ANTIBODIES FOR TREATMENT AND DIAGNOSIS

20180193496 ยท 2018-07-12

Assignee

Inventors

Cpc classification

International classification

Abstract

The invention relates to the diagnosis and treatment of diseases, including cancer and inflammatory disorders. The invention provides, and involves the use of, antibodies that bind: i) the IIICS isoform of fibronectin, ii) matrix-metalloproteinase 3 (MMP3), iii) periostin, or iv) tenascin-W.

Claims

1-66. (canceled)

67. An antibody molecule that binds tenascin W, wherein the antibody molecule comprises a VH domain comprising a framework and a set of complementarity determining regions HCDR1, HCDR2 and HCDR3, and a VL domain comprising a framework and a set of complementarity determining regions LCDR1, LCDR2 and LCDR3, wherein: HCDR3 has the amino acid sequence of SEQ ID NO: 61, LCDR3 has the amino acid sequence of SEQ ID NO: 64, HCDR1 has the amino acid sequence of SEQ ID NO: 59, HCDR2 has the amino acid sequence of SEQ ID NO: 60, LCDR1 has the amino acid sequence of SEQ ID NO: 62, and LCDR2 has the amino acid sequence of SEQ ID NO: 63.

68. The antibody molecule according to claim 67, wherein the VH domain has the amino acid sequence of SEQ ID NO: 57, and/or the VL domain has the amino acid sequence of SEQ ID NO: 58.

69. The antibody molecule according to claim 67, wherein the antibody molecule is or comprises a single chain Fv (scFv), is a small immunoprotein (SIP), is a diabody, or is an IgG molecule

70. A conjugate comprising an antibody molecule according to claim 67 and a biocidal molecule, a cytotoxic molecule, an anti-inflammatory agent, a radioisotope or a detectable label.

71. A method of treating cancer comprising administering an antibody molecule according to claim 67 to the patient in need thereof.

72. An antibody molecule that binds the IIICS isoform of fibronectin, wherein the antibody molecule comprises a VH domain comprising a framework and a set of complementarity determining regions HCDR1, HCDR2 and HCDR3, and a VL domain comprising a framework and a set of complementarity determining regions LCDR1, LCDR2 and LCDR3, wherein: HCDR3 has the amino acid sequence of SEQ ID NO: 5, LCDR3 has the amino acid sequence of SEQ ID NO: 8, HCDR1 has the amino acid sequence of SEQ ID NO: 3, HCDR2 has the amino acid sequence of SEQ ID NO: 4, LCDR1 has the amino acid sequence of SEQ ID NO: 6, and LCDR2 has the amino acid sequence of SEQ ID NO: 7.

73. The antibody molecule according to claim 72, wherein the VH domain has the amino acid sequence of SEQ ID NO: 1, and/or the VL domain has the amino acid sequence of SEQ ID NO: 2.

74. The antibody molecule according to claim 72, wherein the antibody molecule is or comprises a single chain Fv (scFv), is a small immunoprotein (SIP), is a diabody, or is an IgG molecule

75. A conjugate comprising an antibody molecule according to claim 72 and a biocidal molecule, a cytotoxic molecule, an anti-inflammatory agent, a radioisotope or a detectable label.

76. A method of treating cancer comprising administering an antibody molecule or conjugate according to claim 72 to the patient in need thereof.

77. An antibody molecule that binds matrix-metalloproteinase 3 (MMP3), wherein the antibody molecule comprises a VH domain comprising a framework and a set of complementarity determining regions HCDR1, HCDR2 and HCDR3, and a VL domain comprising a framework and a set of complementarity determining regions LCDR1, LCDR2 and LCDR3, wherein: HCDR3 has the amino acid sequence of SEQ ID NO: 21, LCDR3 has the amino acid sequence of SEQ ID NO: 24, HCDR1 has the amino acid sequence of SEQ ID NO: 19, HCDR2 has the amino acid sequence of SEQ ID NO: 20, LCDR1 has the amino acid sequence of SEQ ID NO: 22, and LCDR2 has the amino acid sequence of SEQ ID NO: 23.

78. The antibody molecule according to claim 77, wherein the VH domain has the amino acid sequence of SEQ ID NO: 17, and/or the VL domain has the amino acid sequence of SEQ ID NO: 18.

79. The antibody molecule according to claim 77, wherein the antibody molecule is or comprises a single chain Fv (scFv), is a small immunoprotein (SIP), is a diabody, or is an IgG molecule

80. A conjugate comprising an antibody molecule according to claim 77 and a biocidal molecule, a cytotoxic molecule, an anti-inflammatory agent, a radioisotