL). Next XPhos Pd G2 (98.1 mg, 0.1248 mmol, 0.4 equiv) and silver(I) oxide (216 mg, 0.936 mmol, 3 equiv) were added. The reaction was heated to 60° C. for 24 h. The reaction was concentrated under reduced pressure and the crude reaction mixture purified by silica gel chromatography (0.fwdarw.10% MeOH/DCM) to yield the product as a brown solid (0.425 g, 100% yield). LCMS (ESI) m/z: [M+H] calcd for C.sub.75H.sub.106N.sub.8O.sub.13Si: 1355.77; found 1355.8.

Step 4: Desilylation

[0997] To a solution of rapamycin TMS alkyne (0.425 g, 0.3137 mmol, 1 equiv) in THF (3.13 mL) in a plastic vial was added pyridine (2.09 mL). The reaction was cooled to 0° C. in an ice bath. Next HF-pyridine (70:30) (731 μL, 28.2 mmol, 90 equiv) was added. The reaction stirred at 0° C. for 10 min and then was stirred at room temperature for 4 h. The reaction was dripped into a cooled (0° C.) NaHCO.sub.3 solution, extracted with EtOAc, washed with NaHCO.sub.3 and brine, dried over Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure. Purification by chromatography on silica gel (0.fwdarw.10% MeOH/DCM) afforded the product as a brown solid (0.21 g, 52% yield). LCMS (ESI) m/z: [M+H] calcd for C.sub.72H.sub.98N.sub.8O.sub.13: 1283.73; found 1283.7.

Monomer 15. Synthesis of 40(S)—N.SUP.2.-propargyl-sufuric diamido rapamycin

[0998] ##STR00713##

[0999] A solution of 40(S)-azido rapamycin (1.0 equiv) and triphenylphosphine (1.0 equiv) in THF and H.sub.2O is prepared in a dry reaction vessel. The reaction is heated until consumption of azido-rapamycin as determined by LCMS and/or TLC analysis. The reaction is then cooled to room temperature and concentrated under reduced pressure. The reaction mixture is then suspended in anhydrous MeCN and to this suspension is added 3-methyl-1-(N-(prop-2-yn-1-yl)sulfamoyl)-1H-imidazol-3-ium trifluoromethanesulfonate (1.5 equiv.) and triethylamine (5.0 equiv). The reaction is heated until the starting material was consumed and then cooled to room temperature, diluted with H.sub.2O and EtOAc. The reaction mixture is transferred to a separatory funnel, and the organic layer is washed with brine. The organic layer is dried over Na.sub.2SO.sub.4, filtered, concentrated under reduced pressure and then purified by silica gel chromatography to afford product.

Monomer 16

[1000] ##STR00714##

Step 1: Synthesis of 2-(4-(but-3-yn-1-ylsulfonyl)piperazin-1-yl)-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidine

[1001] A solution of 2-(piperazin-1-yl)-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidine (1.6 g, 4.90 mmol, 1.0 equiv) and triethylamine (2.72 mL, 19.6 mmol, 4.0 equiv) in DCM (24.5 mL) was stirred at 0° C. for 15 min. But-3-yne-1-sulfonyl chloride (640 μL, 5.88 mmol, 1.2 equiv) was then added dropwise into the reaction. The reaction was allowed to warm to room temperature and stirred for 18 h. The reaction was diluted with DCM, washed with H.sub.2O and then brine, dried over Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure. Purification by chromatography on silica gel (0.fwdarw.50% EtOAc/heptane) afforded the product as a white solid (0.768 g, 39% yield). LCMS (ESI) m/z: [M+H] calcd for C.sub.18H.sub.27BN.sub.4O.sub.4S: 407.19; found 407.1.

Step 2: Synthesis of 5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-2-(4-((4-(trimethylsilyl)but-3-yn-1-yl)sulfonyl)piperazin-1-yl)pyrimidine

[1002] A mixture of zinc triflate (1.38 g, 3.81 mmol, 24.0 equiv) and triethylamine (885 μL, 6.36 mmol, 4.0 equiv) in DCM (3.18 mL) was stirred at 30° C. for 30 min. A solution of 2-(4-(but-3-yn-1-ylsulfonyl)piperazin-1-yl)-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidine (0.650 g, 1.59 mmol, 1.0 equiv) in DCM (3.18 mL) was added to the reaction. The reaction was stirred for 1 h at 30° C. and then chlorotrimethylsilane (806 μL, 6.36 mmol, 4.0 equiv) was added. The reaction mixture was stirred at 30° C. for an additional 6 h, at which point the reaction was diluted with DCM, was washed with NH.sub.4Cl and brine, dried over Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure. Purification by chromatography on silica gel (0.fwdarw.50% EtOAc/heptane) afforded the product as a white solid (0.433 g, 57% yield). LCMS (ESI) m/z: [M+H] calcd for C.sub.21H.sub.35BN.sub.4O.sub.4SSi: 479.23; found 479.2.

Step 3: Coupling of Substituted Pyrimidinylpiperazine to Intermediate 2

[1003] Intermediate 2 (0.35 g, 0.3120 mmol, 1 equiv) and 5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-2-(4-((4-(trimethylsilyl)but-3-yn-1-yl)sulfonyl)piperazin-1-yl)pyrimidine (186 mg, 0.3899 mmol, 1.25 equiv) were dissolved in dioxane (3.11 mL). Next XPhos Pd G2 (98.1 mg, 0.1248 mmol, 0.4 equiv) and silver(I) oxide (216 mg, 0.936 mmol, 3 equiv) were added. The reaction was heated at 60° C. for 24 h. The reaction was concentrated under reduced pressure and the crude reaction mixture purified by silica gel chromatography (0.fwdarw.10% MeOH/DCM) to yield the product as a brown solid (0.64 g, 100% yield). LCMS (ESI) m/z: [M+H] calcd for C.sub.74H.sub.106N.sub.8O.sub.14SSi: 1391.74; found 1391.6.

Step 4: Desilylation

[1004] To a solution of rapamycin TMS alkyne (0.64 g, 0.4601 mmol, 1 equiv) in THF (4.60 mL) in a plastic vial was added pyridine (3.06 mL). The reaction was cooled to 0° C. in an ice bath. Next HF-pyridine (70:30) (1.07 mL, 41.4 mmol, 90 equiv) was added. The reaction stirred at 0° C. for 10 min and then was stirred at room temperature for 4 h. The reaction was dripped into a cooled (0° C.) NaHCO.sub.3 solution, extracted with EtOAc, washed with NaHCO.sub.3 and brine, dried over Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure. Purification by chromatography on silica gel (0.fwdarw.10% MeOH/DCM) afforded the product as a brown solid (0.256 g, 42% yield). LCMS (ESI) m/z: [M+H] calcd for C.sub.71H.sub.98N.sub.8O.sub.14S: 1319.70; found 1319.6.

Monomer 17. Synthesis of 40(S)—O-(5-heptynyl) rapamycin

[1005] ##STR00715##

[1006] Alkyne-containing monomer can be prepared from the previously reported rapamycin C40 triflate derivative as shown above.

[1007] Reference for formation of triflate and displacement by alcohols: 1) Or, Y. S.; Luly, J. R.; Wagner, R. 1996. Macrolide immunomodulators. U.S. Pat. No. 5,527,907. Abbott Laboratories. 2) Rane, D. S.; Vyas, R. G. 2012. Process for preparation of 42-O-(heteroalkoxyalkyl) rapamycin compounds with anti-proliferative properties. WO 2012/017449. Meril Life Sciences PVT. LTD, which are incorporated by reference in their entirety.

Monomer 18

[1008] ##STR00716##

Step 1: Coupling of Substituted Pyrimidinylpiperazine to Intermediate 1

[1009] Intermediate 1 (0.4 g, 0.3698 mmol, 1 equiv) and 1-(4-(5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidin-2-yl)piperazin-1-yl)-5-(trimethylsilyl)pent-4-yn-1-one (204 mg, 0.462 mmol, 1.25 equiv) were dissolved in dioxane (3.69 mL). Next XPhos Pd G2 (116 mg, 0.1479 mmol, 0.4 equiv) and silver(I) oxide (254 mg, 1.10 mmol, 3 equiv) were added. The reaction was heated to 60° C. for 24 h. The reaction was concentrated under reduced pressure and the crude reaction mixture purified by silica gel chromatography (0.fwdarw.10% MeOH/DCM) to yield the product as a brown solid (0.377 g, 77% yield). LCMS (ESI) m/z: [M+H] calcd for C.sub.74H.sub.107N.sub.5O.sub.14Si: 1318.77; found 1318.6.

Step 2: Desilylation

[1010] To a solution of rapamycin TMS alkyne (0.377 g, 0.2860 mmol, 1 equiv) dissolved in THF (2.85 mL) in a plastic vial was added pyridine (1.90 mL). The reaction was cooled to 0° C. in an ice bath. Next HF-pyridine (70:30) (667 μL, 25.7 mmol, 90 equiv) was added. The reaction stirred at 0° C. for 10 min and then was stirred at room temperature for 4 h. The reaction was dripped into a cooled (0° C.) NaHCO.sub.3 solution, extracted with EtOAc, washed with NaHCO.sub.3 and brine, dried over Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure. Purification by chromatography on silica gel (0.fwdarw.10% MeOH/DCM) afforded the product as a brown solid (0.377 g, 77% yield). LCMS (ESI) m/z: [M+H] calcd for C.sub.71H.sub.99N.sub.5O.sub.14: 1246.73; found 1246.7.

Monomer 19. Synthesis of 40-O-(3-(2-propargyloxy)pyrimidin-5yl) rapamycin

[1011] ##STR00717##

[1012] To a solution of Intermediate 1 (1.0 equiv) and 5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-2-((3-(trimethylsilyl)prop-2-yn-1-yl)oxy)pyrimidine (3.0 equiv) in dioxane is added Ag.sub.2O (9.0 equiv) and XPhos Pd G2 (40 mol %). The reaction is capped and heated at 60° C. until full consumption of aryl bromide as determined by LCMS and/or TLC analysis. The reaction is then cooled to room temperature, filtered over Celite, and concentrated under reduced pressure. The crude product mixture is subsequently purified by silica gel chromatography to afford the silylated monomer.

Step 2

[1013] The product from the first reaction is dissolved in THF and pyridine. To this solution is added 70% HF-pyridine dropwise at 0° C. The reaction mixture is stirred at 0° C. and then warmed to room temperature. The reaction is stirred at room temperature and after LCMS analysis shows consumption of starting material the reaction mixture is cooled to 0° C. and poured slowly into ice cold sat. aq. NaHCO.sub.3. This aqueous layer is extracted with EtOAc and the organic layer is dried over Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure. This crude product mixture is purified to afford product.

Monomer 20

[1014] ##STR00718##

Step 1

[1015] To a solution of Intermediate 2 (1.0 equiv) and 5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-2-((3-(trimethylsilyl)prop-2-yn-1-yl)oxy)pyrimidine (3.0 equiv) in dioxane is added Ag.sub.2O (9.0 equiv) and XPhos Pd G2 (40 mol %). The reaction is capped and heated at 60° C. until full consumption of aryl bromide as determined by LCMS and/or TLC analysis. The reaction is then cooled to room temperature, filtered over Celite, and concentrated under reduced pressure. The crude product mixture is subsequently purified by silica gel chromatography to afford the silylated monomer.

Step 2

[1016] The product from the first reaction is dissolved in THF and pyridine. To this solution is added 70% HF-pyridine dropwise at 0° C. The reaction mixture is stirred at 0° C. and then warmed to room temperature. The reaction is stirred at room temperature and after LCMS analysis shows consumption of starting material the reaction mixture is cooled to 0° C. and poured slowly into ice cold sat. aq. NaHCO.sub.3. This aqueous layer is extracted with EtOAc and the organic layer is dried over Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure. This crude product mixture is purified to afford product.

Monomer 21

[1017] ##STR00719##

Step 1

[1018] To a solution of Intermediate 2 (1.0 equiv) and 5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-N-(3-(trimethylsilyl)prop-2-yn-1-yl)pyrimidin-2-amine (3.0 equiv) in dioxane is added Ag.sub.2O (9.0 equiv) and XPhos Pd G2 (40 mol %). The reaction is capped and heated to 60° C. until full consumption of aryl bromide as determined by LCMS and/or TLC analysis. The reaction is then cooled to room temperature, filtered over Celite, and concentrated under reduced pressure. The crude product mixture is subsequently purified by silica gel chromatography to afford silylated monomer.

Step 2

[1019] The product from the first reaction is dissolved in THF and pyridine. To this solution is added 70% HF-pyridine dropwise at 0° C. The reaction mixture is stirred at 0° C. and then warmed to room temperature. The reaction is stirred at room temperature and after LCMS analysis shows consumption of starting material the reaction mixture is cooled to 0° C. and poured slowly into ice cold sat. aq. NaHCO.sub.3. This aqueous layer is extracted with EtOAc and the organic layer is dried over Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure. The resultant mixture is purified to afford product.

Monomer 22. Synthesis of 40-O-(3-(2-(4-(but-3-yn-1-ylsulfonyl)piperazin-1-yl)pyrimidin-5-yl)benzyl) rapamycin

[1020] ##STR00720##

Step 1: Coupling of Substituted Pyrimidinylpiperazine to Intermediate 1

[1021] Intermediate 1 (0.35 g, 0.3226 mmol, 1.0 equiv) and 5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-2-(4-((4-(trimethylsilyl)but-3-yn-1-yl)sulfonyl)piperazin-1-yl)pyrimidine (192 mg, 0.403 mmol, 1.25 equiv) were charged to a reaction flask and dissolved in dioxane (3.22 mL). XPhosPd G2 (101 mg, 0.129 mmol, 0.4 equiv) and silver(I) oxide (224 mg, 0.968 mmol, 3.0 equiv) were then charged to the reaction, which was then heated at 60° C. for 24 h. The reaction was concentrated under reduced pressure and the crude reaction mixture purified by silica gel chromatography (0.fwdarw.10% MeOH/DCM) to yield the product as a brown solid (0.5 g, 100% yield). LCMS (ESI) m/z: [M+H] calcd for C.sub.73H.sub.107N.sub.5O.sub.15SSi: 1354.73; found 1354.7.

Step 2: Desilylation

[1022] To a solution of rapamycin TMS alkyne (0.5 g, 0.369 mmol) in THF (3.69 mL) and pyridine (2.46 mL) at 0° C. was added HF-pyridine (70:30) (861 μL, 33.2 mmol). The reaction was stirred at 0° ° C. for 10 min and then stirred at room temperature for 4 h. The reaction was dripped into a cooled (0° C.) NaHCO.sub.3 solution, extracted with EtOAc, washed with NaHCO.sub.3 and brine, dried over Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure. Purification by chromatography on silica gel (0.fwdarw.10% MeOH/DCM) afforded the product as a brown solid (0.25 g, 53% yield). LCMS (ESI) m/z: [M+H] calcd for C.sub.70H.sub.99N.sub.5O.sub.15S: 1282.69; found 1282.6.

Monomer 23. Synthesis of 40(S)-(1-(5-(3-(1,2,3-triazol-5-yl)phenyl)-2-(4-(prop-2-yn-1-yl)piperazin-1-yl)pyrimidine rapamycin

[1023] ##STR00721##

Step 1: Coupling of Substituted Pyrimidinylpiperazine to Intermediate 2

[1024] Intermediate 2 (0.4 g, 0.358 mmol, 1.0 equiv) and TMS-2-(4-(prop-2-yn-1-yl)piperazin-1-yl)-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidine (178 mg, 0.447 mmol, 1.25 equiv) were dissolved in dioxane (3.57 mL). Next, silver(I) oxide (247 mg, 1.07 mmol, 3.0 equiv) and XPhosPd G2 (112 mg, 0.143 mmol, 0.4 equiv) were added. The reaction was heated at 60° C. for 24 h. The reaction was diluted with EtOAc, washed with NH.sub.4Cl and brine, dried over Na.sub.2SO.sub.4, filtered, and concentrated to a foam. The foam was purified by silica gel chromatography (0.fwdarw.5% MeOH/DCM) to yield the crude product as a brown solid (0.4 g, 86% yield). LCMS (ESI) m/z: [M+H] calcd for C.sub.73H.sub.104N.sub.8O.sub.12Si: 1313.76; found 1313.9.

Step 2: Desilylation

[1025] Rapamycin TMS alkyne (0.350 g, 0.266 mmol, 1.0 equiv) was dissolved in THF (2.65 mL) and pyridine (1.77 mL) in a plastic vial. The reaction was cooled to 0° C. in an ice bath. Next HF-pyridine (70:30) (412 μL, 15.9 mmol, 60.0 equiv) was added. The reaction was stirred at 0° C. for 10 min and then stirred at room temperature for 5 h. The reaction was dripped into a cooled (0° C.) NaHCO.sub.3 solution, extracted with EtOAc, washed with NaHCO.sub.3 and brine, dried over Na.sub.2SO.sub.4, filtered, and concentrated to an oil. The oil was purified by silica gel chromatography (0.fwdarw.10% MeOH/DCM) to yield the product as a brown solid (0.292 g, 88% yield). LCMS (ESI) m/z: [M+H] calcd for C.sub.70H.sub.96N.sub.8O.sub.12: 1241.72; found 1241.7.

Monomer 24. Synthesis of 40-O-(3-(2-(4-(prop-2-yn-1-yl)piperazin-1-yl)pyrimidin-5-yl)benzyl) rapamycin

[1026] ##STR00722##

Step 1: Synthesis of 2-(piperazin-1-yl)-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidine hydrochloride

[1027] To a solution of tert-butyl 4-(5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidin-2-yl)piperazine-1-carboxylate (2 g, 5.12 mmol, 1 equiv) in dioxane (8.73 mL) was added HCl (4M in dioxane) (12.8 mL, 51.2 mmol, 10 equiv). The reaction stirred for 2 h at room temperature and concentrated to a solid. The crude material was suspended in DCM and concentrated under reduced pressure twice and then dried under reduced pressure for 18 h to yield the product as a yellow solid (1.7 g, 100% yield). LCMS (ESI) m/z: [M+H] calcd for C.sub.14H.sub.23BN.sub.4O.sub.2: 291.19; found 291.1.

Step 2: Synthesis of 5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-2-(4-(3-(trimethylsilyl)prop-2-yn-1-yl)piperazin-1-yl)pyrimidine

[1028] Potassium t-butoxide (452 mg, 4.03 mmol, 1.2 equiv) was dissolved in MeOH (10 mL) and then 2-(piperazin-1-yl)-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidine (1.1 g, 3.36 mmol, 1 equiv) was added. The reaction stirred for 15 min at room temperature and then was concentrated to a yellow solid. The yellow solid and 3-(trimethylsilyl)propargyl bromide (602 μL, 3.69 mmol, 1.1 equiv) were suspended in MeCN (13.4 mL). Next potassium carbonate (649 mg, 4.70 mmol, 1.4 equiv) was added. The reaction was stirred at room temperature for 24 h. The reaction was diluted with EtOAc, washed with NH.sub.4C1 and brine, dried over Na.sub.2SO.sub.4, filtered, and concentrated to a foam. The foam was purified by silica gel chromatography (0.fwdarw.50% EtOAc/heptane) to yield the product as a white solid (0.350 g, 25% yield). LCMS (ESI) m/z: [M+H] calcd for C.sub.20H.sub.33BN.sub.4O.sub.2Si: 401.25; found 401.1.

Step 3: Coupling of Substituted Pyrimidinylpiperazine to Intermediate 1

[1029] Intermediate 1 (0.37 g, 0.3419 mmol, 1 equiv) and TMS-2-(4-(prop-2-yn-1-yl)piperazin-1-yl)-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidine (171 mg, 0.4273 mmol, 1.25 equiv) were dissolved in dioxane (3.41 mL). Next, silver(I) oxide (236 mg, 1.02 mmol, 3 equiv) and XPhosPd G2 (107 mg, 0.1367 mmol, 0.4 equiv) were added. The reaction was heated to 60° C. for 24 h. The reaction was diluted with EtOAc, washed with NH.sub.4Cl and brine, dried over Na.sub.2SO.sub.4, filtered, and concentrated to a foam. The foam was purified by silica gel chromatography (0.fwdarw.5% MeOH/DCM) to yield the product as a brown solid (0.230 g, 50% yield). LCMS (ESI)m/z: [M+H] calcd for C.sub.72H.sub.105N.sub.5O.sub.13Si: 1276.75; found 1276.6.

Step 4: Desilylation

[1030] Rapamycin TMS alkyne (0.232 g, 0.182 mmol, 1 equiv) was dissolved in THF and pyridine (606 μL) in a plastic vial. The reaction was cooled to 0° C. in an ice bath. Next HF-pyridine (70:30) (282 μL, 10.9 mmol, 60 equiv) was added. The reaction stirred at 0° C. for 10 min and then at room temperature for 3 h. The reaction was dripped into a cooled (0° C.) NaHCO.sub.3 solution, extracted with EtOAc, washed with NaHCO.sub.3 and brine, dried over Na.sub.2SO.sub.4, filtered, and concentrated to an oil. The oil was purified by silica gel chromatography (0.fwdarw.10% DCM/MeOH) to yield the product as a yellow solid (0.130 g, 60% crude yield). LCMS (ESI) m/z: [M+Na] calcd for C.sub.69H.sub.97N.sub.5O.sub.13: 1226.70; found 1226.7.

Monomer 25. Synthesis of 16(S)-furanyl-40-O-(5-hexynyl) rapamycin

[1031] ##STR00723##

[1032] To a stirred solution of freshly purified hex-5-yn-1-yl trifluoromethanesulfonate (0.969 g, 4.21 mmol, 4.0 equiv) in DCM (4 mL) at 0° C. was added solid 2,6-di-tert-butyl-4-methylpyridine (0.432 g, 2.10 mmol, 2.0 equiv) in one portion. The light yellow mixture was stirred for 5 min before solid 16(S)-furanyl rapamycin (1.00 g, 1.05 mmol, 1.0 equiv) was added in one portion. The yellow reaction mixture was then allowed to warm to room temperature overnight. After 18 h the solution was diluted with DCM and washed with sat. aqueous NaHCO.sub.3 solution, brine, dried, and concentrated under pressure. Purification by silica gel chromatography (0.fwdarw.45% EtOAc/hexanes) provided the desired product (0.10 g, 9% yield) as a white foam. LCMS (ESI) m/z: [M+Na] calcd for C.sub.60H.sub.87NO.sub.13: 1052.61; found 1052.6.

Monomer 26. Synthesis of 16(S)-methyl carbamate-40-O-(5-hexynyl) rapamycin

[1033] ##STR00724##

[1034] To a stirred solution of freshly purified hex-5-yn-1-yl trifluoromethanesulfonate (0.416 g, 1.81 mmol, 4.0 equiv) in 2.0 mL of DCM at 0° C. was added solid 2,6-di-tert-butyl-4-methylpyridine (0.278 g, 1.35 mmol 3.0 equiv) in one portion. The light yellow mixture was stirred for 5 min before solid 16(S)-methyl carbamate rapamycin (0.425 g, 0.444 mmol, 1.0 equiv) was added in one portion. The yellow reaction mixture was then allowed to warm to room temperature. After 18 h the reaction mixture was diluted with EtOAc and filtered through Celite. The filtrate was washed with sat. aqueous NaHCO.sub.3 solution, brine, dried, and concentrated under reduced pressure. Purification by silica gel chromatography (0.fwdarw..fwdarw.30% acetone/hexanes) provided the desired product (0.12 g, 26% yield) as a white foam. LCMS (ESI) m/z: [M+Na] calcd for C.sub.58H.sub.88N.sub.2O.sub.14: 1059.61; found 1059.5.

Monomers 27 and 28

[1035] ##STR00725##

Step 1

[1036] To a dry reaction flask is added CIG-modified rapamycin (1.0 equiv) followed by heptanes and DCM. 3-Bromobenzyl bromide (8.0 equiv) and silver(I) oxide (12.0 equiv) are added to the solution and the reaction flask is capped and heated until full consumption of C.sub.16-modified rapamycin, as determined by LCMS analysis. The reaction is then cooled to room temperature, diluted with EtOAc, filtered through Celite, and concentrated under reduced pressure. The resultant residue is purified by silica gel chromatography to afford the product of Step 1.

Step 2

[1037] The product of step 1 (1.0 equiv) is dissolved in dioxane. To this solution is added the pinacol boronate substrate (3.0 equiv), followed by Ag.sub.2O (9.0 equiv) and XPhos Pd G2 (40 mol %). The reaction is capped and heated until consumption of the rapamycin-based starting material. At this point, the reaction mixture is cooled to room temperature, filtered over Celite, and concentrated under reduced pressure. The resultant residue is purified by silica gel chromatography to afford the product of step 2.

Step 3

[1038] The product of step 2 (1.0 equiv) is dissolved in THF and pyridine and cooled to 0° C. 70% HF-pyridine is added dropwise to the reaction. Following complete addition, the reaction is stirred at 0° C. and then at room temperature. Upon reaction completion, as determined by LCMS analysis, the reaction is cooled to 0° C. and poured slowly into ice cold sat. aq. NaHCO.sub.3. This aqueous layer is extracted with EtOAc and the organic layer is dried over Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure. This crude product mixture is purified to afford product.

Monomer 29. Synthesis. of 40-O-(3-(2-(3-(hydroxymethyl)-4-(prop-2-yn-1-yl)piperazin-1-yl)pyrimidin-5-yl)benzyl) rapamycin

[1039] ##STR00726## ##STR00727##

Step 1: Synthesis of tert-butyl 2-(((tert-butyldiphenylsilyl)oxy)methyl)piperazine-1-carboxylate

[1040] To a solution of tert-butyl 2-(hydroxymethyl)piperazine-1-carboxylate (5 g, 23.1 mmol, 1.0 equiv) in DCM (12.8 mL) was added tert-butyl(chloro)diphenylsilane (7.61 g, 27.7 mmol, 1.2 equiv) and imidazole (3.45 g, 50.8 mmol, 2.2 equiv). The reaction stirred for 18 h at room temperature. The reaction was loaded directly onto a silica gel column and purified by normal phase chromatography (0.fwdarw.10% MeOH/DCM) to yield the product as a white solid (10 g, 95% yield). LCMS (ESI) m/z: [M+H] calcd for C.sub.26H.sub.38N.sub.2O.sub.3Si: 455.27; found 455.2.

Step 2: Synthesis of tert-butyl 4-(5-bromopyrimidin-2-yl)-2-(((tert-butyldiphenylsilyl)oxy)-methyl)piperazine-1-carboxylate

[1041] 2,5-Dibromopyrimidine (4.32 g, 18.2 mmol, 1.0 equiv) and tert-butyl 2-(((tert-butyldiphenylsilyl)oxy)methyl)piperazine-1-carboxylate (10 g, 21.9 mmol, 1.2 equiv) were dissolved in MeCN (91.0 mL). Next potassium carbonate (5.04 g, 36.5 mmol, 2.0 equiv) was added. The reaction was heated at 75° C. for 4 h. The reaction was then filtered and concentrated under reduced pressure to a white foam. The foam was purified by silica gel chromatography (0.fwdarw.5% EtOAc/heptane) to yield the product as a white solid (10.2 g, 92% yield). LCMS (ESI) m/z: [M+H] calcd for C.sub.30H.sub.39BrN.sub.4O.sub.3Si: 611.20; found 611.0.

Step 3: Synthesis of tert-butyl 2-(((tert-butyldiphenylsilyl)oxy)methyl)-4-(5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidin-2-yl)piperazine-1-carboxylate

[1042] To a solution of tert-butyl 4-(5-bromopyrimidin-2-yl)-2-(((tert-butyldiphenylsilyl)oxy)-methyl)piperazine-1-carboxylate (8.2 g, 13.4 mmol, 1.0 equiv) and bis(pinacolato)diboron (5.07 g, 20.0 mmol, 1.5 equiv) in dioxane (107 mL) was added potassium acetate (3.93 g, 40.1 mmol, 3.0 equiv) and bis(triphenylphosphine)palladium(II) dichloride (1.88 g, 2:68 mmol, 0.2 equiv). The reaction was heated to 80° C. for 6 h. The reaction was diluted with EtOAc, washed with NH.sub.4Cl and brine, dried over Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure. Purification by chromatography on silica gel (0.fwdarw.30% EtOAc/heptane) afforded the product as a white solid (7.6 g, 69% yield). LCMS (ESI) m/z: [M+H] calcd for C.sub.36H.sub.51BN.sub.4O.sub.5Si: 659.38; found 659.3.

Step 4: Synthesis of 2-(3-(((tert-butyldiphenylsilyl)oxy)methyl)piperazin-1-yl)-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidine hydrochloride

[1043] tert-Butyl 2-(((tert-butyldiphenylsilyl)oxy)methyl)-4-(5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidin-2-yl)piperazine-1-carboxylate (7.6 g, 11.5 mmol, 1.0 equiv) was dissolved in dioxane (19.6 mL). Next HCl (4M in dioxane) (28.5 mL, 114 mmol, 10.0 equiv) was added. the reaction stirred for 2 h and then concentrated under reduced pressure to a solid. The solid was suspended in DCM and concentrated twice under reduced pressure. The solid was then dried under reduced pressure for 18 h to yield the product as a yellow solid (8.22 g, 100% yield). LCMS (ESI) m/z: [M+H] calcd for C.sub.31H.sub.43BN.sub.4O.sub.3Si: 559.32; found 559.2.

Step 5: Synthesis of 2-(3-(((tert-butyldiphenylsilyl)oxy)methyl)-4-(3-(trimethylsilyl)prop-2-yn-1-yl)piperazin-1-yl)-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidine

[1044] To a solution of potassium t-butoxide (123 mg, 1.10 mmol, 1.2 equiv) in MeOH (10 mL) was added 2-(3-(((tert-butyldiphenylsilyl)oxy)methyl)piperazin-1-yl)-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidine hydrochloride (1.5 g, 2.52 mmol, 1.0 equiv). The reaction was stirred for 15 min and was concentrated under reduced pressure. The subsequent free based amine and 3-(trimethylsilyl)propargyl bromide (534 μL, 3.27 mmol, 1.3 equiv) were suspended in MeCN (10.0 mL). Potassium carbonate (1.04 g, 7.56 mmol, 3.0 equiv) was added to the reaction and the mixture was stirred at room temperature for 18 h. The reaction was filtered and the solid washed with EtOAc. The filtrate was concentrated and purified by silica gel chromatography (0.fwdarw.50% EtOAc/heptane) to yield the product as a white solid (0.77 g, 46% yield). LCMS (ESI) m/z: [M+H] calcd for C.sub.37H.sub.53BN.sub.4O.sub.3Si.sub.2: 669.38; found 669.3.

Step 6: Coupling of Substituted Pyrimidinylpiperazine to Intermediate 1

[1045] Intermediate 1 (0.35 g, 0.323 mmol, 1 equiv) and 2-(3-(((tert-butyldiphenylsilyl)oxy)methyl)-4-(3-(trimethylsilyl)prop-2-yn-1-yl)piperazin-1-yl)-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidine (269 mg, 0.403 mmol, 1.25 equiv) were dissolved in dioxane (3.22 mL). Next XPhosPd G2 (101 mg, 0.129 mmol, 0.4 equiv) and silver(I) oxide (224 mg, 0.968 mmol, 3 equiv) were added. The reaction was heated to 60° C. for 24 h. The reaction was diluted with EtOAc, washed with NH.sub.4Cl and brine, dried over Na.sub.2SO.sub.4, filtered, and concentrated to a foam. The foam was purified by silica gel chromatography (0.fwdarw.10% MeOH/DCM) to yield the product as a brown solid (0.350 g, 70% yield). LCMS (ESI) m/z: [M+H] calcd for C.sub.89H.sub.125N.sub.5O.sub.14Si.sub.2: 1544.88; found 1544.90.

Step 7: Desilylation

[1046] To a solution of rapamycin TMS alkyne (0.5 g, 0.3235 mmol, 1 equiv) in THF (3.23 mL) and pyridine (2.15 mL) at 0° C. was added HF-pyridine (70:30) (755 μL, 29.1 mmol, 90 equiv). The reaction stirred at 0° C. for 10 min and then stirred at room temperature for 6 h. The reaction was dripped into a cooled (0° C.) NaHCO.sub.3 solution, extracted with EtOAc, washed with NaHCO.sub.3 and brine, dried over Na.sub.2SO.sub.4, filtered, and concentrated understood an oil. The oil was purified by silica gel chromatography (0%.fwdarw.10% MeOH/DCM) to yield the product as a brown solid (0.115 g, 29% yield). LCMS (ESI) m/z: [M+H] calcd for C.sub.70H.sub.99N.sub.5O.sub.14: 1234.72; found 1234.7.

Monomer 30

[1047] ##STR00728##

Step 1: Coupling of Substituted Pyrimidinylpiperazine to Intermediate 2

[1048] Intermediate 2 (0.4 g, 0.3576 mmol, 1.0 equiv) and 2-(3-(((tert-butyldiphenylsilyl)oxy)methyl)-4-(3-(trimethylsilyl)prop-2-yn-1-yl)piperazin-1-yl)-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidine (298 mg, 0.447 mmol, 1.25 equiv) were dissolved in dioxane (3.57 mL). Next XPhosPd G2 (112 mg, 0.143 mmol, 0.4 equiv) and silver(I) oxide (247 mg, 1.07 mmol, 3.0 equiv) were added. The reaction was heated to 60° C. for 24 h. The reaction was diluted with EtOAc, washed with NH.sub.4C1 and brine, dried over Na.sub.2SO.sub.4, filtered, and concentrated to a foam. The foam was purified by silica gel chromatography (0.fwdarw.0.5% MeOH/DCM) to yield the product as a brown solid (0.530 g, 94% yield). LCMS (ESI) m/z: [M+H] calcd for C.sub.90H.sub.124N.sub.8O.sub.13Si.sub.2: 1581.89; found 1581.85.

Step 2: Desilylation

[1049] Rapamycin alkyne (0.55 g, 0.348 mmol, 1.0 equiv) was dissolved in THF (3.47 mL) and pyridine (2.31 mL) in a plastic vial. The reaction was cooled to 0° C. in an ice bath. Next HF-pyridine (70:30) (812 μL, 31.3 mmol, 90.0 equiv) was added. The reaction stirred at 0° C. for 10 min and then was stirred at room temperature for 6 h. The reaction was dripped into a cooled (0° C.) NaHCO.sub.3 solution, extracted with EtOAc, washed with NaHCO.sub.3 and brine, dried over Na.sub.2SO.sub.4, filtered, and concentrated to an oil. The oil was purified by silica gel chromatography (0.fwdarw.10% MeOH/DCM) to yield the product as a brown solid (0.530 g, 94% yield). LCMS (ESI) m/z: [M+H] calcd for C.sub.71H.sub.98N.sub.8O.sub.13: 1271.73; found 1271.6.

Monomers 74, 75, 31, and 32

[1050] ##STR00729##

Step 1

[1051] To a dry reaction flask is added C.sub.16-modified rapamycin (1.0 equiv) followed by 2,6-di-tert-butyl-4-methylpyridine (2.0 equiv) and DCM. The reaction is cooled to −10° C. and trifluoromethanesulfonic anhydride (1.2 equiv) is added dropwise to reaction. After stirring for 30 min, sodium azide (4.8 equiv) is added to the reaction as a solid in one portion. Upon full consumption of rapamycin starting material, the reaction is quenched slowly with sat. aq. NaHCO.sub.3 and allowed to warm to room temperature. The reaction mixture is transferred to a separatory funnel and the organic layer washed with sat. aq. NaCl. The organic layer is dried over Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure. The resultant residue is purified by silica gel chromatography to afford product of step 1.

Step 2

[1052] The product of step 1 (1.0 equiv) and triphenylphosphine (1.0 equiv) are dissolved in THF. H.sub.2O is added to solution. The reaction is heated until consumption of azido-rapamycin as determined by LCMS and/or TLC analysis. The reaction is then cooled to room temperature and concentrated under reduced pressure. The resulting residue is purified by silica gel chromatography to afford the product of step 2, namely either monomer depending on choice of starting material.

Step 3

[1053] The product of step 2 is then suspended in anhydrous MeCN and to this suspension is added propargyl chloroformate (1.5 equiv) and triethylamine (5.0 equiv). The reaction is heated and monitored by TLC and LCMS. Upon completion of reaction, the reaction is diluted with H.sub.2O and EtOAc. The reaction mixture is transferred to a separatory funnel, and the organic layer is washed with brine. The organic layer is dried over Na.sub.2SO.sub.4, filtered, concentrated under reduced pressure and then purified by silica gel chromatography to afford product, namely either monomer depending on choice of starting material.

Monomer 33. Synthesis of 40-O-(3′-ethynyl-[1,1′-biphenyl]-3-yl) rapamycin

[1054] ##STR00730##

[1055] The synthesis is carried out by Suzuki cross-coupling of Intermediate 1 with trimethyl((3-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)phenyl)ethynyl)silane, followed by TMS-cleavage using HF-pryidine to give the titled Monomer.

Monomer 34. Synthesis of 40(S)-(1-(5-(3′-ethynyl-[1,1′-biphenyl]-3-yl)-1,2,3-triazole) rapamycin

[1056] ##STR00731##

Step 1: Coupling of trimethyl((3-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)phenyl)ethynyl)silane to Intermediate 2

[1057] To an oven-dried reaction flask was added Intermediate 2 (0.10 g, 89.2 μmol, 1 equiv) followed by dioxane (900 μL). Trimethyl((3-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)phenyl)ethynyl)silane (80.1 mg, 267 μmol, 3.0 equiv), XPhos Pd G2 (28.0 mg, 35.6 μmol, 0.4 equiv), and silver(I) oxide (185 mg, 802 μmol, 9.0 equiv) were sequentially added to the reaction solution. The reaction mixture was heated to 60° C. until full consumption of the starting material, as determined by LCMS analysis. The reaction mixture was cooled to room temperature, diluted with EtOAc (2 mL), and filtered through a plug of Celite. The filtrate was concentrated under reduced pressure to provide a brown oil. Purification by normal phase chromatography (0.fwdarw.55% EtOAc/heptanes) provided a white solid (41.9 mg, 39% yield). LCMS (ESI) m/z: [M+H] calcd for C.sub.70H.sub.96N.sub.4O.sub.12Si: 1213.69; found 1213.7.

Step 2: Desilylation

[1058] To a plastic vial was added the product of step 1 (30 mg, 24.7 μmol, 1 equiv), THF (493 μL), and pyridine (82 μL). The reaction solution was cooled to 0° C. and then HF-pyridine (38.3 μL, 1.5 mmol, 1.5 equiv) was added. The reaction solution was stirred at 0° C. for 10 min and then stirred at room temperature until full consumption of the starting material, as determined by LC-MS analysis. The reaction solution was poured into a saturated solution of NaHCO.sub.3 at 0° C. The resulting solution was extracted with EtOAc (3×10 mL), and the organic layers were washed with sat. NaHCO.sub.3 and brine, dried with Na.sub.2SO.sub.4, and filtered. The filtrate was concentrated under reduced pressure to provide an oil. Purification by normal phase chromatography (0.fwdarw.60% EtOAc/heptane) provided a white solid (10.4 mg, 37% yield). LCMS (ESI) m/z: [M+H] calcd for C.sub.67H.sub.88N.sub.4O.sub.12: 1141.65; found 1141.6.

Monomer 35. Synthesis of 40(R)—O-(propargyl carbamate) rapamycin

[1059] ##STR00732##

[1060] A solution of 40(R) 4-nitrophenyl carbonate rapamycin (2.42 g, 2.24 mmol, 1 equiv) in DCM (77 mL) was cooled to 0° C. and treated dropwise with a solution of propargylamine (0.72 mL, 11.2 mmol, 5.0 equiv) in DCM (9.7 mL). The reaction mixture was stirred and allowed to warm to room temperature over 1 h followed by stirring at room temperature while monitoring the reaction by HPLC. After 49 h, the reaction was concentrated to a yellow, viscous oil which was purified by flash chromatography (25.fwdarw.45% EtOAc/DCM) to yield the product (1.00 g, 44% yield) as a colorless viscous oil that formed a glass/stiff foam under reduced pressure. LCMS (ESI) m/z: [M+H.sub.2O] calcd for C.sub.55H.sub.82N.sub.2O.sub.14: 1012.60; found 1012.6; m/z [M+HCO.sub.2] calcd for C.sub.56H.sub.82N.sub.2O.sub.14: 1039.57; found 1039.8.

Monomers 36 and 37

[1061] ##STR00733##

Step 1

[1062] To a dry reaction flask is added C.sub.16-modified rapamycin (1.0 equiv) followed by triethylamine (5.0 equiv) and DCM. The solution is cooled to −78° C. and 4-nitrophenylchloroformate (1.5 equiv) is added in a single portion. The reaction is stirred at −78° C., followed by warming to room temperature. Upon completion of the reaction, as determined by LCMS analysis, the reaction is diluted with H.sub.2O and DCM. The mixture is transferred to a separatory funnel and the organic layer washed with sat. aq. NaCl, dried over Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure. The resultant residue is purified by silica gel chromatography to give the product of step 1.

Step 2

[1063] The product of step 1 (1.0 equiv) is dissolved in DCM. A solution of propargylamine (5.0 equiv) and pyridine (5.0 equiv) in DCM is added to the reaction dropwise and the reaction mixture stirred while warming to room temperature. Upon consumption of rapamycin starting material, as determined by LCMS and TLC analysis, the reaction is concentrated under reduced pressure. The resultant residue is purified by silica gel chromatography to afford the product of step 2.

Monomer 38. Synthesis of 32-O-(prop-2-yn-1-yl) oxime rapamycin

[1064] ##STR00734##

[1065] To a solution of rapamycin (200.0 mg, 0.219 mmol, 1 equiv) in MeOH (5.00 mL) was added sequentially sodium acetate (0.0718 g, 0.875 mmol) and 3-(aminooxy)prop-1-yne hydrochloride (0.0941 g, 0.875 mmol, 4.0 equiv) at room temperature. The reaction was stirred at room temperature for 72 h. The reaction mixture was diluted with EtOAc (20 mL) and washed with 20 mL portions of H.sub.2O and brine. The solution was dried over Na.sub.2SO.sub.4, filtered, and concentrated. The resulting residue was purified via combiflash chromatography (0÷80% EtOAc/hex) to yield the Z isomer followed by the E isomer, both as colorless oils. Both products were taken up separately in 95% aq MeCN and lyophilized to white powders. Z isomer: LCMS (ESI) m/z: [M+Na] calcd for C.sub.54H.sub.82N.sub.2O.sub.13Na: 989.57; found 989.5. E isomer: LCMS (ESI) m/z [M+Na] calcd for C.sub.54H.sub.82N.sub.2O.sub.13: 989.57; found 989.5.

Monomer 39

[1066] ##STR00735##

[1067] The preparation of the monomer proceeds by reacting rapamycin with prop-2-yn-1-yl carbamate in the presence of TFA.

Monomer 40. Synthesis of 28-proparygylcarbamate rapamycin

[1068] ##STR00736##

[1069] The preparation of the monomer proceeds from the known C28-paranitrophenylcarbonate of rapamycin by reacting with propargylamine in the presence of pyridine.

[1070] Reference for preparation of C28-p-nitrophenylcarbonate intermediate: Abel, M.; Szweda, R.; Trepanier, D.; Yatscoff, R. W.; Foster, R. T. 2007. Rapamycin carbohydrate derivatives. U.S. Pat. No. 7,160,867, which is incorporated by reference in its entirety.

Monomer 41. Synthesis of 40(S)-(1-(5-(3-ethynylphenyl)-1,2,3-triazole)) rapamycin

[1071] ##STR00737##

[1072] To an oven-dried reaction flask was added chloro(pentamethylcyclopentadienyl) (cyclooctadiene)ruthenium(II) (37.0 mg, 0.0975 mmol, 0.46 equiv) followed by toluene (2.35 mL). The mixture was purged with N.sub.2 before adding 40(S)-azido rapamycin (0.200 g, 0.212 mmol, 1.0 equiv) and then 1,3-diethynylbenzene (0.0534 g, 0.424 mmol, 2.0 equiv). The flask was purged with N.sub.2 and stirred at 60° C. overnight. After stirring for 15 h the reaction mixture was concentrated to a dark brown residue. Purification by silica gel chromatography (10.fwdarw.60% EtOAc/hexanes) afforded the product as a grey residue (0.077 g, 34% yield). LCMS (ESI) m/z: [M+H] calcd for C.sub.61H.sub.84N.sub.4O.sub.12: 1065.62; found 1065.6.

Monomer 42. Synthesis of 16(S)-(2,4,6-trimethoxyphenyl) 40(R)—O-(1-hexynyl) rapamycin

[1073] ##STR00738##

[1074] To a stirred solution of 16(S)-(2,4,6-trimethoxyphenyl) rapamycin (0.090 g, 0.0856 mmol, 1 equiv) in chloroform (0.34 mL) at −40° C. was added DIPEA (0.745 mL, 4.28 mmol, 50 equiv) followed by hex-5-yn-1-yl trifluoromethanesulfonate (0.200 g, 0.868 mmol, 10.1 equiv). After 15 min at −40° C., the solution was warmed to room temperature and then heated to 60° C. for 18 h. The reaction was cooled to room temperature and diluted with H.sub.2O (20 mL) and EtOAc (15 mL). The layers were separated and the aqueous layer was extracted with EtOAc (3×). The combined organic layers were dried with MgSO.sub.4, filtered, and concentrated to provide a red oil. The crude material was purified by silica gel chromatography (0.fwdarw.60% EtOAc/heptane) to afford the product as a white solid (0.041 g, 43% yield). LCMS (ESI) m/z: [M+H] calcd for C.sub.65H.sub.95NO.sub.15: 1130.68; found 1130.7.

Monomers 43. Synthesis of 32(R)-ethoxy-26-O-(prop-2-yn-1-yl) oxime rapamycin

[1075] ##STR00739##

Step 1: Synthesis of 32(R)-ethoxy-28,40-bistriethylsilyl rapamycin

[1076] A solution of 32-hydroxy-28,40-bistriethylsilyl rapamycin (773 mg, 0.675 mmol, 1.0 equiv) in chloroform (19 mL) was treated with N,N,N′,N′-tetramethyl-1,8-naphthalenediamine (1.85 g, 8.63 mmol, 12.8 equiv) along with freshly dried 4 Å molecular sieves. The mixture was stirred for 1 h at room temperature and treated with triethyloxonium tetrafluoroborate (1.51 g, 7.95 mmol, 11.8 equiv) in one portion at room temperature. The reaction mixture was stirred for 3 h, at which point the reaction mixture was diluted with DCM and filtered through Celite, washing the filter pad with additional DCM. The combined filtrates were washed twice with 1M HCl, once with saturated NaHCO.sub.3 solution, and dried over Na.sub.2SO.sub.4. The solution was filtered and concentrated to a residue. The crude residue was treated with MTBE and filtered to remove polar insoluble material. The filtrate was concentrated and purified by silica gel chromatography (5.fwdarw.25% EtOAc/hex) to afford the product as a foam (516 mg, 65% yield). LCMS (ESI) m/z: [M+Na] calcd for C.sub.65H.sub.113NO.sub.13Si.sub.2 1194.77; found 1194.6.

Step 2: Synthesis of 32(R)-ethoxy rapamycin

[1077] 32(R)-ethoxy-28,40-bistriethylsilyl rapamycin (131 mg, 0.112 mmol, 1.0 equiv) was dissolved in THF (1.3 mL), cooled to 0° C. and treated with pyridine (271 μL, 3.35 mmol, 3.4 equiv) followed by HF-pyridine (51 μL, 1.8 mmol, 1.8 equiv). The reaction flask was capped and stored in the fridge for 3 days, at which point the reaction mixture was poured into 20 mL cold saturated NaHCO.sub.3 solution and the aqueous layer extracted with EtOAc (3×20 mL). The combined organic layers were washed with 1M HCl (2×20 mL), saturated NaHCO.sub.3 solution (20 mL), and brine. The solution was dried over Na.sub.2SO.sub.4, filtered, and concentrated. The residue was taken up in MeOH (1.5 mL) and added dropwise to H.sub.2O (20 mL), the product flask was rinsed with additional MeOH (0.5 mL), which was added dropwise to the slurry. The solids were filtered through a glass frit and washed with additional H.sub.2O to provide the product as a white powder (53 mg, 51% yield). LCMS (ESI) m/z: [M+Na] calcd for C.sub.53H.sub.85NO.sub.13: 966.59; found 966.5.

Step 3: Synthesis of 32(R)-ethoxy-26-O-(prop-2-yn-1-yl) oxime rapamycin

[1078] To a solution of 32(R)-ethoxy rapamycin (1.49 g, 1.53 mmol, 1.0 equiv) and 3-(aminooxy)prop-1-yne hydrochloride (849 mg, 7.89 mmol, 5.2 equiv) in pyridine (7.5 mL) was added 4M HCl in 1,4-dioxane (2.76 mL, 11.04 mmol, 7.2 equiv), dropwise. The reaction mixture was then heated to 50° C. for 3 days. The mixture was cooled to ambient temperature and then added dropwise to H.sub.2O. The resulting solids were filtered, washed with H.sub.2O and taken up in EtOAc. The organic layer was washed sequentially with 1 M HCl, sat. NaHCO.sub.3 solution, and brine, dried over Na.sub.2SO.sub.4, and concentrated to a thick viscous oil. The oil was purified by silica gel chromatography (2:3.fwdarw.4:1 EtOAc/hexanes) to afford the desired product as a white solid (640 mg, 42% yield, mixture of E/Z isomers). LCMS (ESI) m/z: [M+Na] calcd for C.sub.56H.sub.88N.sub.2O.sub.13: 1019.62; found 1019.8.

Monomer 44. Synthesis of 32(R)-methoxy 40(R)—O-(1-hexynyl) rapamycin

[1079] ##STR00740##

[1080] A solution of hex-5-yn-1-yl trifluoromethanesulfonate (2.12 g, 9.20 mmol, 4.0 equiv) in DCM (7.6 mL) was cooled at 0° C. and treated with 2,6-di-tert-butyl-4-methylpyridine (1.89 g, 9.20 mmol, 4.0 equiv) in one portion. After stirring for 5 min, the reaction mixture was treated with 32(R)-methoxy rapamycin (2.14 g, 2.30 mmol, 1.0 equiv) in one portion. The reaction mixture was stirred at 0° C. for 15 min followed by warming to room temperature. After 24 h at room temperature the reaction mixture was diluted with DCM (100 mL) and the organic phase was washed with sat, NaHCO.sub.3 solution, H.sub.2O, and brine and then dried over Na.sub.2SO.sub.4. The solution was filtered and concentrated to yield a light yellow viscous oil. The crude material was purified by silica gel chromatography (20-50% EtOAc/hex) to afford the desired product as a colorless foam (0.73 g, 31% yield). LCMS (ESI) m/z: [M+Na] calcd for C.sub.58H.sub.91NO.sub.13: 1032.64; found: 1032.7.

Monomer 45. Synthesis of 40(R)—O-1-(3,3-dimethylhex-5-ynyl) rapamycin

[1081] ##STR00741##

Step 1: Synthesis of 3,3-dimethylhex-5-yn-1-yl trifluoromethane sulfonate

[1082] To a dry reaction flask was added 3,3-dimethylhex-5-yn-1-ol (0.62 g, 4.9 mmol, 1.0 equiv) followed by DCM (4.8 mL) before being cooled to −60° C. Trifluoromethanesulfonic anhydride (0.95 mL, 5.66 mmol, 1.1 equiv) was added to the reaction, dropwise, while maintaining the temperature below −60° C. After 45 min at −60° C., the reaction was quenched by pouring the mixture into cold sat. KH.sub.2PO.sub.4 (100 mL). The layers were separated and the organic layer was concentrated under reduced pressure to give a red/brown oil. The crude oil was purified by filtography on 10 g silica (100 mL 50% EtOAc/hexanes) to yield a brown oil (0.92 g, 72% yield).

Step 2: Synthesis of 40(R)—O-1-(3,3-dimethylhex-5-ynyl) rapamycin

[1083] To a solution of freshly purified 3,3-dimethylhex-5-yn-1-yl trifluoromethane sulfonate (0.91 g, 3.5 mmol, 4.0 equiv) in DCM (6.8 mL) at 0° C. was added 2,6-di-tert-butyl-4-methylpyridine (0.36 g, 1.7 mmol, 2.0 equiv) in one portion. After stirring for 20 min, rapamycin (0.80 g, 0.88 mmol, 1.0 equiv) was added and the mixture was stirred at 0° C. for 1 h before warming to room temperature and stirring overnight. The reaction mixture was diluted with DCM (100 mL) and then washed with sat. NaHCO.sub.3 (100 mL) and brine (100 mL). The organic layer was concentrated under reduced pressure to yield a green residue. Purification by silica gel chromatography (0.fwdarw.10% acetone/DCM) followed by re-purification by reverse phase chromatography (MeCN/H.sub.2O) afforded the product as an off-white residue (0.071 g, 8% yield). LCMS (ESI) m/z: [M+Na] calcd for C.sub.59H.sub.91NO.sub.13: 1044.64; found 1044.5.

Monomer 46. Synthesis of 32-acetohydrazone 40(R)—O-(1-hexynyl) rapamycin

[1084] ##STR00742##

[1085] The reported monomer can be prepared following the reported methods shown.

[1086] Reference for this transformation: Failli, A. A.; Steffan, R. J. 1991. Rapamycin Hydrazones. U.S. Pat. No. 5,120,726. American Home Products Corporation, which is incorporated by reference in its entirety.

Monomer 47. Synthesis of 32-phenylsemicarbazone 40(R)—O-(1-hexynyl) rapamycin

[1087] ##STR00743##

[1088] The reported monomer can be prepared following the reported methods shown.

[1089] Reference for this transformation: Failli, A. A.; Steffan, R. J. 1991. Rapamycin Hydrazones. U.S. Pat. No. 5,120,726. American Home Products Corporation, which is incorporated by reference in its entirety.

Monomer 48. Synthesis of 32-phenylsemithiocarbazone 40(R)—O-(1-hexynyl) rapamycin

[1090] ##STR00744##

[1091] The reported monomer can be prepared following the reported methods shown.

[1092] Reference for this transformation: Failli, A. A.; Steffan, R. J. 1991. Rapamycin Hydrazones. U.S. Pat. No. 5,120,726. American Home Products Corporation, which is incorporated by reference in its entirety.

Monomer 49. Synthesis of 32-hydrazone 40(R)—O-(1-hexynyl) rapamycin

[1093] ##STR00745##

[1094] To a solution of 40-(R)—O-(1-hexynyl) rapamycin (0.900 g, 0.905 mmol, 1.0 equiv) in MeOH (12.4 mL) was added a 1M solution of hydrazine hydrate (2.72 mmol, 3.0 equiv) in MeOH. The reaction mixture was stirred at room temperature overnight. The reaction mixture was then concentrated under reduced pressure to provide a tan viscous oil. The crude material was purified by silica gel chromatography (0.fwdarw.5% MeOH/DCM) to give the product (127 mg, 14% yield) as a white stiff foam. LCMS (ESI) m/z: [M+Na] calcd for C.sub.57H.sub.89N.sub.3O.sub.12: 1030.63; found: 1030.6.

Monomer 50. Synthesis of 32-amino 40(R)—O-(1-hexynyl) rapamycin

[1095] ##STR00746##

[1096] The reported monomer can be prepared following the reported methods shown.

[1097] Reference for this transformation: Watanabe, M.; Tanaka, K.; Mild, T.; Murata, K. Process for Preparing Amine Compound. US20120065426. Kanto Kagaku Kabushiki Kaisha, which is incorporated by reference in its entirety.

Monomer 51. Synthesis: of 32-O-methyl oxime 40(R)—O-(1-hexynyl) rapamycin

[1098] ##STR00747##

[1099] To a solution of 40(R)—O-(1-hexynyl) rapamycin (400 mg, 0.402 mmol, 1.0 equiv) in MeOH (9.19 mL) was added sodium acetate (132 mg, 1.61 mmol, 4.0 equiv) followed by methoxylamine hydrochloride (134 mg, 1.61 mmol, 4.0 equiv) in one portion at room temperature. The reaction mixture was stirred at room temperature overnight, at which point the reaction mixture was diluted with H.sub.2O (15 mL) and extracted with EtOAc (2×20 mL). The combined organic phase was washed with H2O, brine and dried over MgSO.sub.4. The solution was filtered and concentrated under reduced pressure to provide a colorless foam. The crude material was purified by reverse phase chromatography (10% to 100% MeCN/H.sub.2O). The two separate E/Z oxime isomers were isolated and each lyophilized to white powders to afford both the Z-oxime (180 mg, 44.6% yield) and the E-oxime (50 mg, 12.4% yield). LCMS (ESI) m/z: [M+Na] calcd for C.sub.58H.sub.90N.sub.2O.sub.13: 1045.63; found: 1046.0.

Monomer 52. Synthesis of 32-O-benzyl oxime 40(R)—O-(1-hexynyl) rapamycin

[1100] ##STR00748##

[1101] To a solution of 40(R)—O-(1-hexynyl) rapamycin (0.50 g, 0.50 mmol, 1.0 equiv) in MeOH (11.5 mL) was added sodium acetate (0.17 g, 2.0 mmol, 4.0 equiv) and O-benzylhydroxylamine hydrochloride (0.33 g, 2.1 mmol, 4.0 equiv). After 7 h the reaction mixture was diluted with H.sub.2O (60 mL) and extracted with EtOAc (2×80 mL). The organic phase was washed with H.sub.2O, brine, dried with MgSO.sub.4, and concentrated under reduced pressure to provide a colorless oil. The crude material was purified by chromatography on silica gel (0.fwdarw.50% EtOAc/hexanes) to afford the product (180 mg, 32.6% yield) as a clear colorless oil. LCMS (ESI) m/z: [M+H] calcd for C.sub.64H.sub.94N.sub.2O.sub.13: 1099.68; found 1099.9.

Monomer 53. Synthesis of 32(R)-hydroxy 40(R)—O-(1-hexynyl) rapamycin

[1102] ##STR00749##

[1103] To a solution of hex-5-yn-1-yl trifluoromethanesulfonate (4.25 g, 18.5 mmol, 4.0 equiv) in DCM (15.2 mL) at 0° C. was added 2,6-di-tert-butyl-4-methylpyridine (3.79 g, 18.5 mmol, 4.0 equiv). After stirring for 5 min, the reaction mixture was treated with 32(R)-hydroxy-rapamycin (4.23 g, 4.62 mmol, 1.0 equiv) and the reaction was stirred at 0° C. for 15 min followed by warming to room temperature. After 23 h, the reaction mixture was diluted with DCM (100 mL) and the organic phase was washed with 100 mL portions of sat NaHCO.sub.3 solution, H.sub.2O, brine and dried over Na.sub.2SO.sub.4. The solution was filtered and concentrated to yield a dark green viscous oil. The crude material was purified by silica gel chromatography (10.fwdarw.60% acetone/hexane) to provide the product (1.30 g, 28% yield) as a tan solid/stiff foam. LCMS (ESI) m/z: [M+Na] calcd for C.sub.57H.sub.89NO.sub.13: 1018.62; found: 1018.5.

Monomer 54. Synthesis of 32-oxime 40(R)—O-(1-hexynyl) rapamycin

[1104] ##STR00750##

[1105] To a solution of 40(R)-(hex-5-yn-1-yloxy)-rapamycin (400 mg, 0.402 mmol, 1.0 equiv) in MeOH (9.2 mL) was added sodium acetate (132 mg, 1.61 mmol, 4.0 equiv) followed by hydroxylamine hydrochloride (112 mg, 1.61 mmol, 4.0 equiv) at room temperature. After 40 h, the reaction mixture was diluted with H.sub.2O (40 mL) and extracted with EtOAc (2×25 mL). The combined organic phase was dried over Na.sub.2SO.sub.4, filtered, and concentrated to yield a colorless glass/stiff foam. The crude product was purified by reverse phase chromatography (10.fwdarw.100% MeCN/H.sub.2O). The two separate E/Z oxime isomers were isolated to afford both the more polar oxime isomer (60.8 mg, 15.4% yield) and the less polar oxime isomer (45.6 mg, 11.5% yield) as white solids. LCMS (ESI) (more polar isomer) m/z: [M+Na] calcd for C.sub.57H.sub.88N.sub.2O.sub.13: 1031.62; found: 1031.6; LCMS (ESI) (less polar-isomer) m/z: [M+Na] calcd for C.sub.57H.sub.88N.sub.2O.sub.13: 1031.62; found: 1031.6.

Monomer 55. Synthesis of 40(S)-azido rapamycin

[1106] ##STR00751##

[1107] Reference for the synthesis of the known monomer: Wang, B.; Zhao, J. Z. 2014; Rapamycin analogs and methods for making same. WO2014082286. Hangzhou Zylox Pharma Co., Ltd, which is incorporated by reference in its entirety.

Monomers 56 and 62. Synthesis of of 40(R)-(m-azidobenzyl) ether and 40(R)-(p-azidobenzyl) ether rapamycin

[1108] ##STR00752##

[1109] To a dry reaction flask is added rapamycin followed by heptanes and DCM. 3-Azidobenzylamine or 4-azidobenzylamine and silver(I) oxide are to the solution and the reaction flask is capped and heated to 60° C. until full consumption of rapamycin, as determined by LCMS analysis. The reaction is then cooled to room temperature, diluted with EtOAc, filtered through Celite, and concentrated under reduced pressure to provide a solid. Purification by chromatography on silica gel provides the product.

Monomer 57. Synthesis of of 32(R)-hydroxy 26-O-(p-azidobenzyl) oxime rapamycin

[1110] ##STR00753##

[1111] To a solution of 32(R)-hydroxy rapamycin (1.0 equiv) and O-(4-azidobenzyl)hydroxylamine (5.0 equiv) in pyridine is added HCl in 1,4-dioxane (7.0 equiv), dropwise over 1 min, at room temperature. The reaction mixture is heated to 50° C. During the reaction course, additional O-(4-azidobenzyl)hydroxylamine (1.0 equiv) and HCl in 1,4-dioxane (5.0 equiv) are added after the reaction is cooled to room temperature. The reaction mixture is again heated at 50° C. and stirred until consumption of 32(R)-hydroxy rapamycin. The reaction mixture is then added dropwise into H.sub.2O and cooled to 0° C. The resulting solid is filtered off, washed with H2O, and purified by silica gel chromatography to afford product.

Monomer 58 and 60. Synthesis of 40(R)-(m-azidobenzyl)carbamate and 40(R)-(p-azidobenzyl)carbamate rapamycin

[1112] ##STR00754##

[1113] The monomers can be prepared by reacting the corresponding azidobenzylamines, in the presence of pyridine, with the C40-p-nitrophenylcarbonate derivative of rapamycin.

Monomer 59. Synthesis of of 32(R)-methoxy 26-O-(p-azidobenzyl) oxime rapamycin

[1114] ##STR00755##

[1115] To a solution of 32(R)-methoxy rapamycin (1.0 equiv) and O-(4-azidobenzyl)hydroxylamine (5.0 equiv) in pyridine is added HCl in 1,4-dioxane (7.0 equiv), dropwise over 1 min. The reaction mixture is heated to 50° C. During the course of the reaction, additional O-(4-azidobenzyl)hydroxylamine (1.0 equiv) and HCl in 1,4-dioxane (5.0 equiv) are added after the reaction is cooled to rt. The reaction mixture is again heated to 50° C. and stirred until consumption of 32(R)-methoxy rapamycin. The reaction mixture is then added dropwise into H.sub.2O and cooled to 0° C. The resulting solid is filtered off, washed with H.sub.2O, and purified by silica gel chromatography to afford product.

Monomer 61. Synthesis of of 32(R)-hydroxy 26-O-(m-azidobenzyl) oxime rapamycin

[1116] ##STR00756##

[1117] To a solution of 32(R)-hydroxy rapamycin (1.0 equiv) and O-(3-azidobenzyl)hydroxylamine (5.0 equiv) in pyridine is added HCl in 1,4-dioxane (7.0 equiv), dropwise over 1 min. The reaction mixture is heated to 50° C. During the course of the reaction, additional O-(3-azidobenzyl)hydroxylamine (1.0 equiv) and HCl in 1,4-dioxane (5.0 equiv) are added after the reaction is cooled to room temperature. The reaction mixture is again heated to 50° C. and stirred until consumption of 32(R)-hydroxy rapamycin. The reaction mixture is then added dropwise into H.sub.2O and cooled to 0° C. The resulting solid is filtered off, washed with H.sub.2O, and purified by silica gel chromatography to afford product.

Monomer 63. Synthesis of of 32(R)-methoxy 26-O-(m-azidobenzyl) oxime rapamycin

[1118] ##STR00757##

[1119] To a solution of 32(R)-methoxy rapamycin (1.0 equiv) and O-(3-azidobenzyl)hydroxylamine (5.0 equiv) in pyridine is added HCl in 1,4-dioxane (7.0 equiv), dropwise over 1 min. The reaction mixture is heated to 50° C. During the course of the reaction, additional O-(3-azidobenzyl)hydroxylamine (1.0 equiv) and HCl in 1,4-dioxane (5.0 equiv) are added after the reaction is cooled to room temperature. The reaction mixture is again heated to 50° C. and stirred until consumption of 32(R)-methoxy rapamycin. The reaction mixture is then added dropwise into H.sub.2O and cooled to 0° C. The resulting solid is filtered off, washed with H.sub.2O, and purified by silica gel chromatography to afford product.

Monomer 64

[1120] ##STR00758##

[1121] To a dry reaction vessel is added 3-(4-azidophenyl)propyl trifluoromethanesulfonate (4.0 equiv) followed by anhydrous DCM. The mixture is purged with N.sub.2 and cooled to sub-ambient temperature before addition of 2,6-di-tert-butyl-4-methylpyridine (2.0 equiv) as a solid in one portion. Rapamycin (1.0 equiv) is then added as a solid in one portion. The reaction is stirred and, upon consumption of rapamycin, diluted with DCM and and washed with sat. aqueous NaHCO.sub.3 solution. The organic layer is washed with sat. aq. NaCl, dried over Na.sub.2SO.sub.4, filtered and concentrated. The crude product mixture was purified by silica gel chromatography to afford product.

Monomer 65

[1122] ##STR00759##

[1123] To a dry reaction vessel is added 6-azidohexyl trifluoromethanesulfonate (4.0 equiv) followed by anhydrous DCM. The mixture is purged with N.sub.2 and cooled to sub-ambient temperature before addition of 2,6-di-tert-butyl-4-methylpyridine (2.0 equiv) as a solid in one portion. Rapamycin (1.0 equiv) is then added as a solid in one portion. The reaction is stirred and, upon consumption of rapamycin, diluted with DCM and washed with sat. aqueous NaHCO.sub.3 solution. The organic layer is washed with sat. aq. NaCl, dried over Na.sub.2SO.sub.4, filtered and concentrated. The crude product mixture was purified by silica gel chromatography to afford product.

Monomer 66. Synthesis of 16-furan 40(S)-azido rapamycin

[1124] ##STR00760##

[1125] To a dry reaction flask was added 40(S)-azido rapamycin (0.56 g, 0.59 mmol, 1.0 equiv) and furan (0.89 mL, 12.2 mmol, 21 equiv), followed by DCM (24 mL). The reaction mixture was cooled to −40° C. before adding TFA (0.77 mL, 9.96 mmol, 17 equiv). After 3 h the reaction mixture was diluted with DCM (50 mL) and washed with sat. NaHCO.sub.3 (30 mL). The organic layer was dried with MgSO.sub.4 and concentrated under reduced pressure to provide a yellow foam. Purification by silica gel chromatography (0.fwdarw.45% EtOAc/hexanes) afforded the product as a yellow foam (0.16 g, 27.8% yield). LCMS (ESI) m/z: [M+Na] calcd for C.sub.54H.sub.78N.sub.4O.sub.12: 997.55; found 997.5.

Monomer 67. Synthesis of 16-methyl carbamate 40(S)-azido rapamycin

[1126] ##STR00761##

[1127] To a dry reaction vessel is added 40(S)-azido rapamycin and methyl chloroformate followed by anhydrous DCM. The mixture is purged with N.sub.2 and cooled to −40° C. before addition of TFA. The reaction is stirred and, upon consumption of the starting material, diluted with DCM and washed with sat. aqueous NaHCO.sub.3 solution. The organic layer is washed with sat. aq. NaCl, dried over Na.sub.2SO.sub.4, filtered and concentrated. The crude product mixture was purified by silica gel chromatography to afford product.

Monomer 68. Synthesis of 32(R)-methoxy 40(S)-azido rapamycin

[1128] ##STR00762##

[1129] To a dry reaction flask was added 32(R)-methoxy rapamycin (0.28 g, 0.30 mmol, 1.0 equiv) and 2,6-lutidine (74 μL, 0.64 mmol, 2.1 equiv), followed by DCM (8.4 mL). The reaction mixture was coded to −10° C. and then trifluoromethanesulfonic anhydride (65 μL, 0.38 mmol, 1.3 equiv) was added. After 45 min, tetrabutyl ammonium azide (0.38 g, 1.33 mmol, 4.4 equiv) was added and the reaction was warmed to room temperature while stirring overnight. The reaction mixture was diluted with EtOAc (30 mL) and washed with pH 7 phosphate buffer (2×10 mL) then the organic layer was dried with MgSO.sub.4 and concentrated under reduced pressure to provide a yellow oil. Purification by silica gel chromatography (0.fwdarw.45% EtOAc/hexanes) afforded the product as a clear colorless oil (0.20 g, 67% yield). LCMS (ESI) m/z: [M+Na] calcd for C.sub.52H.sub.82N.sub.4O.sub.12: 977.58; found 977.7.

Monomer 69. Synthesis of 32(R)-ethoxy 40(S)-azido rapamycin

[1130] ##STR00763##

[1131] To a dry flask was added 32(R)-ethoxy rapamycin (1.02 g, 1.08 mmol, 1.0 equiv) and 2,6-lutidine (0.26 mL, 2.3 mmol, 2.1 equiv), followed by DCM (30 mL). The reaction mixture was cooled to −10° C. and then trifluoromethanesulfonic anhydride (0.23 mL, 1.4 mmol, 1.3 equiv) was added to the mixture, dropwise. After 45 min, tetrabutylammonium azide (1.35 g, 4.74 mmol, 4.4 equiv) was added in one portion to the reaction mixture, which was then stirred overnight while warming to room temperature. The reaction mixture was diluted with EtOAc (100 mL), poured into a separatory funnel and washed with pH 7 phosphate buffer (2×10 mL). The organic layer was dried over Na.sub.2SO.sub.4, filtered and the solvent removed under reduced pressure to afford a clear yellow oil. Purification by silica gel chromatography (2/3 to 3/2 EtOAc/hexanes) to afford a yellow oil. Lyophilization then provided an off-white powder (540 mg, 52% yield). LCMS (ESI) m/z: [M+Na] calcd for C.sub.53H.sub.84N.sub.4O.sub.12: 991.60; found 991.8.

Monomer 70. Synthesis of 32(R)-hydroxy 40(S)-azido rapamycin

[1132] ##STR00764##

Step 1: Synthesis of 32(R)-hydroxy rapamycin

[1133] A solution of 32(R)-hydroxy-28,40-bistriethylsilyl rapamycin (3.64 g, 3.18 mmol, 1 equiv) in THF (41.8 mL) was treated with pyridine (20.8 mL, 258 mmol, 81 equiv) and the reaction mixture was cooled to 0° C. The solution was treated dropwise with HF-pyridine (70:30; 4.60 mL, 159 mmol, 50 equiv) and the reaction mixture was stirred at 0° C. for 20 min followed by warming to room temperature. After 5 h, the reaction mixture was cooled back to 0° C. and carefully added to ice cold sat. NaHCO.sub.3 solution (400 mL). The mixture was extracted with EtOAc (2×100 mL) and the organic phases were washed with 75 mL portions of H.sub.2O, sat. NaHCO.sub.3 solution and brine. The organic solution was dried over Na.sub.2SO.sub.4, filtered and concentrated to yield a light yellow oil that produced a stiff foam under reduced pressure. The crude material was purified by silica gel chromatography (20.fwdarw.40% acetone/hex) to yield the desired product as a white amorphous solid (1.66 g, 57% yield). LCMS (ESI) m/z: [M+Na] calcd for C.sub.51H.sub.81NO.sub.13: 938.56; found: 938.7; m/z: [M−H] calcd for C.sub.51H.sub.81NO.sub.13: 914.56; found: 914.7.

Step 2: Synthesis of 32(R)-hydroxy 40(S)-azido rapamycin

[1134] 32(R)-Hydroxy rapamycin (245 mg, 0.267 mmol, 1.0 equiv) was dissolved in MeCN (6.0 mL) and the solution was treated with ˜1.0 g 4 Å powdered molecular sieves. The mixture was stirred for 1 h, at which point the mixture was filtered through a fritted funnel, washing the frit with MeCN (1.4 mL). The solution was treated with 2,6-lutidine (65.0 μL, 0.562 mmol, 2.1 equiv) and cooled to −10° C. The reaction mixture was treated with trifluoromethanesulfonic anhydride (58.5 μL, 0.348 mmol, 1.3 equiv), dropwise. The reaction mixture was stirred at −10° C. for 60 min during which time the reaction mixture became light pink. Tetrabutylammonium azide (335 mg, 1.18 mmol, 4.4 equiv) was added in one portion and the reaction mixture was stirred overnight while warming to room temperature. After 19 h, the reaction mixture was diluted with EtOAc (40 mL) and washed with pH 7 phosphate buffer (2×20 mL). The organic phase was dried over Na.sub.2SO.sub.4, filtered and concentrated to a light tan viscous oil that was placed under high vac to remove lutidine. The crude material was purified by silica gel chromatography (10.fwdarw.30% acetone/hex) to yield the desired product as a white solid (159 mg, 63% yield). LCMS (ESI) m/z: [M+Na] calcd for C.sub.51H.sub.80N.sub.4O.sub.12: 963.57; found: 963.5; m/z: [M+HCO.sub.2] calcd for C.sub.51H.sub.80N.sub.4O.sub.12: 985.57; found: 985.8.

Monomer 71. Synthesis of 32-O-(methyl) oxime 40(S)-azido rapamycin

[1135] ##STR00765##

[1136] To a solution of 40(S)-azido rapamycin (820 mg, 0.87 mmol, 1 equiv) in MeOH (20 mL) was added sodium acetate (0.286 g, 3.49 mmol, 4.0 equiv) and methoxylamine hydrochloride (0.292 g, 3.49 mmol, 4.0 equiv) at room temperature. After stirring overnight, the reaction was diluted with EtOAc and washed with H2O, brine, dried over Na.sub.2SO.sub.4, and concentrated to afford a white foam. The foam was purified by reverse phase chromatography (1/4 to 9/1 MeCN/H.sub.2O, no TFA). The two separate E/Z oxime isomers were isolated and each lyophilized to white powders affording both the Z-oxime (510 mg, 60% yield) and the E-oxime (190 mg, 22% yield). LCMS (ESI) m/z: [M+Na] calcd for C.sub.52H.sub.81N.sub.5O.sub.12: 990.58; found 991.0.

Monomer 72. Synthesis of 32-O-(benzyl) oxime 40(S)-azido rapamycin

[1137] ##STR00766##

[1138] To a solution of 40(S)-azido rapamycin (1.05 g, 1.12 mmol, 1.0 equiv) in MeOH (26 mL) was added sodium acetate (0.367 g, 4.47 mmol, 4.0 equiv) and O-benzylhydroxylamine hydrochloride (0.714 g, 4.47 mmol, 4.0 equiv) at room temperature. The reaction was left for 2 days, at which point the reaction was diluted with EtOAc and washed with H.sub.2O, brine, dried over Na.sub.2SO.sub.4, and concentrated to afford a white foam. The foam was purified by reverse phase chromatography (1/4 to 9/1 MeCN/H.sub.2O, no TFA). The two separate E/Z oxime isomers were isolated and each lyophilized to white powders to afford both the Z-oxime (620 mg, 53% yield) and the E-oxime (130 mg, 11% yield). LCMS (ESI) m/z: [M+Na] calcd for C.sub.58H.sub.85N.sub.5O.sub.12: 1066.61; found 1066.9.

Monomer 73. Synthesis of 32-O-(tert-butyl) oxime 40(S)-azido rapamycin

[1139] ##STR00767##

[1140] To a solution of 40(S)-azido rapamycin (1.05 g, 1.12 mmol, 1.0 equiv) in MeOH (26 mL) was added sodium acetate (0.367 g, 4.47 mmol, 4.0 equiv) and 2-(aminooxy)-2-methylpropane hydrochloride (0.562 g, 4.47 mmol, 4.0 equiv) at room temperature. The reaction was stirred for 2 days, at which point the reaction was diluted with EtOAc and washed with H.sub.2O, brine, dried over Na.sub.2SO.sub.4, and concentrated to afford a white foam. The foam was purified by reverse phase chromatography (1/4 to 9/1 MeCN/H.sub.2O, no TFA). The two separate E/Z oxime isomers were isolated and each lyophilized to white powders to afford both the Z-oxime (390 mg, 34% yield) and the E-oxime (70 mg, 6% yield). LCMS (ESI) m/z: [M+Na] calcd for C.sub.55H.sub.87N.sub.5O.sub.12: 1032.62; found 1032.9.

Monomer 74. Synthesis of 32-oxime 40(S)-azido rapamycin

[1141] ##STR00768##

[1142] To a solution of 40(S)-azido rapamycin (0.26 g, 0.27 mmol, 1.0 equiv) in MeOH (6.5 mL) was added sodium acetate (0.092 g, 1.1 mmol, 4.0 equiv) and hydroxylamine hydrochloride (0.076 g, 1.1 mmol, 4 equiv) at room temperature. The reaction was stirred overnight, at which point the reaction was diluted with H.sub.2O (30 mL) and extracted with EtOAc (2×40 mL). The organic phase was washed with 40 mL portions of H.sub.2O and brine before drying with MgSO.sub.4 and concentrating under reduced pressure to provide a colorless oil. The crude material was purified by reverse phase chromatography (0.fwdarw.100% MeCN:H.sub.2O, no TFA). The two separate E/Z oxime isomers were isolated and each lyophilized to white powders to afford both the major oxime isomer (110 mg, 42.7% yield) and the minor oxime isomer (54 mg. 21.0% yield). LCMS (ESI) m/z: [M+Na] calcd for C.sub.51H.sub.79N.sub.5O.sub.12: 976.56; found 976.7.

Monomer 75. Synthesis of 32-O-(carboxymethyl) oxime 40(S)-azido rapamycin

[1143] ##STR00769##

[1144] To a solution of 40(S)-azido rapamycin (1.22 g, 1.30 mmol, 1.0 equiv) in MeOH (31 mL) was added sodium acetate (0.44 g, 5.4 mmol, 4.0 equiv) and carboxymethoxylamine hemihydrochloride (1.1 g, 5.1 mmol, 4 equiv) at room temperature. The reaction was stirred overnight, at which point the reaction was diluted with H.sub.2O (75 mL) and extracted with EtOAc (2×100 mL). The organic phase was washed with 100 mL portions of H.sub.2O and brine before drying with MgSO.sub.4 and concentrating under reduced pressure to provide a colorless oil. The crude material was purified by reverse phase chromatography (0.fwdarw.100% MeCN/H.sub.2O, no TFA). The two separate E/Z oxime isomers were isolated to afford both the major oxime isomer as a clear colorless oil (51 mg, 3.9% yield) and the minor oxime isomer (30 mg, 2.3% yield). LCMS (ESI) m/z: [M+Na] calcd for C.sub.53H.sub.81N.sub.5O.sub.14: 1034.57; found 1034.8.

Monomer 76. Synthesis of 32(R)-hydroxy 26-O-(carboxymethyl) oxime rapamycin

[1145] ##STR00770##

[1146] To a dry reaction flask was added 32(R)-hydroxy rapamycin (3.39 g, 3.70 mmol, 1.0 equiv) and carboxymethoxylamine hemihydrochloride (1.62 g, 7.40 mmol, 2.0 equiv), followed by pyridine (18 mL) at room temperature. Pyridine hydrochloride (2.99 g, 25.9 mmol, 7.0 equiv) was added and then the reaction mixture was heated to 50° C. After 1.5 days, the solvent was removed under reduced pressure and the semisolid material was purified by reverse phase chromatography (15.fwdarw.90% MeCN/H.sub.2O, no TFA) to afford the product, a mixture of E/Z oxime isomers, as a white powder (1.51 g, 41% yield). LCMS (ESI) m/z: [M+Na] calcd for C.sub.53H.sub.84N.sub.2O.sub.15: 1011.58; found 1011.6.

Monomer 77. Synthesis of 32(R)-methoxy 26-O-(carboxymethyl) oxime rapamycin

[1147] ##STR00771##

[1148] To a dry reaction flask was added 32(R)-methoxy rapamycin (118 mg, 0.127 mmol, 1.0 equiv) and carboxymethoxylamine hemihydrochloride (137 mg, 0.634 mmol, 5.0 equiv), followed by pyridine (0.59 mL) at room temperature. Pyridine hydrochloride (0.103 g, 0.888 mmol, 7.0 equiv) was added and then the reaction mixture was heated to 50° C. After 1.5 days, the reaction mixture was cooled to room temperature and added dropwise into H.sub.2O (25 mL) followed by cooling the mixture to 0° C. The precipitated solid was filtered, washed with H.sub.2O twice and dried to afford the product, a mixture of E/Z oxime isomers, as a white powder (99 mg, 77% yield). LCMS (ESI) m/z: [M−H] calcd for C.sub.54H.sub.86N.sub.2O.sub.15: 1001.59; found 1001.7.

Monomer 78. Synthesis of 32-O-(carboxymethyl) oxime rapamycin

[1149] ##STR00772##

[1150] To a solution of rapamycin and O-(carboxymethyl)hydroxylamine hemihydrochloride in MeOH is added sodium acetate. The reaction mixture is then stirred at room temperature until full consumption of rapamycin, as determined by LCMS analysis. To the reaction mixture is then added H.sub.2O and DCM. The layers are separated and the aqueous layer extracted with DCM. The organic layers are dried over Na.sub.2SO.sub.4, filtered and purified by silica gel chromatography.

[1151] Reference for preparation of the monomer: Zheng, Y. F.; Wei, T. Q.; Sharma, M. 2016. Sandwich assay design for small molecules. WO2016100116 A1. Siemens Healthcare Diagnostics Inc., which is incorporated by reference in its entirety.

Monomer 79. Synthesis of 28-O-(carboxymethyl) ether rapamycin

[1152] ##STR00773##

[1153] Synthesis of the monomer proceeds first by the alkylation of C.sub.40—O-TBDMS protected rapamycin with iodoacetic acid and silver(I) oxide and then desilyation under acidic conditions with an acetic acid/THF/H.sub.2O solution.

[1154] Reference for preparation of C.sub.40—O-TBDMS protected rapamycin: Abel, M.; Szweda, R.; Trepanier, D.; Yatscoff, R. W.; Foster, R. T. 2004. Rapamycin carbohydrate derivatives. WO 2004/101583. Isotechnica International Inc., which is incorporated by reference in its entirety.

Monomer 80. Synthesis of 40(R)—O-(carboxymethyl) ether rapamycin

[1155] ##STR00774##

[1156] Synthesis of the monomer proceeds by the alkylation of rapamycin with iodoacetic acid and silver(I) oxide.

Monomer 81. Synthesis of 32(R)-hydroxy 26-O-(1-butylamine) oxime rapamycin

[1157] ##STR00775##

[1158] To a solution of 32(R)-hydroxy rapamycin (1.0 equiv) and (9H-fluoren-9-yl)methyl (4-(aminooxy)butyl)carbamate (5.0 equiv) in pyridine is added HCl in dioxane (7.0 equiv), dropwise over 1 min at room temperature. The reaction mixture is heated to 50° C. During the course of the reaction, additional (9H-fluoren-9-yl)methyl (4-(aminooxy)butyl)carbamate (5.0 equiv) (1.0 equiv) and HCl in dioxane (5.0 equiv) are added after the reaction is cooled to room temperature. The reaction mixture is again heated to 50° C. and stirred until consumption of 32(R)-hydroxy rapamycin. The reaction mixture is then added dropwise into H.sub.2O and cooled to 0° C. The resulting solid was filtered off, washed with H.sub.2O, and purified to afford product.

Monomer 82. Synthesis of 32(R)-methoxy 26-O-(1-butylamine) oxime rapamycin

[1159] ##STR00776##

[1160] To a solution of 32(R)-methoxy rapamycin (1.0 equiv) and (9H-fluoren-9-yl)methyl (4-(aminooxy)butyl)carbamate (5.0 equiv) in pyridine is added HCl in dioxane (7.0 equiv), dropwise over 1 min. The reaction mixture is heated to 50° C. During the course of the reaction, additional (9H-fluoren-9-yl)methyl (4-(aminooxy)butyl)carbamate (5.0 equiv) (1.0 equiv) and HCl in dioxane (5.0 equiv) are added after the reaction is cooled to room temperature. The reaction mixture is again heated to 50° C. and stirred until consumption of 32(R)-methoxy rapamycin. The reaction mixture is then added dropwise into H.sub.2O and cooled to 0° C. The resulting solid is filtered off, washed with H2O, and purified to afford product.

Monomer 83. Synthesis of 40(S)-amino rapamycin

[1161] ##STR00777##

[1162] Synthesis of the monomer proceeds by the reduction of 40(S)-azido rapamycin with triphenylphosphine.

Monomer 84. Synthesis of 16-furan 40(S)-amino rapamycin

[1163] ##STR00778##

[1164] Synthesis of the monomer proceeds by the reduction of C16-furan 40(S)-azido rapamycin with triphenylphosphine.

Monomer 85. Synthesis of 16-methyl carbamate 40(S)-amino rapamycin

[1165] ##STR00779##

[1166] Synthesis of the monomer proceeds by the reduction of C16-methyl carbamate 40(S)-azido rapamycin with triphenylphosphine.

Monomer 86. Synthesis of 32-deoxy 40(R)—O-1-hexynyl rapamycin

[1167] ##STR00780##

[1168] Starting with 32-deoxy rapamycin rather than rapamycin, monomer 86 can be prepared following the procedure used to prepare monomer 1.

Monomer 87. Synthesis of 32-deoxy 26-O-(prop-2-yn-1-yl) oxime rapamycin

[1169] ##STR00781##

[1170] Starting with 32-deoxy rapamycin rather than 32(R)-hydroxy rapamycin, monomer 87 can be prepared following the procedure used to prepare monomer 6.

Monomer 88. Synthesis of 32-deoxy 40(S)-azido rapamycin

[1171] ##STR00782##

[1172] Starting with 32-deoxy rapamycin rather than 32(R)-methoxy rapamycin, monomer 88 can be prepared following the procedure used to prepare monomer 68.

GENERAL PROCEDURES AND SPECIFIC EXAMPLES

General Procedure 1: Coupling of an Amine-Containing Active Site Inhibitor with Azide Containing N-Hydroxysuccinimide Esters

[1173] ##STR00783##

[1174] To a 0.035 M solution of amine salt (1.0 equiv) in DMF was added N-hydroxysuccinimide ester (1.25 equiv), followed by slow addition of triethylamine (3.5 equiv). The solution was: allowed to stir at room temperature under N.sub.2 atmosphere until consumption of the amine salt, as indicated by LCMS analysis. The reaction was concentrated under reduced pressure and purified by chromatography on silica gel to afford product.

Intermediate A1-1: Synthesis of 1-(4-(4-(1-azido-3,6,9,12,15,18,21,24-octaoxaheptacosan-27-oyl)piperazin-1-yl)-3-(trifluoromethyl)phenyl)-8-(6-methoxypyridin-3-yl)-3-methyl-1,3-dihydro-2H-imidazo[4,5-c]quinolin-2-one

[1175] ##STR00784##

[1176] To a solution of 8-(6-methoxypyridin-3-yl)-3-methyl-1-(4-(piperazin-1-yl)-3-(trifluoromethyl)-phenyl)-1,3-dihydro-2H-imidazo[4,5-c]quinolin-2-one (50 mg, 93.6 μmol 1.0 equiv) in DMF (2.67 mL) was added 2,5-dioxopyrrolidin-1-yl 1-azido-3,6,9,12,15,18,21,24-octaoxaheptacosan-27-oate (65.4 mg, 116 μmol), followed by slow addition of triethylamine (46 μL, 327 μmol, 3.5 equiv). The reaction was stirred for 12 h and then concentrated under reduced pressure. The product was isolated after chromatography on silica gel (0.fwdarw.5% MeOH/DCM). LCMS (ESI) m/z: [M+H] calcd for C.sub.47H.sub.61F.sub.3N.sub.9O.sub.11: 984.44; found 984.5.

[1177] Following the General Procedure 1, but using the appropriate amine salt and azide functionalized N-hydroxysuccinimide ester, the additional intermediates in Table 12 were prepared.

TABLE-US-00015 TABLE 12 Additional azides prepared Molecular Calculated Observed Structure Formula MW MW [00785]embedded image   Intermediate A1-1 C.sub.47H.sub.60F.sub.3N.sub.9O.sub.11 [M + H] = 984.44 [M + H] = 984.5 [00786]embedded image   Intermediate A1-2 C.sub.43H.sub.52F.sub.3N.sub.9O.sub.9 [M + H] = 896.39 [M + H] = 896.5 [00787]embedded image   Intermediate A1-3 C.sub.31H.sub.45N.sub.11O.sub.8 [M + H] = 700.35 [M + H] = 700.3 [00788]embedded image   Intermediate A1-4 C.sub.29H.sub.41N.sub.11O.sub.7 [M + H] = 656.33 [M + H] = 656.3 [00789]embedded image   Intermediate A1-5 C.sub.27H.sub.37N.sub.11O.sub.6 [M + H] = 612.30 [M + H] = 612.3 [00790]embedded image   Intermediate A1-6 C.sub.25H.sub.33N.sub.11O.sub.5 [M + H] = 568.27 [M + H] = 568.3 [00791]embedded image   Intermediate A1-7 C.sub.23H.sub.29N.sub.11O.sub.4 [M + H] = 524.25 [M + H] = 524.2 [00792]embedded image   Intermediate A1-8 C.sub.38H.sub.57N.sub.11O.sub.10S [M + H] = 860.41 [M + H] = 860.8 [00793]embedded image   Intermediate A1-9 C.sub.34H.sub.49N.sub.11O.sub.8S [M + H] = 772.36 [M + H] = 772.3 [00794]embedded image   Intermediate A1-10 C.sub.28H.sub.48IN.sub.9O.sub.9 [M + H] = 782.27 [M + H] = 782.1 [00795]embedded image   Intermediate A1-11 C.sub.28H.sub.49N.sub.9O.sub.9 [M + H] = 656.37 [M + H] = 656.3 [00796]embedded image   Intermediate A1-12 C.sub.24H.sub.41N.sub.9O.sub.7 [M + H] = 568.32 [M + H] = 568.8 [00797]embedded image   Intermediate A1-13 C.sub.37H.sub.57N.sub.11O.sub.10 [M + H] = 816.44 [M + H] = 816.4 [00798]embedded image   Intermediate A1-14 C.sub.33H.sub.49N.sub.11O.sub.8 [M + H] = 728.38 [M + H] = 728.3 [00799]embedded image   Intermediate A1-15 C.sub.36H.sub.54N.sub.10O.sub.10 [M + H] = 787.41 [M + H] = 787.8 [00800]embedded image   Intermediate A1-16 C.sub.32H.sub.46N.sub.10O.sub.8 [M + H] = 699.36 [M + H] = 699.2 [00801]embedded image   Intermediate A1-17 C.sub.35H.sub.53H.sub.11O.sub.10 [M + H] = 788.41 [M + H] = 788.4 [00802]embedded image   Intermediate A1-18 C.sub.3SH.sub.53N.sub.11O.sub.9 [M + H] = 772.41 [M + H] = 772.3 [00803]embedded image   Intermediate A1-19 C.sub.31H.sub.45N.sub.11O.sub.7 [M + H] = 684.36 [M + H] = 684.3 [00804]embedded image   Intermediate A1-20 C.sub.36H.sub.55N.sub.11O.sub.10 [M + H] = 802.42 [M + H] = 802.2 [00805]embedded image   Intermediate A1-21 C.sub.32H.sub.47N.sub.11O.sub.8 [M + H] = 714.37 [M + H] = 714.3 [00806]embedded image   Intermediate A1-22 C.sub.35H.sub.51N.sub.11O.sub.10 [M + H] = 786.39 [M + H] = 786.4 [00807]embedded image   Intermediate A1-23 C.sub.31H.sub.43N.sub.11O.sub.8 [M + H] = 698.34 [M + H] = 698.3 [00808]embedded image   Intermediate A1-24 C.sub.36H.sub.53N.sub.11O.sub.10 [M + H] = 800.41 [M + H] = 800.3 [00809]embedded image   Intermediate A1-25 C.sub.32H.sub.45N.sub.1108 [M + H] = 712.35 [M + H] = 712.3 [00810]embedded image   Intermediate A1-26 C.sub.37H.sub.55N.sub.11O.sub.10 [M + H] = 814.42 [M + H] = 814.3 [00811]embedded image   Intermediate A1-27 C.sub.33H.sub.47N.sub.11O.sub.8 [M + H] = 726.37 [M + H] = 726.3 [00812]embedded image   Intermediate A1-28 C.sub.39H.sub.53N.sub.11O.sub.10 [M + H] = 836.41 [M + H] = 836.3 [00813]embedded image   Intermediate A1-29 C.sub.35H.sub.45N.sub.11O.sub.8 [M + H] = 748.35 [M + H] = 748.2 [00814]embedded image   Intermediate A1-30 C.sub.41H.sub.55N.sub.11O.sub.10 [M + H] = 862.42 [M + H] = 862.3 [00815]embedded image   Intermediate A1-31 C.sub.37H.sub.47N.sub.11O.sub.8 [M + H] = 774.37 [M + H] = 774.3 [00816]embedded image   Intermediate A1-32 C.sub.47H.sub.51F.sub.3N.sub.8O.sub.8 [M + H] = 913.39 [M + H] = 913.3 [00817]embedded image   Intermediate A1-33 C.sub.48H.sub.57F.sub.3N.sub.12O.sub.9 [M + H] = 1003.44 [M + H] = 1003.4 [00818]embedded image   Intermediate A1-34 C.sub.39H.sub.54N.sub.14O.sub.10 [M + H] = 879.42 [M + H] = 879.3 [00819]embedded image   Intermediate A1-35 C.sub.43H.sub.60FN.sub.7O.sub.13S [M + H] = 934.41 [M + H] = 934.3 [00820]embedded image   Intermediate A1-36 C.sub.67H.sub.117N.sub.11O.sub.26 [M + H] = 1492.83 [M + H] = 1492.8

General Procedure 2: Synthesis of a Bivalent Rapamycin Analog Via Cu-Catalyzed Cycloaddition

[1178] ##STR00821##

[1179] To a 0.005M solution of alkynyl modified rapamycin (1.0 equiv) in MeOH was added the organoazide reagent (1.25 equiv) at 0° C. 1M aq. CuSO.sub.4 (3.7 equiv) was added to the reaction, followed by slow addition of 1M aq. sodium ascorbate (5.0 equiv). The reaction was allowed to stir from 0° C. to room temperature, until consumption of alkyne, as indicated by LCMS. The reaction mixture was concentrated under reduced pressure, diluted with DMSO, H.sub.2O, and formic acid, and purified by reverse phase HPLC to afford the product after lyophilization.

Example 1: Synthesis of Series 1 Bivalent Rapamycin Analog

[1180] ##STR00822##

[1181] To a solution of Monomer 1 (125 mg, 125 μmol, 1.0 equiv) in MeOH (25 mL) was added A1-17 (118 Mg, 150 μmol, 1.25 equiv). The reaction was cooled to 0° C. and 1M aq. CuSO.sub.4 (462 μL, 462 μmol, 3.7 equiv) was slowly added, followed by dropwise addition of 1M aq. sodium ascorbate (625 mL, 625 μmol, 5.0 equiv). The reaction was stirred under a N.sub.2 atmosphere from 0° C. to room temperature for 12 h. The reaction was then concentrated under reduced pressure, diluted with DMSO (3 mL), H.sub.2O (600 μL), and formic acid (30 μL) and purified by reverse phase HPLC (10.fwdarw.40.fwdarw.65% MeCN+0.1% formic acid/H.sub.2O+0.1% formic acid). Lyophilization of pure fractions provided product as a white solid (78.4 mg, 35% yield). LCMS (ESI) m/z: [M+H] calcd for C.sub.92H.sub.140N.sub.12O.sub.23: 1782.02; found 1781.8.

[1182] Following General Procedure 2, but using the appropriate alkynyl modified rapamycin and organoazide, the Series 1 bivalent analogs in Table 13 were synthesized:

TABLE-US-00016 TABLE 13 Series 1 Bivalent Analogs Molecular Calculated Observed Structure Formula MW MW [00823]embedded image   Example 1 C.sub.92H.sub.140N.sub.12O.sub.23 [M + H] = 1782.02 [M + H] = 1781.8 [00824]embedded image   Example 2 C.sub.86H.sub.128N.sub.12O.sub.20 [M + H] = 1649.94 [M + H] = 1650.0 [00825]embedded image   Example 3 CssH.sub.132N.sub.12O.sub.21 [M + H] = 1693.97 [M + H] = 1694.0 [00826]embedded image   Example 4 C.sub.85H.sub.135IN.sub.10O.sub.22 [M + H] = 1775.89 [M + H] = 1775.9 [00827]embedded image   Example 5 C.sub.85H.sub.136N.sub.10O.sub.22 [M + H] = 1649.99 [M + H] = 1649.7 [00828]embedded image   Example 6 C.sub.81H.sub.128N.sub.10O.sub.20 [M + H] = 1561.94 [M + H] = 1561.9 [00829]embedded image   Example 7 C.sub.93H.sub.140N.sub.12O.sub.23 [M + H] = 1794.02 [M + H] = 1793.9 [00830]embedded image   Example 8 C.sub.89H.sub.132N.sub.12O.sub.21 [M + H] = 1705.97 [M + H] = 1705.8 [00831]embedded image   Example 9 C.sub.93H.sub.142N.sub.12O.sub.24 [M + H] = 1812.03 [M + H] = 1811.8 [00832]embedded image   Example 10 C.sub.89H.sub.134N.sub.12O.sub.22 [M + Na] = 1745.97 [M + Na] = 1746.0 [00833]embedded image   Example 11 C.sub.104H.sub.147F.sub.3N.sub.10O.sub.24 [M + H] = 1978.06 [M +H] = 1977.9 [00834]embedded image   Example 12 C.sub.84H.sub.127N.sub.13O.sub.20 [M + H] = 1638.94 [M + H] = 1639.0 [00835]embedded image   Example 13 C.sub.86H.sub.131N.sub.13O.sub.21 [M + H] = 1682.97 [M + H] = 1682.7 [00836]embedded image   Example 14 C.sub.86H.sub.131N.sub.13O.sub.21 [M + H] = 1682.97 [M + H] = 1682.9 [00837]embedded image   Example 15 C.sub.86H.sub.131N.sub.13O.sub.21 [M + H] = 1682.97 [M + H] = 1682.9 [00838]embedded image   Example 16 C.sub.82H.sub.123N.sub.13O.sub.19 [M + H] = 1594.91 [M + H] = 1594.8 [00839]embedded image   Example 17 C.sub.90H.sub.139N.sub.13O.sub.23 [M + H] = 1771.02 [M + H] = 1770.8 [00840]embedded image   Example 18 C.sub.95H.sub.140N.sub.12O.sub.23 [M + H] = 1818.02 [M + H] = 1818.8 [00841]embedded image   Example 19 C.sub.91H.sub.132N.sub.12O.sub.21 [M + H] = 1729.97 [M + H] = 1730.9 [00842]embedded image   Example 20 C.sub.98H.sub.138N.sub.16O.sub.20 [M + H] = 1860.04 [M + H] = 1860.05 [00843]embedded image   Example 21 C.sub.96H.sub.134N.sub.16O.sub.19 [M + Na] = 1837.99 [M + Na] = 1837.9 [00844]embedded image   Example 22 C.sub.94H.sub.130N.sub.16O.sub.18 [M + H] = 1771.98 [M + H] = 1772.05 [00845]embedded image   Example 23 C.sub.99H.sub.140N.sub.16O.sub.21 [M + Na] = 1912.03 [M + Na] = 1912.7 [00846]embedded image   Example 24 C.sub.97H.sub.136N.sub.16O.sub.20 [M + Na] = 1868.00 [M + Na] = 1868.7 [00847]embedded image   Example 25 C.sub.95H.sub.132N.sub.16O.sub.19 [M + Na] = 1823.98 [M + Na] = 1823.6 [00848]embedded image   Example 26 C.sub.97H.sub.136N.sub.16O.sub.21S [M + H] = 1893.98 [M + H] = 1894.1 [00849]embedded image   Example 27 C.sub.95H.sub.132N.sub.16O.sub.2OS [M + H] = 1849.96 [M + H] = 1850.0 [00850]embedded image   Example 28 C.sub.93H.sub.128N.sub.16O.sub.19S [M + H] = 1805.93 [M + H] = 1806.0 [00851]embedded image   Example 29 C.sub.99H.sub.137N.sub.19O.sub.19 [M + Na] = 1919.03 [M + Na] = 1919.6 [00852]embedded image   Example 30 C.sub.97H.sub.133N.sub.19O.sub.18 [M + Na] = 1875.01 [M + Na] = 1875.0 [00853]embedded image   Example 31 C.sub.95H.sub.129N.sub.19O.sub.17 [M + Na] = 1830.98 [M + Na] = 1830.9 [00854]embedded image   Example 32 C.sub.100H.sub.139N.sub.19O.sub.20 [M + H] = 1927.04 [M + H] = 1927.1 [00855]embedded image   Example 33 C.sub.98H.sub.135N.sub.19O.sub.19 [M + Na] = 1905.02 [M + Na] = 1904.8 [00856]embedded image   Example 34 C.sub.96H.sub.131N.sub.19O.sub.18 [M + H] = 1839.00 [M + H] = 1839.1 [00857]embedded image   Example 35 C.sub.96H.sub.131N.sub.19O.sub.19S [M + H] = 1886.97 [M + H] = 1887.1 [00858]embedded image   Example 36 C.sub.94H.sub.127N.sub.19O.sub.18S [M + H] = 1842.94 [M + H] = 1843.2 [00859]embedded image   Example 37 C.sub.97H.sub.133N.sub.19O.sub.20S [M + H] = 1916.98 [M + H] = 1917.1 [00860]embedded image   Example 38 C.sub.93H.sub.141N.sub.13O.sub.24 [M + H] = 1825.03 [M + H] = 1825.0 [00861]embedded image   Example 39 C.sub.89H.sub.133N.sub.13O.sub.22 [M + H] = 1736.98 [M + H] = 1737.0 [00862]embedded image   Example 40 C.sub.95H.sub.144N.sub.12O.sub.23S [M + H] = 1854.03 [M + H] = 1853.8 [00863]embedded image   Example 41 C.sub.91H.sub.136N.sub.12O.sub.21S [M + H] = 1765.97 [M + H] = 1765.9 [00864]embedded image   Example 42 C.sub.93H.sub.141N.sub.11O.sub.23 [M + H] = 1781.03 [M + H] = 1781.0 [00865]embedded image   Example 43 C.sub.89H.sub.133N.sub.11O.sub.21 [M + H] = 1692.98 [M + H] = 1692.9 [00866]embedded image   Example 44 C.sub.100H.sub.139F.sub.3N.sub.10O.sub.22 [M + H] = 1890.01 [M + H] = 1890.0 [00867]embedded image   Example 45 C.sub.107H.sub.147F.sub.3N.sub.10O.sub.24 [M + H]/.sub.2 = 1007.03 [M + H] = 1007.0 [00868]embedded image   Example 46 C.sub.96H.sub.132N.sub.16O.sub.19 [M + H] = 1813.99 [M + H] = 1813.9 [00869]embedded image   Example 47 C.sub.94H.sub.128N.sub.16O.sub.18 [M + H] = 1769.97 [M + H] = 1770.1 [00870]embedded image   Example 48 C.sub.97H.sub.131N.sub.19O.sub.18 [M + H] = 1851.0 [M + H] = 1851.0 [00871]embedded image   Example 49 C.sub.95H.sub.127N.sub.19O.sub.17 [M + H] = 1806.97 [M + H] = 1806.9 [00872]embedded image   Example 50 C.sub.89H.sub.137N.sub.13O.sub.23 [M + H] = 1757.00 [M + H] = 1756.9 [00873]embedded image   Example 51 C.sub.8SH.sub.129N.sub.13O.sub.21 [M + H] = 1668.95 [M + H] = 1668.9 [00874]embedded image   Example 52 C.sub.97H.sub.136F.sub.3N.sub.11O.sub.22 [M + H] = 1864.99 [M + H] = 1864.9 [00875]embedded image   Example 53 C.sub.92H.sub.139N.sub.11O.sub.24 [M + H] = 1783.01 [M + H] = 1782.9 [00876]embedded image   Example 54 C.sub.90H.sub.135N.sub.12O.sub.22 [M + H] = 1735.98 [M + H] = 1735.8 [00877]embedded image   Example 55 C.sub.89H.sub.136N.sub.12O.sub.21 [M + H] = 1710.00 [M + H] = 1709.9 [00878]embedded image   Example 56 C.sub.92H.sub.138N.sub.12O.sub.23 [M + H] = 1780.01 [M + H] = 1779.8 [00879]embedded image   Example 57 C.sub.88H.sub.130N.sub.12O.sub.21 [M + H] = 1691.96 [M + H] = 1691.6 [00880]embedded image   Example 58 C.sub.94H.sub.144N.sub.12O.sub.23 [M + H] = 1810.05 [M + H] = 1810.0 [00881]embedded image   Example 59 C.sub.90H.sub.136N.sub.12O.sub.21 [M + H] = 1722.00 [M +H] = 1722.0 [00882]embedded image   Example 60 C.sub.86H.sub.127N.sub.13O.sub.22 [M + H] = 1694.93 [M + HJ = 1694.8 [00883]embedded image   Example 61 C.sub.90H.sub.135N.sub.13O.sub.24 [M + H] = 1782.98 [M + H] = 1782.9 [00884]embedded image   Example 62 C.sub.96H.sub.137N.sub.15O.sub.22 [M + H] = 1853.01 [M + H] = 1853.2 [00885]embedded image   Example 63 C.sub.89H.sub.135N.sub.13O.sub.23 [M + H] = 1754.99 [M + HI = 1754.9 [00886]embedded image   Example 64 C.sub.91H.sub.141N.sub.13O.sub.23 [M + H] = 1785.03 [M + H] = 1785.4 [00887]embedded image   Example 65 C.sub.87H.sub.133N.sub.13O.sub.21 [M + H] = 1696.98 [M + H] = 1696.9 [00888]embedded image   Example 66 C.sub.105H.sub.144F.sub.3N.sub.13O.sub.22 [M + H] = 1997.06 [M + H] = 1997.3 [00889]embedded image   Example 67 C.sub.104H.sub.138F.sub.3N.sub.9O.sub.21 [M + H] = 1907.00 [M + H] = 1906.7 [00890]embedded image   Example 68 C.sub.88H.sub.132N.sub.12O.sub.20 [M + H] = 1677.98 [M + H] = 1677.9 [00891]embedded image   Example 69 C.sub.92H.sub.140N.sub.12O.sub.22 [M + H] = 1766.03 [M + H] = 1765.9

General Procedure 3: Synthesis of a Bivalent Rapamycin Analog Via Cu-Catalyzed Cycloaddition

[1183] ##STR00892##

[1184] In the above scheme, “-spacer-” is meant to be in any appropriate position on the compound, as allowed.

[1185] To a 0.01M solution of alkynyl modified rapamycin (1.0 equiv) in DMSO was added the organoazide reagent (2.0 equiv). To the reaction was then added tetrakis(acetonitrile)copper(I) hexafluorophosphate (2.0 equiv) followed by TBTA (4.0 equiv). The reaction was allowed to stir until consumption of alkyne, as indicated by LCMS. The reaction mixture was then diluted with DMSO and formic acid, and purified by reverse phase HPLC to afford the product after lyophilization.

Example 70: Synthesis of Series 1 Bivalent Rapamycin Analog

[1186] ##STR00893##

[1187] To a solution of Monomer 44 (20 mg, 19.7 μmol, 1.0 equiv) and A1-19 (26.9 mg, 39.4 μmol, 2.0 equiv) in DMSO (1.96 mL) was added tetrakis(acetonitrile)copper(I) hexafluorophosphate (14.6 mg, 39.4 μmol, 2.0 equiv) followed by TBTA (41.8 mg, 78.8 μmol, 4.0 equiv). The reaction stirred for 3 h and was then diluted with DMSO (2 mL) and formic acid (1 mL) and purified by reverse phase HPLC (10.fwdarw.40.fwdarw.95% MeCN+0.1% formic acid/H.sub.2O+0.1% formic acid). Lyophilization of pure fractions provided product as a white solid (11.7 mg, 35% yield). LCMS (ESI) m/z: [M+H] calcd for C.sub.89H.sub.136N.sub.12O.sub.20: 1694.01; found 1694.4.

[1188] Following General Procedure 3, but using the appropriate alkynyl modified rapamycin and organoazide, the Series 1 bivalent analogs in Table 14 were synthesized:

TABLE-US-00017 TABLE 14 Series 1 Bivalent Analogs Molecular Structure Formula [00894]embedded image C.sub.89H.sub.136N.sub.12O.sub.20 [00895]embedded image C.sub.94H.sub.142N.sub.12O.sub.24 [00896]embedded image C.sub.105H.sub.148F.sub.3N.sub.11O.sub.25 [00897]embedded image C.sub.101H.sub.140F.sub.3N.sub.11O.sub.23 [00898]embedded image C.sub.90H.sub.134N.sub.12O.sub.21 [00899]embedded image C.sub.100H.sub.148N.sub.12O.sub.25 [00900]embedded image C.sub.96H.sub.141N.sub.11O.sub.23 [00901]embedded image C.sub.93H.sub.144N.sub.12O.sub.23 [00902]embedded image C.sub.101H.sub.144F.sub.3N.sub.11O.sub.24 [00903]embedded image C.sub.89H.sub.137N.sub.13O.sub.22 [00904]embedded image C.sub.85H.sub.129N.sub.13O.sub.20 [00905]embedded image C.sub.93H.sub.141N.sub.13O.sub.23 [00906]embedded image C.sub.93H.sub.144N.sub.12O.sub.22 [00907]embedded image C.sub.93H.sub.142N.sub.12O.sub.23 [00908]embedded image C.sub.89H.sub.134N.sub.12O.sub.21 [00909]embedded image C.sub.96H.sub.140N.sub.12O.sub.23 [00910]embedded image C.sub.92H.sub.132N.sub.12O.sub.21 [00911]embedded image C.sub.95H.sub.139N.sub.13O.sub.23 [00912]embedded image C.sub.98H.sub.142N.sub.12O.sub.23 [00913]embedded image C.sub.94H.sub.134N.sub.12O.sub.21 [00914]embedded image C.sub.94H.sub.142N.sub.12O.sub.23 [00915]embedded image C.sub.90H.sub.134N.sub.12O.sub.21 [00916]embedded image C.sub.99H.sub.146N.sub.12O.sub.23 [00917]embedded image C.sub.86H.sub.130N.sub.12O.sub.21 [00918]embedded image C.sub.90H.sub.138N.sub.12O.sub.23 [00919]embedded image C.sub.96H.sub.141N.sub.15O.sub.23 [00920]embedded image C.sub.100H.sub.147FN.sub.8O.sub.26S [00921]embedded image C.sub.124H.sub.204N.sub.12O.sub.39 [00922]embedded image C.sub.92H.sub.142N.sub.14O.sub.22 Calculated Structure MW [00923]embedded image [M + H] = 1694.01 [00924]embedded image [M + H] = 1824.03 [00925]embedded image [M + H]/2 = 1010.54 [00926]embedded image [M + H] = 1933.02 [00927]embedded image [M + H] = 1719.99 [00928]embedded image [M + H] = 1918.08 [00929]embedded image [M + H] = 1817.03 [00930]embedded image [M + H] = 1798.05 [00931]embedded image [M + H] = 1953.04 [00932]embedded image [M + H] = 1741.01 [00933]embedded image [M + H] = 1652.96 [00934]embedded image [M + H] = 1809.03 [00935]embedded image [M + H] = 1782.06 [00936]embedded image [M + H] = 1796.04 [00937]embedded image [M + H] = 1707.99 [00938]embedded image [M + H] = 1830.02 [00939]embedded image [M + H] = 1741.97 [00940]embedded image [M + H] = 1831.02 [00941]embedded image [M + H] = 1856.04 [00942]embedded image [M + H] = 1767.99 [00943]embedded image [M + H] = 1808.04 [00944]embedded image [M + H] = 1719.99 [00945]embedded image [M + H] = 1872.07 [00946]embedded image [M + H] = 1677.96 [00947]embedded image [M + H] = 1756.01 [00948]embedded image [M + H] = 1873.04 [00949]embedded image [M + H] = 1928.02 [00950]embedded image [M + 2H]/2 = 1244.22 [00951]embedded image [M + H] = 1796.05 Observed Structure MW [00952]embedded image [M + H] = 1694.4 [00953]embedded image [M + H] = 1824.1 [00954]embedded image [M + H]/2 = 1010.3 [00955]embedded image [M + H] = 1933.0 [00956]embedded image [M + H] = 1720.0 [00957]embedded image [M + H] = 1918.0 [00958]embedded image [M + H] = 1817.2 [00959]embedded image [M + H] = 1798.4 [00960]embedded image [M + H] = 1953.1 [00961]embedded image [M + H] = 1741.1 [00962]embedded image [M + H] = 1652.9 [00963]embedded image [M + H] = 1809.0 [00964]embedded image [M + H] = 1782.1 [00965]embedded image [M + H] = 1796.05 [00966]embedded image [M + H] = 1708.0 [00967]embedded image [M + H] = 1829.9 [00968]embedded image [M + H] = 1741.8 [00969]embedded image [M + H] = 1830.7 [00970]embedded image [M + H] = 1856.0 [00971]embedded image [M + H] = 1767.9 [00972]embedded image [M + H] = 1808.1 [00973]embedded image [M + H] = 1719.8 [00974]embedded image [M + H] = 1871.9 [00975]embedded image [M + H] = 1667.8 [00976]embedded image [M + H] = 1755.9 [00977]embedded image [M + H] = 1873.1 [00978]embedded image [M + H] = 1928.3 [00979]embedded image [M + 2H]/2 = 1244.3 [00980]embedded image [M + H] = 1796.0

General Procedure 4: Extension of Amino-Terminal Peg Unit by Reaction with a Cyclic Anhydride to Prepare Intermediates B1

[1189] ##STR00981##

[1190] To a reaction vial was added the amino-peg-azide linker section (1.0 equiv) followed by DCM, such that concentration of this reagent was 0.27 M. The cyclic anhydride (1.09 mmol, 1.0 equiv) and trimethylamine (0.1 equiv) were sequentially added to the reaction solution. The reaction vial was capped and stirred at room temperature overnight. The resulting reaction mixture was concentrated under reduced pressure to yield a colorless foamy residue. Purification by silica gel chromatography provides the desired Intermediates B1.

Intermediate B1-1: Synthesis of 1-azido-13-oxo-3,6,9-trioxa-12-azahexadecan-16-oic Acid

[1191] ##STR00982##

[1192] To a reaction vial was added 2-(2-(2-(2-azidoethoxy)ethoxy)ethoxy)ethanamine (250 mg, 1.09 mmol, 1.0 equiv) followed by DCM (4 mL). Dihydrofuran-2,5-dione (109 mg, 1.09 mmol, 1.0 equiv) and trimethylamine (11.0 mg, 109 μmol, 0.1 equiv) were sequentially added to the reaction solution. The reaction vial was capped and stirred at room temperature for 18 h. The reaction mixture was concentrated under reduced pressure to yield a colorless foamy residue. Purification by silica gel chromatography (0.fwdarw.5% MeOH/DCM) provided the product, 1-azido-13-oxo-3,6,9-trioxa-12-azahexadecan-16-oic acid, as a colorless oil (250 mg, 72% yield). LCMS (ESI) m/z: [M−H] calcd for C.sub.12H.sub.22N.sub.4O.sub.6: 317.15; found 316.8.

[1193] Following the General Procedure 4, but using the appropriate cyclic anhydride and amino-peg precursor, the additional Intermediates B1 in Table 15 were prepared.

TABLE-US-00018 TABLE 15 Additional carboxylic acid linker Intermediates B1 prepared. Molecular Calculated Observed Structure Formula MW MW [00983]embedded image C.sub.12H.sub.22N.sub.4O.sub.6 [M − H] = 317.15 [M − H] = 316.8 [00984]embedded image C.sub.14H.sub.26N.sub.4O.sub.7 [M − H] = 361.17 [M − H] = 360.8 [00985]embedded image C.sub.13H.sub.24N.sub.4O.sub.6 [M − H] = 331.16 [M − H] = 330.8 [00986]embedded image C.sub.15H.sub.28N.sub.4O.sub.7 [M − H] = 375.19 [M − H] = 374.8 [00987]embedded image C.sub.14H.sub.26N.sub.4O.sub.6 [M − H] = 345.18 [M − H] = 344.8 [00988]embedded image C.sub.16H.sub.30N.sub.4O.sub.7 [M − H] = 389.20 [M − H] = 388.8 [00989]embedded image C.sub.16H.sub.30N.sub.4O.sub.8 [M + H] = 407.21 [M + H] = 407.1

General Procedure 5: Coupling of an Amine-Containing Active Site Inhibitor with Intermediates B1 to Prepare Intermediates B2

[1194] ##STR00990##

[1195] To a 0.18 M suspension of carboxylic acid (1.0 equiv) in DMF was added amine salt (1.0 equiv), HOBt hydrate (1.2 equiv), diisopropylethylamine (2.5 equiv), and EDCI HCl (1.2 equiv). The reaction was stirred at room temperature under N.sub.2 atmosphere for 14 h and then concentrated under reduced pressure, and the resulting residue was azeotroped with toluene (3×). Purification by chromatography on silica gel afforded the product.

Intermediate B2-1: Synthesis of N1-(4-(4-amino-3-(2-aminobenzo[d]oxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)-N4-(2-(2-(2-(2-azidoethoxy)ethoxy)ethoxy)ethyl)succinamide

[1196] ##STR00991##

[1197] To a suspension of 1-azido-13-oxo-3,6,9-trioxa-12-azahexadecan-16-oic acid (116 mg, 364 μmol, 1.0 equiv) in DMF (2 mL) was added 5-(4-amino-1-(4-aminobutyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]oxazol-2-amine, TFA salt (164 mg, 364 μmol, 1.0 equiv), HOBt hydrate (66.7 mg, 436 μmol, 1.2 equiv), diisopropylethylamine (157 μL, 909 μmol, 2.5 equiv), and then EDCI HCl (83.5 mg, 436 μmol, 1.2 equiv). The reaction mixture was stirred under N.sub.2 atmosphere overnight at room temperature. The reaction mixture was concentrated under reduced pressure removing as much of the DMF as possible and then azeotroped with toluene three times. Purification by silica gel chromatography (0.fwdarw.20% MeOH/DCM) provided the product, N1-(4-(4-amino-3-(2-aminobenzo[d]oxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)-N4-(2-(2-(2-(2-azidoethoxy)ethoxy)ethoxy) ethyl)succinamide, as a tan colored gummy solid (58 mg, 25% yield). LCMS (ESI) m/z: [M+H] calcd for C.sub.28H.sub.38N.sub.12O.sub.6: 639.30; found 639.2.

[1198] Following General Procedure 5 above, but using the appropriate carboxylic acid linker section from Table 15, the Intermediates B2 in Table 16 were prepared.

TABLE-US-00019 TABLE 16 Additional active site inhibitor containing Intermediates B2 prepared. Calcu- Ob- Molecular lated served Structure Formula MW MW [00992]embedded image C.sub.28H.sub.38N.sub.12O.sub.6 [M + H] = 639.30 [M + H] = 639.2 [00993]embedded image C.sub.30H.sub.42N.sub.12O.sub.7 [M + H] = 683.34 [M + H] = 683.2 [00994]embedded image C.sub.29H.sub.40N.sub.12O.sub.6 [M + H] = 653.33 [M + H] = 653.3 [00995]embedded image C.sub.31H.sub.44N.sub.12O.sub.7 [M + H] = 697.35 [M + H] = 697.3 [00996]embedded image C.sub.30H.sub.42N.sub.12O.sub.6 [M + H] = 667.34 [M + H] = 667.3 [00997]embedded image C.sub.32H.sub.46N.sub.12O.sub.7 [M + H] = 711.37 [M + H] = 711.3 [00998]embedded image C.sub.32H.sub.46N.sub.12O.sub.8 [M + H] = 727.36 [M + H] = 727.3

[1199] Following General Procedure 2 above, but using the appropriate Intermediates B2 from Table 16, the Series 2 bifunctional rapamycin analog in Table 17 were prepared.

TABLE-US-00020 TABLE 17 Series 2 Bivalent Compounds Molecular Structure Formula [00999]embedded image C.sub.85H.sub.125N.sub.13O.sub.19 [01000]embedded image C.sub.87H.sub.129N.sub.13O.sub.20 [01001]embedded image C.sub.86H.sub.127N.sub.13O.sub.19 [01002]embedded image C.sub.88H.sub.131N.sub.13O.sub.20 [01003]embedded image C.sub.87H.sub.129N.sub.13O.sub.19 [01004]embedded image C.sub.89H.sub.133N.sub.13O.sub.20 [01005]embedded image C.sub.86H.sub.130N.sub.14O.sub.20 [01006]embedded image C.sub.87H.sub.132N.sub.14O.sub.21 Calculated Structure MW [01007]embedded image [M + H] = 1632.93 [01008]embedded image [M + H] = 1676.95 [01009]embedded image [M + H] = 1646.94 [01010]embedded image [M + H] = 1690.97 [01011]embedded image [M + H] = 1660.96 [01012]embedded image [M + H] = 1704.99 [01013]embedded image [M + H] = 1679.97 [01014]embedded image [M + H] = 1709.98 Observed Structure MW [01015]embedded image [M + H] = 1632.9 [01016]embedded image [M + H] = 1676.6 [01017]embedded image [M + H] = 1646.8 [01018]embedded image [M + H] = 1690.8 [01019]embedded image [M + H] = 1660.7 [01020]embedded image [M + H] = 1704.8 [01021]embedded image [M + H] = 1679.9 [01022]embedded image [M + H] = 1709.9

General Procedure 6: Coupling of an Carboxylic Acid-Containing Active Site Inhibitor with Azide Containing PEG-Amine

[1200] ##STR01023##

[1201] To a 0.18 M suspension of carboxylic acid (1.0 equiv) in DMA was added PEG-amine (1.8 equiv), DIPEA (4.0 equiv) and PyBOP (1.8 equiv). The reaction was allowed to stir until consumption of carboxylic acid, as indicated by LCMS. The reaction mixture was then purified by reverse phase HPLC to afford the product after lyophilization.

Intermediate C1-1: Synthesis of (1r,4r)-4-[4-amino-5-(7-methoxy-1H-indol-2-yl)imidazo[4,3-f][1,2,4]triazin-7-yl]-N-(20-azido-3,6,9,12,15,18-hexaoxaicosan-1-yl)cyclohexane-1-carboxamide

[1202] ##STR01024##

[1203] To a solution of (1r,4r)-4-[4-amino-5-(7-methoxy-1H-indol-2-yl)imidazo[4,3-f][1,2,4]triazin-7-yl]cyclohexane-1-carboxylic acid (50 mg, 123 μmol, 1.0 equiv) and 20-azido-3,6,9,12,15,18-hexaoxaicosan-1-amine (77.4 mg, 221 μmol, 1.8 equiv) in DMA (1.22 mL) was added DIPEA (85.4 μL, 491 μmol, 4.0 equiv) followed by PyBOP (82.7 mg, 159 μmol, 1.8 equiv). The reaction was stirred at room temperature for 2 h. The crude reaction mixture was then purified by reverse phase HPLC (10.fwdarw.100% MeCN/H.sub.2O). Lyophilization of pure fractions provided product as a white solid (47.2 mg, 52% yield). LCMS (ESI) m/z: [M+H] calcd for C.sub.35H.sub.50N.sub.10O.sub.8: 739.39; found 739.4.

[1204] Following the General Procedure 6, but using the appropriate carboxylic acid and azide functionalized amine, the additional Intermediates C1 in Table 18 were prepared.

TABLE-US-00021 TABLE 18 Additional active site inhibitor containing Intermediates C1 prepared. Molecular Calculated Observed Structure Formula MW MW [01025]embedded image C.sub.35H.sub.50N.sub.10O.sub.8 [M + H] = 739.39 [M + H] = 739.4 [01026]embedded image C.sub.42H.sub.63N.sub.9O.sub.11 [M + H] = 870.47 [M + H] = 870.4 [01027]embedded image C.sub.39H.sub.58N.sub.10O.sub.10 [M + H] = 827.44 [M + H] = 827.4

[1205] Following General Procedure 3, but using the appropriate alkynyl modified rapamycin and Intermediates C1 from Table 18, the Series 3 bivalent analogs in Table 19 were synthesized:

TABLE-US-00022 TABLE 19 Series 3 Bivalent Analogs Molecular Structure Formula [01028]embedded image C.sub.92H.sub.137N.sub.11O.sub.21 [01029]embedded image C.sub.99H.sub.150N.sub.10O.sub.24 [01030]embedded image C.sub.96H.sub.145N.sub.11O.sub.23 Calculated Structure MW [01031]embedded image [M + H] = 1733.01 [01032]embedded image [M + H] = 1864.09 [01033]embedded image [M + H] = 1821.06 Observed Structure MW [01034]embedded image [M + H] = 1733.8 [01035]embedded image [M + H] = 1863.8 [01036]embedded image [M + H] = 1720.9

General Procedure 7: Coupling of an Amine-Reactive Alkyne Containing Pre-Linker and Amine Containing Ester to Prepare Intermediates D1

[1206] ##STR01037##

Step 1

[1207] To a 0.14M solution of carboxylic acid (1.25 equiv) in DMF was added HATU (1.9 equiv) and DIPEA (3.75 equiv) followed by amino-PEG-ester (1.0 equiv). The reaction was allowed to stir until consumption of carboxylic acid, as indicated by LCMS. The mixture was poured into H.sub.2O and the aqueous phase was extracted with DCM. The combined organic phases were washed with brine, dried with anhydrous Na.sub.2SO.sub.4, filtered and the filtrate was concentrated in vacuum. The residue was purified by silica gel chromatography to afford the product.

Step 2

[1208] A 0.67M solution of ester (1 equiv) in TFA was allowed to stir until consumption of ester, as indicated by LCMS. The reaction mixture was quenched with a 0.24M solution of DIPEA in DCM at 0° C., followed by NH.sub.4Cl. The aqueous phase was extracted with DCM, and the combined organic phases were dried with anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the product.

Intermediate D1-4: Synthesis of 3-[2-[2-[2-[2-[[2-[4-(5-ethynylpyrimidin-2-yl)piperazin-1-yl]pyrimidine-5-carbonyl]amino]ethoxy]ethoxy]ethoxy]ethoxy]propanoic Acid

[1209] ##STR01038##

Step 1

[1210] To a solution of 2-[4-(5-ethynylpyrimidin-2-yl)piperazin-1-yl]pyrimidine-5-carboxylic acid (8.5 g, 24.51 mmol, 1.25 equiv, HCl) in DMF (170 mL) was added HATU (13.98 g, 36.77 mmol, 1.9 equiv) and DIPEA (12.81 mL, 73.54 mmol, 3.75 equiv). After stirring for 30 min, tert-butyl 3-[2-[2-[2-(2-aminoethoxy)ethoxy]ethoxy]ethoxy]propanoate (6.30 g, 19.61 mmol, 1.0 equiv) was added to the reaction mixture, at which point the reaction mixture was stirred for an additional 30 min at room temperature. The reaction mixture was quenched with NH.sub.4Cl (100 mL) and the aqueous phase was extracted with EtOAc (3×150 mL). The combined organic phases were washed with brine (20 mL), dried with anhydrous Na.sub.2SO.sub.4, filtered and concentrated in vacuum to give crude product. The crude product was purified by silica gel chromatography (25/1 to 4/1 DCM/MeOH) to give the product (6.3 g, 54.2% yield) as light yellow solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.30H.sub.43N.sub.7O.sub.7: 614.33; found 614.4.

Step 2

[1211] A solution of tert-butyl 3-[2-[2-[2-[2-[[2-[4-(5-ethynylpyrimidin-2-yl)piperazin-1-yl]pyrimidine-5-carbonyl]amino]ethoxy]ethoxy]ethoxy]ethoxy]propanoate (3.3 g, 5.38 mmol, 1.0 equiv) in TFA (8 mL) was stirred at room temperature for 5 min. To the reaction mixture was added a solution of DIPEA (18.8 mL) in DCM (80 mL) at 0° C., then NH.sub.4Cl (100 mL) was added to the reaction mixture. The aqueous phase was extracted with DCM (10×200 mL). The combined organic phases were dried with anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the product (3 g, 80% yield) as light yellow solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.26H.sub.35N.sub.7O.sub.7: 558.27; found 558.2.

[1212] Following the General Procedure 7, but using the appropriate PEG-ester, the additional Intermediates D1 in Table 20 were prepared:

TABLE-US-00023 TABLE 20 Additional alkynes prepared Calcu- Molecular lated Structure Formula MW [01039]embedded image C.sub.20H.sub.23N.sub.7O.sub.4 [M + H] = 426.19 [01040]embedded image C.sub.22H.sub.27N.sub.7O.sub.5 [M + H] = 470.22 [01041]embedded image C.sub.24H.sub.31N.sub.7O.sub.6 [M + H] = 514.24 [01042]embedded image C.sub.26H.sub.35N.sub.7O.sub.7 [M + H] = 558.27 [01043]embedded image C.sub.28H.sub.39N.sub.7O.sub.8 [M + H] = 602.29 Observed Structure MW [01044]embedded image [M + H] = 426.1 [01045]embedded image [M + H] = 470.2 [01046]embedded image [M + H] = 514.2 [01047]embedded image [M + H] = 558.2 [01048]embedded image [M + H] = 602.4

General Procedure 8: Coupling of an Alkyne Containing Acid and Amine-Containing Active Site Inhibitor

[1213] ##STR01049##

[1214] To a 0.16M solution of carboxylic acid (1.0 equiv) in DMF was added HATU (1.5 equiv) and DIPEA (3.0 equiv). The reaction was allowed to stir for 30 min, and then the reaction was cooled to 0° C. and the amine-containing active site inhibitor (1.0 equiv) was added. The reaction was allowed to stir until consumption of carboxylic acid, as indicated by LCMS. The reaction mixture was then purified by reverse phase HPLC to afford the product.

Intermediate D2-7: Synthesis of N-[2-[2-[2-[2-[3-[4-[4-amino-3-(2-amino-1,3-benzoxazol-5-yl)pyrazolo[3,4-d]pyrimidin-1-yl]butylamino]-3-oxo-propoxy]ethoxy]ethoxy]ethoxy]ethyl]-2-[4-(5-ethynylpyrimidin-2-yl)piperazin-1-yl]pyrimidine-5-carboxamide

[1215] ##STR01050##

[1216] To a solution of 3-[2-[2-[2-[2-[[2-[4-(5-ethynylpyrimidin-2-yl) piperazin-1-yl] pyrimidine-5-carbonyl] amino]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid (1.8 g, 3.23 mmol, 1.0 equiv) in DMF (20 mL) was added HATU (1.84 g, 4.84 mmol, 1.5 equiv), and DIPEA (1.25 g, 9.68 mmol, 1.69 mL, 3.0 equiv). The mixture was stirred at room temperature for 30 min, and then the reaction mixture was cooled to 0° C. and 5-[4-amino-1-(4-aminobutyl)pyrazolo[3,4-d]pyrimidin-3-yl]-1,3-benzoxazol-2-amine (1.09 g, 3.23 mmol, 1.0 equiv) was added. The reaction was stirred at room temperature for 1 hr, and then H.sub.2O (10 mL) was added. The reaction was purified by prep-HPLC (25.fwdarw.45% MeCN/H.sub.2O (10 mM NH.sub.4OAc)) to give the product (0.5 g, 17.6% yield) as light yellow solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.42H.sub.51N.sub.15O.sub.7: 878.42; found 878.3.

[1217] Following the General Procedure 8, but using the appropriate amine-containing active site inhibitor and alkyne functionalized carboxylic acids from Table 20, the additional Intermediates D2 in Table 21 were prepared:

TABLE-US-00024 TABLE 21 Additional active site inhibitor containing Intermediates D2 prepared. Molecular Calculated Observed Structure Formula MW MW [01051]embedded image C.sub.36H.sub.39N.sub.15O.sub.4 [M + H] = 746.34 [M + H] = 746.3 [01052]embedded image C.sub.37H.sub.40N.sub.14O.sub.4 [M + H] = 745.34 [M + H] = 745.3 [01053]embedded image C.sub.38H.sub.43N.sub.15O.sub.5 [M + H] = 790.36 [M + H] = 790.3 [01054]embedded image C.sub.39H.sub.44N.sub.14O.sub.5 [M + H] = 789.37 [M + H] = 789.3 [01055]embedded image C.sub.40H.sub.47N.sub.15O.sub.6 [M + H] = 834.39 [M + H] = 834.2 [01056]embedded image C.sub.41H.sub.48N.sub.14O.sub.6 [M + H] = 833.40 [M + H] = 833.3 [01057]embedded image C.sub.42H.sub.51N.sub.15O.sub.7 [M + H] = 878.42 [M + H] = 878.3 [01058]embedded image C.sub.43H.sub.52N.sub.14O.sub.7 [M + H] = 877.42 [M + H] = 877.4 [01059]embedded image C.sub.48H.sub.53N.sub.15O.sub.7 [M + H] = 952.43 [M + H] = 952.5 [01060]embedded image C.sub.44H.sub.55N.sub.15O.sub.8 [M + H] = 922.44 [M + H] = 922.3 [01061]embedded image C.sub.45H.sub.56N.sub.14O.sub.8 [M + H] = 921.45 [M + H] = 921.4

General Procedure 9: Synthesis of a Bivalent Rapamycin Analog Via Cu-Catalyzed Cycloaddition

[1218] ##STR01062##

[1219] To a 0.05M solution of azido modified rapamycin (1.0 equiv) in DMSO was added the organoalkyne reagent (2.0 equiv). To the reaction was then added tetrakis(acetonitrile)copper(I) hexafluorophosphate (2.0 equiv) followed by TBTA (4.0 equiv). The reaction was allowed to stir until consumption of alkyne, as indicated by LCMS. The reaction mixture was then diluted with DMSO and formic acid, and purified by reverse phase HPLC to afford the product after lyophilization.

Example 115: Synthesis of Series 4 Bivalent Rapamycin Analog

[1220] ##STR01063##

[1221] To a solution of Cao-azido rapamycin (20 mg, 21.3 μmol, 1.0 equiv) and D2-7 (37.3 mg, 42.6 μmol, 2.0 equiv) in DMSO (425 μL) was added tetrakis(acetonitrile)copper(I) hexafluorophosphate (15.8 mg, 42.6 μmol, 2.0 equiv) followed by TBTA (45.1 mg, 85.2 μmol, 4.0 equiv). The reaction stirred for 6 h and was then purified by reverse phase HPLC (10.fwdarw.40.fwdarw.95% MeCN+0.1% formic acid/H.sub.2O+0.1% formic acid). Lyophilization of pure fractions provided product (8.31 mg, 21.5% yield) as a white solid. LCMS (ESI) m/z: [M+Na] calcd for C.sub.93H.sub.129N.sub.19O.sub.19: 1838.96; found 1838.8.

[1222] Following General Procedure 9, but using the appropriate azido modified rapamycin and Intermediates D2 from Table 21, the Series 4 bivalent analogs in Table 22 were synthesized:

TABLE-US-00025 TABLE 22 Series 4 Bivalent Analogs Molecular Structure Formula [01064]embedded image C.sub.87H.sub.117N.sub.19O.sub.16 [01065]embedded image C.sub.88H.sub.118N.sub.18O.sub.16 [01066]embedded image C.sub.89H.sub.121N.sub.19O.sub.17 [01067]embedded image C.sub.90H.sub.122N.sub.18O.sub.17 [01068]embedded image C.sub.91H.sub.125N.sub.19O.sub.18 [01069]embedded image C.sub.92H.sub.126N.sub.18O.sub.18 [01070]embedded image C.sub.93H.sub.129N.sub.19O.sub.19 [01071]embedded image C.sub.94H.sub.130N.sub.18O.sub.19 [01072]embedded image C.sub.99H.sub.131N.sub.19O.sub.19 [01073]embedded image C.sub.95H.sub.133N.sub.19O.sub.20 [01074]embedded image C.sub.96H.sub.134N.sub.18O.sub.20 Calculated Structure MW [01075]embedded image [M + H] = 1684.90 [01076]embedded image [M + H] = 1683.91 [01077]embedded image [M + H] = 1728.93 [01078]embedded image [M + H] = 1727.93 [01079]embedded image [M + H] = 1772.95 [01080]embedded image [M + H] = 1771.96 [01081]embedded image [M + Na] = 1838.96 [01082]embedded image [M + H] = 1815.98 [01083]embedded image [M + H] = 1890.99 [01084]embedded image [M + H] = 1861.01 [01085]embedded image [M + H] = 1860.01 Observed Structure MW [01086]embedded image [M + H] = 1684.75 [01087]embedded image [M + H] = 1684.0 [01088]embedded image [M + H] = 1728.7 [01089]embedded image [M + H] = 1727.9 [01090]embedded image [M + H] = 1772.7 [01091]embedded image [M + H] = 1771.8 [01092]embedded image [M + Na] = 1838.8 [01093]embedded image [M + H] = 1815.9 [01094]embedded image [M + H] = 1891.2 [01095]embedded image [M + H] = 1861.0 [01096]embedded image [M + H] = 1859.8

General Procedure 10: Coupling of an Amine-Reactive Alkyne Containing Pre-Linker and Amine Containing PEG-Ester

[1223] ##STR01097##

Step 1

[1224] To a 0.3M solution of amine (1.0 equiv) in DCM at 0° C. was added DIPEA (1.3 equiv) followed by amine-reactive pre-linker (1.05 equiv). The reaction was allowed to stir until consumption of PEG-amine. The mixture was poured into H.sub.2O and the aqueous phase was extracted with DCM. The combined organic phases were washed with NH.sub.4Cl, brine, dried with anhydrous Na.sub.2SO.sub.4, filtered and the filtrate was concentrated in vacuum. The residue was purified by silica gel chromatography to afford the product.

Step 2

[1225] A 1.58M solution of ester (1 equiv) in TFA was allowed to stir until consumption of the ester, as indicated by LCMS. The reaction mixture was reduced under reduced pressure and the resulting residue was purified by silica gel chromatography to afford the product.

Intermediate E1-2: Synthesis of 1-{[(prop-2-yn-1-yloxy)carbonyl]amino}-3,6,9,12-tetraoxapentadecan-15-oic Acid

[1226] ##STR01098##

Step 1

[1227] To a solution of tert-butyl 1-amino-3,6,9,12-tetraoxapentadecan-15-oate (14.5 g, 45.11 mmol, 1.0 equiv) and DIPEA (10.22 mL, 58.65 mmol, 1.3 equiv) in DCM (150 mL) was added prop-2-yn-1-yl carbonochloridate (5.61 g, 47.37 mmol, 1.05 equiv) at 0° C. The reaction solution was stirred at room temperature for 2 h, at which point the mixture was poured into ice-H.sub.2O (200 mL) and stirred for 5 min. The aqueous phase was extracted with DCM (3×100 mL). The combined organic phase was washed with aqueous NH.sub.4Cl (2×80 mL), brine (100 mL), dried with anhydrous Na.sub.2SO.sub.4, filtered and concentrated in vacuo. The residue was purified by silica gel chromatography (1/0 to 1/1 petroleum ether/EtOAc) to afford tert-butyl 5-oxo-4,9,12,15,18-pentaoxa-6-azahenicos-1-yn-21-oate (13.5 g, 74.2% yield) as light yellow oil.

Step 2

[1228] To tert-butyl 5-oxo-4,9,12,15,18-pentaoxa-6-azahenicos-1-yn-21-oate (15 g, 37.18 mmol, 1.0 equiv) was added TFA (23.45 mL, 316.70 mmol, 8.52 equiv) at room temperature. The reaction was stirred for 5 min and then the mixture was concentrated under reduced pressure at 45° C. The residue was purified by silica gel chromatography (0/1 to 1/20 MeOH/EtOAc) to afford the product (12 g, 92.9% yield) as light yellow oil.

[1229] Following the General Procedure 10, but using the appropriate amine-reactive pre-linker and amine functionalized ester, the additional Intermediates E1 in Table 23 were prepared:

TABLE-US-00026 TABLE 23 Additional carbonxylic acid linker Intermediates E1 prepared. Molecular Calculated Observed Structure Formula MW MW [01099]embedded image C.sub.13H.sub.21NO.sub.7 [M + Na] = 326.12 [M + Na] = 326.1 [01100]embedded image C.sub.15H.sub.25NO.sub.8 [M + H] = 348.17 [01101]embedded image C.sub.15H.sub.25NO.sub.6 [M + H] = 316.18 [M + H] = 316.0 [01102]embedded image C.sub.17H.sub.29NO.sub.7 [M + H] = 360.20 [M + H] = 360.1 [01103]embedded image C.sub.18H.sub.23NO.sub.6 [M + H] = 350.16 [M + H] = 350.2 [01104]embedded image C.sub.20H.sub.27NO.sub.7 [M + H] = 394.19 [M + H] = 394.3

General Procedure 11: Coupling of an Alkyne Containing Acid and Amine Containing Ester

[1230] ##STR01105##

Step 1

[1231] To a 0.14M solution of carboxylic acid (1.0 equiv) in DCM was added HATU (1.5 equiv) and DIPEA (3.0 equiv). The mixture was stirred for 1 h, then amino-PEG-ester (1.0 equiv) was added. The reaction was allowed to stir until consumption of carboxylic acid, as indicated by LCMS. The mixture was poured into H.sub.2O and the aqueous phase was extracted with DCM. The combined organic phases were washed with brine, dried with anhydrous Na.sub.2SO.sub.4, filtered and the filtrate was concentrated under reduced pressure. The residue was purified by silica gel chromatography to afford the product.

Step 2

[1232] A 1.58M solution of ester (1 equiv) in TFA was allowed to stir until consumption of the ester, as indicated by LCMS. The reaction mixture was concentrated under reduced pressure and the resulting residue was purified by silica gel chromatography to afford the product.

Intermediate E2-4: Synthesis of 5,21-dioxo-4,9,12,15,18,25,28,31,34-nonaoxa-6,22-diazaheptatriacont-1-yn-37-oic Acid

[1233] ##STR01106##

Step 1

[1234] To a solution of E1-2 (5 g, 14.39 mmol, 1.0 equiv) in DCM (100 mL) was added HATU (8.21 g, 21.59 mmol, 1.5 equiv) and DIPEA (7.52 mL, 43.18 mmol, 3.0 equiv). The mixture was stirred at room temperature for 1 h, then tert-butyl 1-amino-3,6,9,12-tetraoxapentadecan-15-oate (4.63 g, 14.39 mmol, 1.0 equiv) was added to the mixture. The reaction mixture was stirred for 2 h and was then poured into H.sub.2O (100 mL) and stirred for 5 min. The aqueous phase was extracted with DCM (2×50 mL) and the combined organic phases were washed with 0.5 N HCl (3×50 mL), saturated aqueous NaHCO.sub.3(2×50 mL), brine (50 mL), dried with anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (1/0 to 12/1 EtOAc/MeOH) to afford tert-butyl 5,21-dioxo-4,9,12,15,18,25,28,31,34-nonaoxa-6,22-diazaheptatriacont-1-yn-37-oate (8.5 g, 90.7% yield) as a light yellow oil.

Step 2

[1235] A solution of tert-butyl 5,21-dioxo-4,9,12,15,18,25,28,31,34-nonaoxa-6,22-diazaheptatriacont-1-yn-37-oate (8.5 g, 13.06 mmol, 1.0 equiv) in TFA (8.24 mL, 111.27 mmol, 8.52 equiv) was stirred at room temperature for 5 min. The mixture was concentrated under reduced pressure at 45° C. The residue was purified by silica gel chromatography (0/1 to 1/10 MeOH/EtOAc) to afford the product (4.76 g, 60.4% yield) as light yellow oil. LCMS (ESI) m/z: [M+H] calcd for C.sub.26H.sub.46N.sub.2O.sub.13: 595.31; found 595.4.

[1236] Following the General Procedure 11, but using the appropriate alkyne-containing carboxylic acid from Table 23 and amine functionalized ester, the additional Intermediates E2 in Table 24 were prepared:

TABLE-US-00027 TABLE 24 Additional alkynes prepared Molecular Calculated Observed Structure Formula MW MW [01107]embedded image C.sub.20H.sub.34N.sub.2O.sub.10 [M − H] = 461.21 [M − H] = 461.2 [01108]embedded image C.sub.22H.sub.38N.sub.2O.sub.11 [M + H] = 505.24 [M + H] = 505.2 [01109]embedded image C.sub.24H.sub.42N.sub.2O.sub.12 [M + H] = 551.28 [M + H] = 551.4 [01110]embedded image C.sub.26H.sub.46N.sub.2O.sub.13 [M + H] = 595.31 [M + H] = 595.4 [01111]embedded image C.sub.22H.sub.38N.sub.2O.sub.9 [M − H] = 473.25 [M − H] = 473.2 [01112]embedded image C.sub.24H.sub.42N.sub.2O.sub.10 [M + H] = 519.29 [M + H] = 519.2 [01113]embedded image C.sub.26H.sub.46N.sub.2O.sub.11 [M + H] = 563.32 [M + H] = 563.3 [01114]embedded image C.sub.28H.sub.50N.sub.2O.sub.12 [M + H] = 607.34 [M + H] = 607.2 [01115]embedded image C.sub.25H.sub.36N.sub.2O.sub.9 [M + H] = 509.25 [M + H] = 509.2 [01116]embedded image C.sub.27H.sub.40N.sub.2O.sub.10 [M + H] = 553.28 [M + H] = 553.2 [01117]embedded image C.sub.29H.sub.44N.sub.2O.sub.11 [M + H] = 597.30 [01118]embedded image C.sub.31H.sub.48N.sub.2O.sub.12 [M + H] = 641.33 [M + H] = 641.4

General Procedure 12: Coupling of an Acid and Amine Containing Active Site Inhibitor

[1237] ##STR01119##

[1238] To a 0.1M solution of carboxylic acid (1.0 equiv) in dioxane was added amine-containing active site inhibitor (1.8 equiv) and DIPEA (3.0 equiv), followed by PyBOP (1.3 equiv). The reaction was allowed to stir until consumption of carboxylic acid, as indicated by LCMS. The reaction mixture was then purified by silica gel chromatography to afford the product.

Intermediate E3-7: Synthesis of prop-2-yn-1-yl N-(14-{[14-({4-[4-amino-3-(2-amino-1,3-benzoxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl]butyl}carbamoyl)-3,6,9,12-tetraoxatetradecan-1-yl]carbamoyl}-3,6,9,12-tetraoxatetradecan-1-yl)carbamate

[1239] ##STR01120##

[1240] To a solution of E2-4 (0.1 g, 0.1681 mmol, 1.0 equiv) in dioxane (1.68 mL) was added 5-[4-amino-1-(4-aminobutyl)pyrazolo[3,4-d]pyrimidin-3-yl]-1,3-benzoxazol-2-amine (131 mg, 0.3025 mmol, 1.8 equiv) followed by DIPEA (87.7 μL, 0.5043 mmol, 3.0 equiv). Finally, PyBOP (113 mg, 1.3 equiv) was added. The reaction was stirred for 4 h and then purified by silica gel chromatography (0%.fwdarw.20% DCM/MeOH). LCMS (ESI) m/z: [M+H] calcd for C.sub.42H.sub.62N.sub.10O.sub.13: 915.46; found 915.3.

[1241] Following the General Procedure 12, but using the appropriate alkyne-containing carboxylic acid from Table 24 and amine-containing active site inhibitor, the additional Intermediates E3 in Table 25 were prepared:

TABLE-US-00028 TABLE 25 Additional active site inhibitor containing Intermediates E3 prepared. Calcu- Ob- Molecular lated served Structure Formula MW MW [01121]embedded image C.sub.36H.sub.50N.sub.10O.sub.10 [M + H] = 783.38 [M + H] = 783.5 Intermediate E3-1 [01122]embedded image C.sub.37H.sub.51N.sub.9O.sub.10 [M + H] = 782.38 [M + H] = 782.3 Intermediate E3-2 [01123]embedded image C.sub.38H.sub.54N.sub.10O.sub.11 [M + H] = 827.41 [M + H] = 827.4 Intermediate E3-3 [01124]embedded image C.sub.39H.sub.55N.sub.9O.sub.10 [M + H] = 826.41 [M + H] = 826.4 Intermediate E3-4 [01125]embedded image C.sub.40H.sub.58N.sub.10O.sub.12 [M + H] = 871.43 [M + H] = 871.3 Intermediate E3-5 [01126]embedded image C.sub.41H.sub.59N.sub.9O.sub.12 [M + H] = 870.44 [M + H] = 870.3 Intermediate E3-6 [01127]embedded image C.sub.42H.sub.62N.sub.10O.sub.13 [M + H] = 915.46 [M + H] = 915.3 Intermediate E3-7 [01128]embedded image C.sub.43H.sub.63N.sub.9O.sub.13 [M + H] = 914.46 [M + H] = 914.4 Intermediate E3-8 [01129]embedded image C.sub.38H.sub.54N.sub.10O.sub.9 [M + H] = 795.42 [M + H] = 795.5 Intermediate E3-9 [01130]embedded image C.sub.39H.sub.55N.sub.9O.sub.9 [M + H] = 794.42 [M + H] = 794.6 Intermediate E3-10 [01131]embedded image C.sub.40H.sub.58N.sub.10O.sub.10 [M + H] = 839.44 [M + H] = 839.3 Intermediate E3-11 [01132]embedded image C.sub.41H.sub.59N.sub.9O.sub.10 [M + H] = 838.45 [M + H] = 838.4 Intermediate E3-12 [01133]embedded image C.sub.43H.sub.63N.sub.9O.sub.11 [M + H] = 882.47 [M + H] = 882.4 Intermediate E3-13 [01134]embedded image C.sub.42H.sub.62N.sub.10O.sub.11 [M + H] = 883.47 [M + H] = 883.4 Intermediate E3-14 [01135]embedded image C.sub.44H.sub.66N.sub.10O.sub.12 [M + H] = 927.49 [M + H] = 927.5 Intermediate E3-15 [01136]embedded image C.sub.45H.sub.67N.sub.9O.sub.12 [M + H] = 926.50 [M + H] = 926.4 Intermediate E3-16 [01137]embedded image C.sub.41H.sub.52N.sub.10O.sub.9 [M + H] = 829.40 [M + H] = 829.3 Intermediate E3-17 [01138]embedded image C.sub.43H.sub.56N.sub.10O.sub.10 [M + H] = 873.43 [M + H] = 873.4 Intermediate E3-19 [01139]embedded image C.sub.44H.sub.57N.sub.9O.sub.10 [M + H] = 872.43 [M + H] = 872.3 Intermediate E3-20 [01140]embedded image C.sub.45H.sub.60N.sub.10O.sub.11 [M + H] = 917.45 [M + H] = 917.4 Intermediate E3-21 [01141]embedded image C.sub.46H.sub.61N.sub.9O.sub.11 [M + H] = 916.46 [M + H] = 916.4 Intermediate E3-22 [01142]embedded image C.sub.47H.sub.64N.sub.10O.sub.12 [M + H] = 961.48 [M + H] = 961.5 Intermediate E3-23 [01143]embedded image Ca.sub.48H.sub.65N.sub.9O.sub.12 [M + H] = 960.48 [M + H] = 960.4 Intermediate E3-24

Intermediate E3-25: Synthesis of N-{2-[2-(2-{2-[(2-{2-[2-({4-[4-amino-3-(2-amino-1,3-benzoxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl]butyl}(methyl)carbamoyl)ethoxy]ethoxy}ethyl)(methyl)carbamoyl]ethoxy}ethoxy)eth oxy]ethyl}-N-methylhex-5-ynamide

[1242] ##STR01144##

[1243] To a suspension of tetrabutylammonium bromide (16.1 mg, 50.0 μmol, 0.4 equiv) and potassium hydroxide (31.5 mg, 562 μmol, 4.5 equiv) in THF (1.25 mL) was added E3-9 (100 mg, 125 μmol, 1.0 equiv) followed by methyl iodide (34.9 μL, 562 μmol, 4.5 equiv). After stirring for 21 h, H.sub.2O (0.2 mL) was added. The reaction mixture was purified by silica gel chromatography (0.fwdarw.20% MeOH/DCM) to afford the product (17.1 mg, 16% yield). LCMS (ESI) m/z: [M+H] calcd for C.sub.41H.sub.60N.sub.10O.sub.9: 837.46; found 837.4.

TABLE-US-00029 TABLE 26 Additional active site inhibitor containing Intermediates E3 prepared. Molecular Calculated Observed Structure Formula MW MW [01145]embedded image C.sub.41H.sub.60N.sub.10O.sub.9 [M + H] = 837.46 [M + H] = 837.4 Intermediate E3-25

Example 125: Synthesis of Series 5 Bivalent Rapamycin Analog

[1244] ##STR01146##

[1245] To a solution of 40(S)-azido rapamycin (25.0 mg, 26.6 μmol, 1.0 equiv) and E3-7 (48.6 mg, 53.2 μmol, 2.0 equiv) in DMSO (532 μL) was added tetrakis(acetonitrile)copper(I) hexafluorophosphate (19.8 mg, 53.2 μmol, 2.0 equiv) followed by TBTA (56.4 mg, 106.4 μmol, 4.0 equiv). The reaction stirred for 6 h and was then purified by reverse phase HPLC (10.fwdarw.40.fwdarw.95% MeCN+0.1% formic acid/H.sub.2O+0.1% formic acid). Lyophilization of pure fractions provided the product (11.6 mg, 23.5% yield) as a white solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.93H.sub.140N.sub.14O.sub.25: 1854.02; found 1853.7.

[1246] Following General Procedure 3, but using the appropriate azide modified rapamycin and Intermediates E3 from Table 25 and Table 26, the Series 5 bivalent analogs in Table 27 were synthesized:

TABLE-US-00030 TABLE 27 Series 5 Bivalent Analogs Calcu- Ob- Molecular lated served Structure Formula MW MW [01147]embedded image C.sub.87H.sub.128N.sub.14O.sub.22 [M + Na] = 1743.92 [M + Na] = 1743.9 Example 120 [01148]embedded image C.sub.88H.sub.129N.sub.13O.sub.22 [M + H] = 1720.95 [M + H] = 1720.9 Example 121 [01149]embedded image C.sub.89H.sub.132N.sub.14O.sub.23 [M + H] = 1765.97 [M + H] = 1766.1 Example 122 [01150]embedded image C.sub.90H.sub.133N.sub.13O.sub.23 [M + H] = 1764.97 [M + H] = 1764.8 Example 123 [01151]embedded image C.sub.91H.sub.136N.sub.14O.sub.24 [M + H] = 1809.99 [M + H] = 1809.8 Example 124 [01152]embedded image C.sub.93H.sub.140N.sub.14O.sub.25 [M + H] = 1854.02 [M + H] = 1853.7 Example 125 [01153]embedded image C.sub.92H.sub.137N.sub.13O.sub.24 [M + H] = 1809.00 [M + H] = 1808.9 Example 126 [01154]embedded image C.sub.94H.sub.141N.sub.13O.sub.25 [M + H] = 1853.02 [M + H] = 1852.8 Example 127 [01155]embedded image C.sub.89H.sub.132N.sub.14O.sub.21 [M + H] = 1733.98 [M + H] = 1734.0 Example 128 [01156]embedded image C.sub.90H.sub.133N.sub.13O.sub.21 [M + H] = 1732.98 [M + H] = 1732.9 Example 129 [01157]embedded image C.sub.91H.sub.136N.sub.14O.sub.22 [M + H] = 1778.00 [M + H] = 1778.0 Example 130 [01158]embedded image C.sub.92H.sub.137N.sub.13O.sub.22 [M + H] = 1777.01 [M + H] = 1777.0 Example 131 [01159]embedded image C.sub.93H.sub.140N.sub.14O.sub.23 [M + H] = 1822.03 [M + H] = 1822.1 Example 132 [01160]embedded image C.sub.94H.sub.141N.sub.13O.sub.23 [M + H] = 1821.03 [M + H] = 1821.0 Example 133 [01161]embedded image C.sub.95H.sub.144N.sub.14O.sub.24 [M + H] = 1866.06 [M + H] = 1865.9 Example 134 [01162]embedded image C.sub.96H.sub.145N.sub.13O.sub.24 [M + H] = 1865.06 [M + H] = 1865.0 Example 135 [01163]embedded image C.sub.92H.sub.130N.sub.14O.sub.21 [M + H] = 1767.96 [M + H] = 1767.9 Example 136 [01164]embedded image C.sub.94H.sub.134N.sub.14O.sub.22 [M + H] = 1811.99 [M + H] = 1812.1 Example 137 [01165]embedded image C.sub.95H.sub.135N.sub.13O.sub.22 [M + H] = 1810.99 [M + H] = 1811.1 Example 138 [01166]embedded image C.sub.96H.sub.138N.sub.14O.sub.23 [M + H] = 1856.01 [M + H] = 1856.0 Example 139 [01167]embedded image C.sub.97H.sub.139N.sub.13O.sub.23 [M + H] = 1855.02 [M + H] = 1854.9 Example 140 [01168]embedded image C.sub.98H.sub.142N.sub.14O.sub.24 [M + H] = 1900.04 [M + H] = 1899.9 Example 141 [01169]embedded image C.sub.99H.sub.143N.sub.13O.sub.24 [M + H] = 1899.04 [M + H] = 1899.0 Example 142 [01170]embedded image C.sub.88H.sub.132N.sub.14O.sub.22 [M + H] = 1737.97 [M + H] = 1737.8 Example 143 [01171]embedded image C.sub.89H.sub.133N.sub.13O.sub.22 [M + H] = 1736.98 [M + H] = 1736.7 Example 144 [01172]embedded image C.sub.90H.sub.136N.sub.14O.sub.23 [M + H] = 1782.00 [M + H] = 1782.0 Example 145 [01173]embedded image C.sub.91H.sub.137N.sub.13O.sub.23 [M + H] = 1781.00 [M + H] = 1780.9 Example 146 [01174]embedded image C.sub.89H.sub.134N.sub.14O.sub.22 [M + H] = 1751.99 [M + H] = 1751.9 Example 147 [01175]embedded image C.sub.90H.sub.135N.sub.13O.sub.22 [M + H] = 1750.99 [M + H] = 1750.9 Example 148 [01176]embedded image C.sub.91H.sub.138N.sub.14O.sub.23 [M + H] = 1796.01 [M + H] = 1795.9 Example 149 [01177]embedded image C.sub.92H.sub.139N.sub.13O.sub.23 [M + H] = 1795.02 [M + H] = 1794.8 Example 150 [01178]embedded image C.sub.88H.sub.131N.sub.15O.sub.22 [M + H] = 1750.97 [M + H] = 1750.9 Example 151 [01179]embedded image C.sub.89H.sub.132N.sub.14O.sub.22 [M + H] = 1749.97 [M + H] = 1749.9 Example 152 [01180]embedded image C.sub.90H.sub.135N.sub.15O.sub.23 [M + H] = 1794.99 [M + H] = 1794.8 Example 153 [01181]embedded image C.sub.94H.sub.135N.sub.15O.sub.22 [M + H] = 1827.00 [M + H] = 1826.9 Example 154 [01182]embedded image C.sub.95H.sub.136N.sub.14O.sub.22 [M + H] = 1826.00 [M + H] = 1825.9 Example 155 [01183]embedded image C.sub.96H.sub.139N.sub.15O.sub.23 [M + H] = 1871.02 [M + H] = 1870.9 Example 156 [01184]embedded image C.sub.97H.sub.140N.sub.14O.sub.23 [M + H] = 1870.03 [M + H] = 1869.9 Example 157 [01185]embedded image C.sub.91H.sub.137N.sub.15O.sub.22 [M + H] = 1793.01 [M + H] = 1792.9 Example 158 [01186]embedded image C.sub.92H.sub.138N.sub.14O.sub.22 [M + H] = 1792.02 [M + H] = 1791.9 Example 159 [01187]embedded image C.sub.93H.sub.141N.sub.15O.sub.23 [M + H] = 1837.04 [M + H] = 1836.9 Example 160 [01188]embedded image C.sub.94H.sub.142N.sub.14O.sub.23 [M + H] = 1836.05 [M + H] = 1836.0 Example 161 [01189]embedded image C.sub.90H.sub.136N.sub.14O.sub.21 [M + H] = 1750.01 [M + H] = 1749.8 Example 162 [01190]embedded image C.sub.91H.sub.137N.sub.13O.sub.21 [M + H] = 1749.01 [M + H] = 1748.8 Example 163 [01191]embedded image C.sub.92H.sub.140N.sub.14O.sub.22 [M + H] = 1794.03 [M + H] = 1793.9 Example 164 [01192]embedded image C.sub.91H.sub.138N.sub.14O.sub.21 [M + H] = 1764.02 [M + H] = 1763.9 Example 165 [01193]embedded image C.sub.92H.sub.139N.sub.13O.sub.21 [M + H] = 1763.03 [M + H] = 1762.9 Example 166 [01194]embedded image C.sub.93H.sub.142N.sub.14O.sub.22 [M + H] = 1808.05 [M + H] = 1808.0 Example 167 [01195]embedded image C.sub.94H.sub.143N.sub.13O.sub.22 [M + H] = 1807.05 [M + H] = 1807.0 Example 168 [01196]embedded image C.sub.90H.sub.135N.sub.15O.sub.21 [M + H] = 1763.00 [M + H] = 1762.9 Example 169 [01197]embedded image C.sub.91H.sub.136N.sub.14O.sub.21 [M + H] = 1762.01 [M + H] = 1761.9 Example 170 [01198]embedded image C.sub.92H.sub.139N.sub.15O.sub.22 [M + H] = 1807.03 [M + H] = 1807.0 Example 171 [01199]embedded image C.sub.93H.sub.140N.sub.14O.sub.22 [M + H] = 1806.03 [M + H] = 1805.9 Example 172 [01200]embedded image C.sub.96H.sub.139N.sub.15O.sub.21 [M + H] = 1839.03 [M + H] = 1838.9 Example 173 [01201]embedded image C.sub.98H.sub.143N.sub.15O.sub.22 [M + H] = 1883.06 [M + H] = 1883.0 Example 174 [01202]embedded image C.sub.99H.sub.144N.sub.14O.sub.22 [M + H] = 1882.07 [M + H] = 1881.9 Example 175 [01203]embedded image C.sub.93H.sub.141N.sub.15O.sub.21 [M + H] = 1805.05 [M + H] 1804.9 Example 176 [01204]embedded image C.sub.95H.sub.145N.sub.15O.sub.22 [M + H] = 1849.08 [M + H] = 1848.9 Example 177 [01205]embedded image C.sub.96H.sub.146N.sub.14O.sub.22 [M + H] = 1848.08 [M + H] = 1847.9 Example 178 [01206]embedded image C.sub.93H.sub.141N.sub.13O.sub.22 [M + H] = 1793.04 [M + H] = 1792.9 Example 179 [01207]embedded image C.sub.92H.sub.138N.sub.14O.sub.21 [M + H] = 1776.02 [M + H] = 1775.8 Example 180

[1247] Following the General Procedure 10, but using the appropriate amine-reactive pre-linker and amine functionalized ester, the additional Intermediates F1 in Table 28 were prepared:

TABLE-US-00031 TABLE 28 Additional carboxylic acid linker Intermediates F1 prepared. Molecular Calculated Observed Structure Formula MW MW [01208]embedded image C.sub.11H.sub.17NO.sub.6 [M + H] = 260.11 Intermediate Fl-1 [01209]embedded image C.sub.13H.sub.21NO.sub.7 [M + Na] = 326.12 [M + Na] = 326.1 Intermediate F1-2 [01210]embedded image C.sub.15H.sub.25NO.sub.8 [M + H] = 348.17 Intermediate F1-3

General Procedure 13: Coupling of an Alkyne Containing Acid and Amine Containing Post-Linker

[1248] ##STR01211##

Step 1

[1249] To a 0.2M solution of carboxylic acid (1.3 equiv) in DMF was added HATU (1.9 equiv) and DIPEA (5.0 equiv). The mixture was stirred for 1 h, then amino-containing post-linker (1.0 equiv) was added. The reaction was allowed to stir until consumption of amine-linker, as indicated by LCMS. The mixture was poured into H.sub.2O and the precipitate was collected by filtration under N.sub.2 to give crude product. The residue was purified by silica gel chromatography to afford the product.

Step 2

[1250] To a 0.02M solution of ester (1.0 equiv) in THF/EtOH/H2O (2:1:1) was added LiOH.H.sub.2O (2.0 equiv) at room temperature. The reaction mixture was stirred until consumption of the ester, as indicated by LCMS. The mixture was concentrated under reduced pressure to remove THF and EtOH. The aqueous phase was neutralized with aqueous HCl (0.5 N) and then the precipitate was collected by filtration under N.sub.2 to give product.

Intermediate F2-3: Synthesis of 4-(4-(5-(3,19-dioxo-6,9,12,15,20-pentaoxa-2,18-diazatricos-22-yn-1-yl)pyrimidin-2-yl)piperazin-1-yl)benzoic Acid

[1251] ##STR01212##

Step 1

[1252] To a solution of F1-3 (4.40 g, 12.66 mmol, 1.3 equiv) in DMF (60 mL) was added HATU (7.04 g, 18.51 mmol, 1.9 equiv) and DIPEA (8.48 mL, 48.70 mmol, 5 equiv), the mixture was stirred at room temperature for 1 h, then ethyl 2-(4-(5-(aminomethyl)pyrimidin-2-yl)piperazin-1-yl) pyrimidine-5-carboxylate (3.7 g, 9.74 mmol, 1.0 equiv, HCl) was added. The reaction was stirred for 3 h and was then poured into H.sub.2O (300 mL) and stirred for 10 min. The precipitate was collected by filtration under N.sub.2 to give the crude product as brown solid. The residue was purified by silica gel chromatography (1/1 to 0/1 petroleum ether/EtOAc, then 1/0 to 15/1 DCM/MeOH) to afford ethyl 2-(4-(5-(3,19-dioxo-6,9,12,15,20-pentaoxa-2,18-diazatricos-22-yn-1-yl)pyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylate (4.7 g, 70.2% yield) as white solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.31H.sub.44N.sub.8O.sub.9: 673.32; found 673.3.

Step 2

[1253] To a solution of ethyl 2-(4-(5-(3,19-dioxo-6,9,12,15,20-pentaoxa-2,18-diazatricos-22-yn-1-yl)pyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylate (5.38 g, 8.00 mmol, 1.0 equiv) in THF (270 mL) EtOH (135 mL) and H.sub.2O (135 mL) was added LiOH.H.sub.2O (671.13 mg, 15.99 mmol, 2.0 equiv) at 25° C. The reaction mixture was stirred at 25° C. for 20 h. The mixture was concentrated under reduced pressure to remove THF and EtOH. The aqueous phase was neutralized with aqueous HCl (0.5 N) and then the precipitate was collected by filtration under N.sub.2 to give 4-(4-(5-(3,19-dioxo-6,9,12,15,20-pentaoxa-2,18-diazatricos-22-yn-1-yl)pyrimidin-2-yl)piperazin-1-yl)benzoic acid (4.34 g, 79.9% yield) as white solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.29H.sub.40N.sub.8O.sub.9: 645.30; found 645.1.

[1254] Following the General Procedure 13, but using the appropriate alkyne-containing carboxylic acid from Table 28 and amine functionalized ester, the additional Intermediates F2 in Table 29 were prepared:

TABLE-US-00032 TABLE 29 Additional alkynes prepared Molecular Calculated Observed Structure Formula MW MW [01213]embedded image C.sub.25H.sub.32N.sub.8O.sub.7 [M + H] = 557.25 [M + H] = 557.1 Intermediate F2-1 [01214]embedded image C.sub.27H.sub.36N.sub.8O.sub.8 [M + H] = 601.27 [M + H] = 601.4 Intermediate F2-2 [01215]embedded image C.sub.29H.sub.40N.sub.8O.sub.9 [M + H] = 645.30 [M + H] = 645.1 Intermediate F2-3

Intermediate F3-5: Synthesis of prop-2-yn-1-yl N-(14-{[(2-{4-[5-({4-[4-amino-3-(2-amino-1,3-benzoxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl]butyl}carbamoyl)pyrimidin-2-yl]piperazin-1-yl}pyrimidin-5-yl)methyl]carbamoyl}-3,6,9,12-tetraoxatetradecan-1-yl)carbamate

[1255] ##STR01216##

[1256] To a solution of F2-3 (0.1 g, 0.1551 mmol, 1.0 equiv) in dioxane (1.55 mL) was added 5-[4-amino-1-(4-aminobutyl)pyrazolo[3,4-d]pyrimidin-3-yl]-1,3-benzoxazol-2-amine (121 mg, 0.2791 mmol, 1.8 equiv) followed by DIPEA (80.9 μL, 0.4653 mmol, 3.0 equiv). Finally, PyBOP (104 mg, 0.2016 mmol, 1.3 equiv) was added. The reaction stirred for 4 h and then purified by silica gel chromatography (0%.fwdarw.20% DCM/MeOH). LCMS (ESI) m/z: [M+H] calcd for C.sub.45H.sub.56N.sub.16O.sub.9: 965.45; found 965.4.

[1257] Following the General Procedure 12, but using the appropriate alkyne-containing carboxylic acid from Table 29 and amine-containing active site inhibitor, the additional Intermediates F3 in Table 30 were prepared:

TABLE-US-00033 TABLE 30 Additional alkynes prepared Molecular Calculated Observed Structure Formula MW MW [01217]embedded image C.sub.41H.sub.48N.sub.16O.sub.7 [M + H] = 877.40 [M + H] = 877.4 Intermediate F3-1 [01218]embedded image C.sub.42H.sub.49N.sub.15O.sub.7 [M + H] = 876.40 [M + H] = 876.3 Intermediate F3-2 [01219]embedded image C.sub.43H.sub.52N.sub.16O.sub.8 [M + H] = 921.42 [M + H] = 921.4 Intermediate F3-3 [01220]embedded image C.sub.44H.sub.53N.sub.15O.sub.8 [M + H] = 920.43 [M + H] = 920.4 Intermediate F3-4 [01221]embedded image C.sub.45H.sub.56N.sub.16O.sub.9 [M + H] = 965.45 [M + H] = 965.4 Intermediate F3-5 [01222]embedded image C.sub.46H.sub.57N.sub.15O.sub.9 [M + H] = 964.45 [M + H] = 964.4 Intermediate F3-6

Example 185: Synthesis of Series 6 Bivalent Rapamycin Analog

[1258] ##STR01223## ##STR01224##

[1259] To a solution of 40(S)-azido rapamycin (25.0 mg, 26.6 μmol, 1.0 equiv) and F3-5 (51.3 mg, 53.2 μmol, 2.0 equiv) in DMSO (532 μL) was added tetrakis(acetonitrile)copper(I) hexafluorophosphate (19.8 mg, 53.2 μmol, 2.0 equiv) followed by TBTA (56.4 mg, 106.4 μmol, 4.0 equiv). The reaction stirred for 6 h and was then purified by reverse phase HPLC (10.fwdarw.40.fwdarw.95% MeCN+0.1% formic acid/H.sub.2O+0.1% formic acid). Lyophilization of pure fractions provided product (11.6 mg, 22.7% yield) as a white solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.96H.sub.134N.sub.20O.sub.21: 1904.01; found 1903.9.

[1260] Following General Procedure 3, but using the appropriate azide modified rapamycin and Intermediates F3, the Series 6 bivalent analogs in Table 31 were synthesized:

TABLE-US-00034 TABLE 31 Series 6 Bivalent Analogs Molecular Calculated Observed Structure Formula MW MW [01225]embedded image C.sub.92H.sub.126N.sub.20O.sub.19 [M + H] = 1815.96 [M + H] = 1816.0 Example 181 [01226]embedded image C.sub.93H.sub.127N.sub.19O.sub.19 [M + H] = 1814.96 [M + H] = 1814.9 Example 182 [01227]embedded image C.sub.94H.sub.13N.sub.20O.sub.20 [M + H] = 1859.98 [M + H] = 1860.0 Example 183 [01228]embedded image C.sub.95H.sub.131N.sub.19O.sub.20 [M + H] = 1858.99 [M + H] = 1859.1 Example 184 [01229]embedded image C.sub.96H.sub.134N.sub.20O.sub.21 [M + H] = 1904.01 [M + H] = 1903.9 Example 185 [01230]embedded image C.sub.97H.sub.135N.sub.19O.sub.21 [M + H] = 1903.02 [M + H] = 1902.9 Example 186

General Procedure 14: Coupling of an Amine and a Carboxylic Acid Containing Active Site Inhibitor

[1261] ##STR01231##

Step 1

[1262] To a 0.18M solution of carboxylic acid (1.0 equiv) and amino-PEG (1.1 equiv) in pyridine was added EDC (1.1 equiv). The reaction was allowed to stir until consumption of carboxylic acid, as indicated by LCMS. The pyridine was removed under reduced pressure and the resulting residue was dissolved in DCM and washed with H.sub.2O. The aqueous phase was extracted with DCM and the combined organic phases were dried with anhydrous MgSO.sub.4, filtered and the filtrate was concentrated under reduced pressure. The residue was purified by silica gel chromatography to afford the product.

Step 2

[1263] A 0.03M solution of Boc protected amine (1 equiv) in DCM was added TFA (80 equiv). The reaction was allowed to stir until consumption of the starting material, as indicated by LCMS. The reaction mixture was concentrated under reduced pressure and the resulting residue to afford the product.

Intermediate G1-2: Synthesis of (1r,4r)-4-[4-amino-5-(7-methoxy-1H-indol-2-yl)imidazo[4,3-f][1,2,4]triazin-7-yl]-N-(2-{2-[2-(2-aminoethoxy)ethoxy]ethoxy}ethyl)cyclohexane-1-carboxamide

[1264] ##STR01232##

Step 1

[1265] To a solution of trans-4-[4-amino-5-(7-methoxy-1H-indol-2-yl)imidazo[5,1-f][1,2,4]triazin-7-yl]cyclohexanecarboxylic acid (75.0 mg, 0.184 mmol, 1.0 equiv) and N-Boc-2,2′-[oxybis(ethylenoxy)]diethylamine (59.1 mg, 0.202 mmol, 1.1 equiv) in pyridine (1 mL) was added EDC (39.8 mg, 0.208 mmol, 1.1 equiv). After stirring overnight, the pyridine was removed under reduced pressure. The resulting residue was dissolved in DCM (30 mL) and washed with H.sub.2O (30 mL). The aqueous layer was back extracted with DCM (30 mL) and the combined organic phases were dried with MgSO.sub.4, filtered, and concentrated under reduced pressure. The crude material was purified by prep-TLC (60% acetone/hexanes) to provide the product (92.9 mg, 73% yield) as a light brown residue. LCMS (ESI) m/z: [M+H] calcd for C.sub.34H.sub.48N.sub.8O.sub.7: 681.37; found 681.4.

Step 2

[1266] To a solution of tert-butyl N-(2-{2-[2-(2-{[(1r,4r)-4-[4-amino-5-(7-methoxy-1H-indol-2-yl)imidazo[4,3-f][1,2,4]triazin-7-yl]cyclohexyl]formamido}ethoxy)ethoxy]ethoxy}ethyl)carbamate (92.9 mg, 0.136 mmol, 1 equiv) in DCM (4 mL) at 0° C. was added TFA (0.8 mL, 10 mmol, 80 equiv). The mixture was stirred at 0° C. for 45 min, then warmed to room temperature. After 30 min at room temperature the solvent was removed under reduced pressure. The residue was diluted with DCM (5 mL) and concentrated to provide the product (125.0 mg, 100% yield) as a yellow residue. LCMS (ESI) m/z: [M+H] calcd for C.sub.29H.sub.40N.sub.8O.sub.5: 581.32; found 581.4.

[1267] Following the General Procedure 14, but using the appropriate alkyne-containing carboxylic acid and amine functionalized PEG, the additional Intermediates G1 in Table 32 were prepared:

TABLE-US-00035 TABLE 32 Additional amines prepared Molecular Calculated Observed Structure Formula MW MW [01233]embedded image C.sub.27H.sub.36N.sub.8O.sub.4 [M + H] = 537.29 [M + H] = 537.5 Intermediate G1-1 [01234]embedded image C.sub.29H.sub.40N.sub.8O.sub.5 [M + H] = 581.32 [M + H] = 581.4 Intermediate G1-2

Intermediate G2-2: Synthesis of 1-azido-N-(2-{2-[2-(2-{[(1r,4r)-4-[4-amino-5-(7-methoxy-1H-indol-2-yl)imidazo[4,3-f][1,2,4]triazin-7-yl]cyclohexyl]formamido}ethoxy)ethoxy]ethoxy}ethyl)-3,6,9,12-tetraoxapentadecan-15-amide

[1268] ##STR01235##

[1269] To a solution of azido-PEG4-NHS ester (66.1 mg, 0.170 mmol, 1.25 equiv) and (1r,4r)-4-[4-amino-5-(7-methoxy-1H-indol-2-yl)imidazo[4,3-f][1,2,4]triazin-7-yl]-N-(2-{2-[2-(2-aminoethoxy)ethoxy]ethoxy}ethyl)cyclohexane-1-carboxamide (94.5 mg, 0.136 mmol, 1.0 equiv) in DMF (2.8 mL) was added TEA (94 μL, 0.68 mmol, 5.0 equiv), dropwise at room temperature. The reaction was stirred for 50 min and then the solvent was removed under reduced pressure to afford a yellow oil. The crude material was purified by prep-TLC (10% MeOH/DCM) to provide the product (91.2 mg, 78% yield) as a yellow oil. LCMS (ESI) m/z: [M+H] calcd for C.sub.40H.sub.59N.sub.11O.sub.10: 854.45; found 854.5.

[1270] Following the General Procedure 1, but using the appropriate amine from Table 32 and azide functionalized N-hydroxysuccinimide ester, the additional Intermediates G2 in Table 33 were prepared:

TABLE-US-00036 TABLE 33 Additional active site inhibitor containing Intermediates G2 prepared. Molecular Calculated Observed Structure Formula MW MW [01236]embedded image C.sub.38H.sub.55N.sub.11O.sub.9 [M + Na] = 832.41 [M + Na] = 832.3 Intermediate G2-1 [01237]embedded image C.sub.40H.sub.59N.sub.11O.sub.10 [M + H] = 854.45 [M + H] = 854.5 Intermediate G2-2

[1271] Following General Procedure 3, but using the appropriate alkyne modified rapamycin and Intermediates G2, the Series 7 bivalent analogs in Table 34 were synthesized:

TABLE-US-00037 TABLE 34 Series 7 Bivalent Analogs Calcu- Ob- Molecular lated served Structure Formula MW MW [01238]embedded image C.sub.95H.sub.142N.sub.12O.sub.22 [M + H] = 1804.04 [M + H] = 1803.9 Example 187 [01239]embedded image C.sub.96H.sub.146N.sub.12O.sub.22 [M + H] = 1820.08 [M + H] = 1820.2 Example 188 [01240]embedded image C.sub.97H.sub.146N.sub.12O.sub.23 [M + H] = 1848.07 [M + H] = 1848.3 Example 189 [01241]embedded image C.sub.98H.sub.150N.sub.12O.sub.23 [M + H] = 1864.10 [M + H] = 1864.3 Example 190

General Procedure 15: Coupling of an Amine-Reactive Azide Containing Pre-Linker and Amine Containing Ester

[1272] ##STR01242##

Step 1

[1273] To a 0.12M solution of carboxylic acid (1.0 equiv) in DMF was added DIPEA (3.0 equiv) and HATU (1.5 equiv) followed by amino-PEG-ester (1.5 equiv). The reaction was allowed to stir until consumption of carboxylic acid, as indicated by LCMS. The mixture was poured into H.sub.2O and the precipitate was isolated by filteration. The crude material was purified by silica gel chromatography to afford the product.

Step 2

[1274] To a 0.03M solution of ester (1.0 equiv) in THF/H.sub.2O/MeOH (4:1:1) was added LiOH.H.sub.2O (1.50 equiv) at room temperature. The reaction was allowed to stir until consumption of the ester, as indicated by LCMS, at which point the reaction mixture was diluted with H.sub.2O and the mixture was acidified with aqueous HCl (0.5M) to pH 7. The precipitate was filtered and the filter cake was washed with H.sub.2O, and dried under reduced pressure to give crude product. The crude product was dissolved in TFA and was then evaporated under reduced pressure. The oily residue was triturated with MeCN, then dropped into MTBE for 10 min. The supernatant was removed and then the precipitate was collected by filtration under N.sub.2 to give the product.

Intermediate H1-1: Synthesis of 3-[2-({2-[4-(5-azidopyrimidin-2-yl)piperazin-1-yl]pyrimidin-5-yl}formamido)ethoxy]propanoic Acid

[1275] ##STR01243##

Step 1

[1276] To a solution of 2-(4-(5-azidopyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylic acid (796.12 mg, 2.43 mmol, 1.0 equiv) in DMF (20 mL) was added DIPEA (1.27 mL, 7.30 mmol, 3.0 equiv) and HATU (1.39 g, 3.65 mmol, 1.5 equiv) at room temperature, after 1 h, methyl 3-(2-aminoethoxy)propanoate (0.67 g, 3.65 mmol, 1.5 equiv, HCl) was added to the mixture. The reaction mixture was stirred for 20 min, at which point the mixture was poured into H.sub.2O (200 mL) and stirred for 5 min. The supernatant was removed and then the precipitate was collected by filtration under N.sub.2 to give the crude product. The residue was purified by silica gel chromatography (1/1 to 0/1 petroleum ether/EtOAc) to afford the product (0.8 g, 1.68 mmol, 69.0% yield) as a light yellow solid. LCMS (ESI) m/z: [M+Na] calcd for C.sub.19H.sub.24N.sub.10O.sub.4: 479.2; found 479.1.

Step 2

[1277] To a solution of methyl 3-(2-(2-(4-(5-azidopyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxamido)ethoxy)propanoate (0.8 g, 1.75 mmol, 1.0 equiv) in THF (40 mL), H.sub.2O (10 mL) and MeOH (10 mL) was added LiOH.H.sub.2O (0.11 g, 2.62 mmol, 1.50 equiv) at room temperature. The reaction mixture was stirred for 3 h, at which point the mixture was concentrated under reduced pressure to remove THF and MeOH. To the residue was added H.sub.2O (50 mL) and the mixture was acidified with aqueous HCl (0.5M) to pH 7. The precipitate was filtered and the filter cake was washed with H.sub.2O (20 mL), and dried under reduced pressure to give crude product. The crude product was dissolved in TFA (3 mL) and was then evaporated under reduced pressure. The oily residue was triturated with MeCN (1 mL), then dropped into MTBE (20 mL) for 10 min. The supernatant was removed and then the precipitate was collected by filtration under N.sub.2 to give the product (0.368 g, 34.5% yield, TFA) as a light yellow solid. LCMS (ESI) m/z: [M+H] calcd for C.sub.18H.sub.22N.sub.10O.sub.4: 443.19; found 443.1.

[1278] Following the General Procedure 15, but using the appropriate amine and acid, the additional Intermediates H1 in Table 35 were prepared:

TABLE-US-00038 TABLE 35 Additional azides prepared Molecular Calculated Observed Structure Formula MW MW [01244]embedded image C.sub.18H.sub.22N.sub.10O.sub.4 [M + H] = 443.19 [M + H] = 443.1 [01245]embedded image C.sub.20H.sub.26N.sub.10O.sub.5 [M + H] = 487.22 [M + H] = 487.2 [01246]embedded image C.sub.22H.sub.30N.sub.10O.sub.6 [M + H] = 531.24 [M + H] = 531.2 [01247]embedded image C.sub.19H.sub.24N.sub.10O.sub.5 [M + H] = 473.20

Intermediate H2-1: Synthesis of N-(2-(3-((4-(4-amino-3-(2-aminobenzo[d]oxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)amino)-3-oxopropoxy)ethyl)-2-(4-(5-azidopyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxamide

[1279] ##STR01248##

[1280] To a solution of 3-(2-(2-(4-(5-azidopyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxamido)ethoxy)propanoic acid (100 mg, 185 μmol, 1.0 equiv) and 5-{4-amino-1-pentyl-1H-pyrazolo[3,4-d]pyrimidin-3-yl}-1,3-benzoxazol-2-amine (99.9 mg, 221 μmol, 1.2 equiv) in DMA (1.84 mL) was added DIPEA (112 μL, 647 μmol, 3.5 equiv) followed by HOBt hydrate (42.2 mg, 221 μmol, 1.2 equiv) and EDCI HCl (42.3 mg, 221 μmol, 1.2 equiv). The reaction was stirred at room temperature for 7 h, at which point the reaction mixture was diluted with DMSO and purified by reverse phase prep-HPLC (10.fwdarw.100% MeCN/H.sub.2O to provide the product (28.4 mg, 20% yield). LCMS (ESI) m/z: [M+H] calcd for C.sub.34H.sub.38N.sub.18O.sub.4: 763.34; found 763.3.

[1281] Following the General Procedure 5, but using the appropriate amine-containing active site inhibitor and Intermediate H1, the additional Intermediates H2 in Table 36 were prepared:

TABLE-US-00039 TABLE 36 Additional active site inhibitor containing Intermediates H2 prepared. Calcu- Molecular lated Structure Formula MW [01249]embedded image C.sub.34H.sub.38N.sub.18O.sub.4 [M + H] = 763.34 [01250]embedded image C.sub.36H.sub.42N.sub.18O.sub.5 [M + H] = 807.37 [01251]embedded image C.sub.38H.sub.46N.sub.18O.sub.6 [M + H] = 851.39 [01252]embedded image C.sub.35H.sub.40N.sub.18O.sub.5 [M + H] = 793.35 Observed Structure MW [01253]embedded image [M + H] = 763.3 [01254]embedded image [M + H] = 807.3 [01255]embedded image [M + H] = 851.4 [01256]embedded image [M + H] = 793.3

[1282] Following General Procedure 3, but using the appropriate alkyne modified rapamycin and Intermediates H2, the Series 8 bivalent analogs in Table 37 were synthesized:

TABLE-US-00040 TABLE 37 Series 8 Bivalent Analogs Calcu- Ob- Molecular lated served Structure Formula MW MW [01257]embedded image C.sub.88H.sub.122N.sub.20O.sub.17 [M + H] = 1731.94 [M + H] = 1731.9 [01258]embedded image C.sub.90H.sub.126N.sub.20O.sub.18 [M + H] = 1775.96 [M + H] = 1776.1 [01259]embedded image C.sub.92H.sub.130N.sub.20O.sub.19 [M + H] = 1819.99 [M + H] = 1820.0 [01260]embedded image C.sub.89H.sub.124N.sub.20O.sub.18 [M + H] = 1761.95 [M + H] = 1761.9

General Procedure 16: Coupling of an Alkyne Containing Carboxylic Acid and an Amine Containing Active Site Inhibitor

[1283] ##STR01261##

[1284] To a 0.1M solution of amine containing active site inhibitor (1.8 equiv) in DMA was added carboxylic acid (1.0 equiv), DIPEA (3.0 equiv), and finally PyBOP (1.3 equiv). The reaction was allowed to stir until consumption of carboxylic acid, as indicated by LCMS. The reaction mixture was then purified by reverse phase prep-HPLC to afford the product.

Intermediate I1-1: Synthesis of N-{4-[4-amino-3-(2-amino-1,3-benzoxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl] butyl}-4,7,10,13,16,19,22,25,28,31-decaoxatetratriacont-33-ynamide

[1285] To a solution of {4-[4-amino-3-(2-amino-1,3-benzoxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl]butyl}amino 2,2,2-trifluoroacetate (770 mg, 1.71 mmol, 1.8 equiv) in DMA (9.52 mL) was added 4,7,10,13,16,19,22,25,28,31-decaoxatetratriacont-33-ynoic acid (500 mg, 953 μmol, 1.0 equiv), DIPEA (495 μL, 2.85 mmol, 3.0 equiv), and finally PyBOP (640 mg, 1.23 mmol, 1.3 equiv). After stirring overnight the the crude reaction mixture was purified by reverse phase chromatography (10.fwdarw.100% MeCN/H.sub.2O) to provide the product (105.1 mg, 13% yield). LCMS (ESI) m/z: [M+H] calcd for C.sub.40H.sub.60N.sub.8O.sub.12: 845.44; found 845.3.

[1286] Following the General Procedure 16, but using the appropriate amine-containing active site inhibitor and carboxylic acid containing PEG, the additional Intermediates I1 in Table 38 were prepared:

TABLE-US-00041 TABLE 38 Additional alkynes prepared Molecular Structure Formula [01262]embedded image C.sub.40H.sub.60N.sub.8O.sub.12 [01263]embedded image C.sub.41H.sub.61N.sub.7O.sub.12 Calculated Structure MW [01264]embedded image [M + H] = 845.44 [01265]embedded image [M + H] = 844.45 Observed Structure MW [01266]embedded image [M + H] = 845.3 [01267]embedded image [M + H] = 844.3

Example 195: Synthesis of Series 9 Bivalent Rapamycin Analog

[1287] ##STR01268##

[1288] To a solution 40(S)-azido rapamycin (105 mg, 124 μmol, 3.0 equiv) in DMSO (4.12 mL) was added tetrakis(acetonitrile)copper(I) hexafluorophosphate (30.7 mg, 82.6 μmol, 2.0 equiv) followed by TBTA (87.5 mg, 165 μmol, 4.0 equiv). After stirring for 4 h the crude reaction mixture was purified by reverse phase chromatography (40.fwdarw.100% MeCN/H.sub.2O) to provide the product (11.0 mg, 14.9% yield). LCMS (ESI) m/z: [M+H] calcd for C.sub.91H.sub.138N.sub.12O.sub.24: 1784.00; found 1784.7.

[1289] Following General Procedure 9, but using the appropriate azide modified rapamycin and Intermediates I1, the Series 9 bivalent analogs in Table 39 were synthesized:

TABLE-US-00042 TABLE 39 Series 9 Bivalent Analogs Calcu- Molecular lated Structure Formula MW [01269]embedded image C.sub.91H.sub.138N.sub.12O.sub.24 [M + H] = 1784.00 [01270]embedded image C.sub.92H.sub.139N.sub.11O.sub.24 [M + H] = 1783.01 Observed Structure MW [01271]embedded image [M + H] = 1784.7 [01272]embedded image [M + H] = 1783.2

Intermediate J1-1: N-{4-[4-amino-3-(2-amino-1,3-benzoxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl]butyl}-1-hydroxy-3,6,9,12-tetraoxapentadecan-15-amide

[1290] ##STR01273##

[1291] To a solution of 1-hydroxy-3,6,9,12-tetraoxapentadecan-15-oic acid (97 mg, 364 μmol, 1.65 equiv) and 5-[4-amino-1-(4-aminobutyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl]-1,3-benzoxazol-2-amonium trifluoroacetate (100 mg, 221 μmol, 1.0 equiv) in DMA (2.20 mL) was added DIPEA (153 μL, 884 μmol, 4.0 equiv) followed by PyBOP (149 mg, 287 μmol, 1.3 equiv). The reaction was stirred at room temperature for 3 h then purified by silica gel chromatography (0.fwdarw.30% MeOH/DCM) to afford the product (77.4 mg, 60% yield). LCMS (ESI) m/z: [M+H] calcd for C.sub.27H.sub.38N.sub.8O.sub.7: 587.30; found 587.2.

TABLE-US-00043 TABLE 40 Additional alcohols prepared Molecular Calculated Observed Structure Formula MW MW [01274]embedded image C.sub.27H.sub.38N.sub.8O.sub.7 [M + H] = 587.30 [M + H] = 587.2

Intermediate J2-1: 14-({4-[4-amino-3-(2-amino-1,3-benzoxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl]butyl}carbamoyl)-3,6,9,12-tetraoxatetradecan-1-yl 4,7,10,13-tetraoxahexadec-15-ynoate

[1292] ##STR01275##

[1293] To a solution of 4,7,10,13-tetraoxahexadec-15-ynoic acid (37.4 mg, 144 μmol, 1.1 equiv) in DMA (1 mL) was added EDC (50.7 mg, 262 μmol, 2.0 equiv) followed by 4-dimethylaminopyridine (32.0 mg, 262 μmol, 2.0 equiv). The resulting suspension was stirred for 5 minutes, then N-{4-[4-amino-3-(2-amino-1,3-benzoxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl]butyl}-1-hydroxy-3,6,9,12-tetraoxapentadecan-15-amide (77.4 mg, 131 μmol, 1.0 equiv) in DMA (1.6 mL) was added. The reaction mixture was stirred at room temperature for 24 h then purified by silica chromatography (0.fwdarw.20% MeOH/DCM) to afford the product. LCMS (ESI) m/z: [M+H] calcd for C.sub.39H.sub.56N.sub.8O.sub.12: 829.41; found 829.3.

TABLE-US-00044 TABLE 41 Additional alkynes prepared Molecular Calculated Observed Structure Formula MW MW [01276]embedded image C.sub.39H.sub.56N.sub.8O.sub.12 [M + H] = 829.41 [M + H] = 829.3

[1294] Following General Procedure 3, but using the appropriate azide modified rapamycin and Intermediates J2, the Series 10 bivalent analogs in Table 42 were synthesized:

TABLE-US-00045 TABLE 42 Series 10 Bivalent Analogs Calcu- Molecular lated Structure Formula MW [01277]embedded image C.sub.90H.sub.134N.sub.12O.sub.24 [M + H] = 1767.97 Observed Structure MW [01278]embedded image [M + H] = 1767.7

[1295] Following General Procedure 7, but using the appropriate NHS ester-PEG-azide and amine containing PEG-tert-butyl ester, the Intermediates K1 in Table 43 were synthesized:

TABLE-US-00046 TABLE 43 Additional carboxylic acids prepared Molecular Calculated Observed Structure Formula MW MW [01279]embedded image C.sub.18H.sub.34N.sub.4O.sub.9 [M + H] = 451.24 [M + H] = 451.4

[1296] Following General Procedure 1, but using the appropriate Intermediate K1 and amine containing active site inhibitor, the Intermediates K2 in Table 44 were synthesized:

TABLE-US-00047 TABLE 44 Additional azides prepared Molecular Structure Formula [01280]embedded image C.sub.34H.sub.50N.sub.12O.sub.9 [01281]embedded image C.sub.35H.sub.51N.sub.11O.sub.9 Calculated Structure MW [01282]embedded image [M + H] = 771.39 [01283]embedded image [M + H] = 770.40 Observed Structure MW [01284]embedded image [M + H] = 771.3 [01285]embedded image [M + H] = 770.4

[1297] Following General Procedure 3, but using the appropriate alkyne modified rapamycin and Intermediates K2, the Series 11 bivalent analogs in Table 45 were synthesized:

TABLE-US-00048 TABLE 45 Series 11 Bivalent Analogs Molecular Calculated Structure Formula MW [01286]embedded image C.sub.91H.sub.137N.sub.13O.sub.22 [M + H] = 1765.01 [01287]embedded image C.sub.92H.sub.138N.sub.12O.sub.22 [M + H] = 1764.01 Observed Structure MW [01288]embedded image [M + H] = 1964.9 [01289]embedded image [M + H] = 1763.8

General Procedure 17: Coupling of an Ester Containing Carboxylic Acid and an Amine Containing Active Site Inhibitor

[1298] ##STR01290##

Step 1

[1299] To a 0.10 M solution of carboxylic acid PEG (1.0 equiv) in DMF was added an amine containing active site inhibitor (1.8 equiv) followed by DIPEA (3.0 equiv) and PyBOP (1.3 equiv). The reaction was allowed to stir until consumption of carboxylic acid, as indicated by LCMS. The mixture was then purified by silica gel chromatography to afford the product.

Step 2

[1300] A 0.08M solution of ester (1 equiv) in DCM was added TFA (80 equiv). The solution was allowed to stir until consumption of the ester, as indicated by LCMS. The reaction mixture was concentrated under reduced pressure and then lyophilized from MeCN to give the product.

Intermediate L1-1: Synthesis of 3-[2-({4-[4-amino-3-(2-amino-1,3-benzoxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl]butyl}carbamoyl)ethoxy]propanoic Acid

[1301] ##STR01291##

Step 1: Synthesis of tert-butyl 3-[2-({4-[4-amino-3-(2-amino-1,3-benzoxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl]butyl}carbamoyl)ethoxy]propanoate

[1302] To a solution of 3-[3-(tert-butoxy)-3-oxopropoxy]propanoic acid (250 mg, 1.14 mmol, 1.0 equiv) in DMF (11.3 mL) was added 5-(4-amino-1-(4-aminobutyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]-oxazol-2-amine trifluoroacetic acid salt (927 mg, 2.05 mmol, 1.8 equiv), DIPEA (595 μL, 3.42 mmol, 3.0 equiv), and PyBOP (769 mg, 1.48 mmol, 1.3 equiv). The resulting solution was stirred at room temperature for 3 h. The crude product was purified by silica gel chromatography (0.fwdarw.20% MeOH/DCM) to afford the product as a pink oil. The product was repurified by silica gel chromatography (0.fwdarw.15% MeOH/DCM) to afford the product (245 mg, 40% yield) as a pink solid. LC-MS (ESI) m/z: [M+H] calcd for C.sub.26H.sub.34N.sub.8O.sub.5: 539.28; found 539.2.

Step 2: Synthesis of 3-[2-({4-[4-amino-3-(2-amino-1,3-benzoxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl]butyl}carbamoyl)ethoxy]propanoic Acid

[1303] To a solution of tert-butyl 3-[2-({4-[4-amino-3-(2-amino-1,3-benzoxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl]butyl}carbamoyl)ethoxy]propanoate (133 mg, 0.2469 mmol, 1.0 equiv) in DCM (3 mL) was added TFA (1.5 mL). The resulting homogenous solution was stirred at room temperature for 3 h. The reaction mixture was concentrated under reduced pressure. The product was dissolved in MeCN and lyophilized to give the product (222 mg, 150%) as a light pink tacky solid. LC-MS (ESI) m/z: [M+H] calcd for C.sub.22H.sub.26N.sub.8O.sub.5: 483.21; found 483.1.

[1304] Following General Procedure 17, but using the appropriate carboxylic acid-PEG-ester and amine containing active site inhibitor, the Intermediates L1 in Table 46 were synthesized:

TABLE-US-00049 TABLE 46 Additional carboxylic acids prepared Molecular Calculated Observed Structure Formula MW MW [01292]embedded image C.sub.22H.sub.26N.sub.8O.sub.5 [M + H] = 483.21 [M + H] = 483.1 [01293]embedded image C.sub.26H.sub.34N.sub.8O.sub.7 [M + H] = 571.27 [M + H] = 571.2

[1305] Following General Procedure 1, but using the appropriate Intermediate L1 and amine containing pre-linker, the Intermediates L2 in Table 47 were synthesized:

TABLE-US-00050 TABLE 47 Additional azides prepared Molecular Calculated Observed Structure Formula MW MW [01294]embedded image C.sub.30H.sub.35N.sub.15O.sub.4 [M + H] = 670.31 [M + H] = 670.2 [01295]embedded image C.sub.34H.sub.43N.sub.15O.sub.6 [M + H] = 758.36 [M + H] = 758.2

[1306] Following General Procedure 3, but using the appropriate alkyne modified rapamycin and Intermediates L2, the Series 12 bivalent analogs in Table 48 were synthesized:

TABLE-US-00051 TABLE 48 Series 12 Bivalent Analogs Molecular Structure Formula [01296]embedded image C.sub.84H.sub.119N.sub.17O.sub.17 [01297]embedded image C.sub.88H.sub.127N.sub.17O.sub.19 Calculated Structure MW [01298]embedded image [M + H] = 1638.90 [01299]embedded image [M + H] = 1726.96 Observed Structure MW [01300]embedded image [M + H] = 1638.7 [01301]embedded image [M + H] = 1726.8

Biological Examples

[1307] Cell Based AlphaLISA Assays for Determining IC50 for Inhibition of P-Akt (S473), P-4E-BP1 (T37/46), and P-P70S6K (T389) in MDA-MB-468 Cells

[1308] mTOR Kinase Cellular Assay

[1309] To measure functional activity of mTORC1 and mTORC2 in cells the phosphorylation of 4EBP1 (Thr37/46) and P70S6K (Thr389), and AKT1/2/3 (Ser473) was monitored using AlphaLisa SureFire Ultra Kits (Perkin Elmer). MDA-MB-468 cells (ATCC® HTB-132) were cultured in 96-well tissue culture plates and treated with compounds in the disclosure at concentrations varying from 0.017-1,000 nM for two to four hours at 37° C. Incubations were terminated by removal of the assay buffer and addition of lysis buffer provided with the assay kit. Samples were processed according to the manufacturer's instructions. The Alpha signal from the respective phosphoproteins was measured in duplicate using a microplate reader (Envision, Perkin-Elmer or Spectramax M5, Molecular Devices). Inhibitor concentration response curves were analyzed using normalized IC.sub.50 regression curve fitting with control based normalization.

[1310] As an example, measured IC.sub.50 values for selected compounds are reported below:

TABLE-US-00052 IC.sub.50 for Inhibition of mTORC1 and mTORC2 Substrate Phosphorylation (nM) p-P70S6K- p-4E-BP1- p-AKT1/2/3- Compound (T389) (T37/46) (S473) MLN-128 1.4 16 3.7 Rapamycin 0.2 >1,000 >1,000 Example 1 0.3 1.0 3.9

[1311] As an example, measured pIC.sub.50 values for selected compounds are reported below:

TABLE-US-00053 pIC.sub.50 for Inhibition of mTORC1 and mTORC2 Substrate Phosphorylation P-P70S6K- P-4E-BP1- p-AKT 1/2/3 - Example (T389) (T37/46) (S473)  1 +++ +++ +++  2 +++ ++ +  3 +++ +++ ++  4 +++ − −  5 +++ + −  6 +++ − −  7 +++ +++ +++  8 +++ +++ ++  9 +++ − −  10 +++ − −  11 +++ +++ +++  12 − − −  13 ++ ++ +  14 ++ ++ +  15 ++ ++ +  16 − − −  17 ++ ++ +  18 +++ +++ +++  19 +++ + +  19 +++ +++ ++  20 +++ +++ ++  21 +++ +++ ++  22 +++ +++ ++  23 +++ +++ +++  24 +++ +++ ++  25 +++ +++ ++  26 +++ +++ ++  27 +++ +++ ++  28 +++ +++ ++  29 +++ +++ ++  30 +++ +++ ++  31 +++ +++ ++  32 ++ ++ ++  33 ++ ++ ++  34 ++ ++ +  35 +++ +++ ++  36 +++ ++ ++  37 +++ +++ ++  38 ++ ++ +  39 ++ + +  40 +++ +++ +  41 +++ ++ −  42 +++ +++ ++  43 +++ + +  44 +++ +++ +++  45 +++ +++ +++  46 +++ +++ ++  47 +++ +++ ++  48 +++ +++ ++  49 +++ +++ +  50 ++ ++ +  51 ++ ++ +  52 +++ ++ ++  53 +++ +++ ++  54 ++ − −  55 +++ ++ +  56 +++ +++ +++  57 +++ +++ ++  58 +++ +++ +++  59 +++ +++ ++  60 +++ +++ ++  61 ++ ++ ++  62 − − −  63 + + +  64 +++ ++ +  65 ++ ++ +  66 +++ +++ +++  67 +++ +++ +++  68 +++ ++ +  69 +++ +++ ++  70 ++ − −  71 ++ ++ −  72 +++ +++ +++  73 +++ +++ +++  74 ++ − −  75 ++ + +  76 +++ +++ ++  77 +++ +++ ++  78 +++ ++ ++  79 +++ ++ +  80 +++ ++ +  81 ++ ++ +  82 +++ ++ +  83 +++ +++ +++  84 +++ +++ ++  85 +++ +++ ++  86 +++ +++ ++  87 +++ ++ −  88 +++ +++ ++  89 +++ +++ ++  90 +++ +++ +++  91 +++ +++ +++  92 +++ ++ +  93 ++ ++ −  94 ++ ++ −  95 +++ +++ ++  96 +++ +++ ++  97 ++ ++ ++  99 +++ ++ ++ 100 +++ + ++ 101 +++ +++ ++ 102 +++ ++ ++ 103 +++ +++ ++ 104 ++ + + 105 ++ ++ + 106 +++ +++ ++ 107 +++ +++ +++ 108 +++ +++ ++ 109 +++ − − 110 +++ + − 111 +++ + + 112 +++ − − 113 +++ +++ ++ 114 +++ − − 115 +++ +++ +++ 116 +++ ++ − 117 +++ − − 118 +++ +++ ++ 119 +++ − − 120 ++ ++ + 121 ++ + − 122 ++ ++ ++ 123 ++ ++ + 124 ++ ++ ++ 125 ++ ++ ++ 126 ++ ++ + 127 ++ ++ + 128 ++ ++ + 129 ++ + − 130 ++ ++ ++ 131 ++ + + 132 ++ ++ + 133 ++ ++ + 134 ++ ++ ++ 135 ++ ++ + 136 ++ ++ + 137 ++ ++ + 138 ++ − + 139 ++ ++ ++ 140 ++ ++ + 141 ++ ++ ++ 142 ++ ++ + 143 ++ + − 144 + − − 145 ++ + − 146 ++ − − 147 + + − 148 + − − 149 ++ + + 150 + + − 151 + + − 152 + − − 153 ++ + − 154 − − − 155 − − − 156 − − − 157 − − − 158 − − − 159 +++ − − 160 + − + 161 − − − 162 ++ + − 163 + − − 164 +++ ++ + 165 ++ + − 166 − − − 167 ++ + + 168 + + − 169 + − − 170 + − − 171 + + − 172 + − − 173 + − − 174 + − − 175 − − − 176 + − − 177 + − − 178 + − − 179 ++ + − 180 ++ − − 181 +++ +++ ++ 182 +++ − − 183 +++ +++ ++ 184 +++ +++ ++ 185 +++ +++ ++ 186 +++ ++ + 187 +++ +++ ++ 188 +++ +++ + 189 +++ +++ ++ 190 +++ ++ + 191 +++ +++ − 192 +++ ++ − 193 +++ ++ − 194 +++ − − 195 ++ ++ ++ 196 ++ ++ + 197 ++ ++ + 198 +++ +++ ++ 199 +++ +++ + 200 ++ − + 201 +++ ++ + Note: pIC50 (p-P70S6K-(T389)) ≥9 +++ 9 > pIC50 ≥ 8 ++ 8 > pIC50 ≥ 6 + <6 − pIC50 (p-4E-BPl-(T37/46) or p-AKTl/2/3-(S473)) ≥8.5 +++ 8.5 > pIC50 ≥ 7.5 ++ 7.5 > pIC50 ≥ 6.0 + <6 −

EQUIVALENTS

[1312] While the present disclosure has been described in conjunction with the specific embodiments set forth above, many alternatives, modifications and other variations thereof will be apparent to those of ordinary skill in the art. All such alternatives, modifications and variations are intended to fall within the spirit and scope of the present disclosure.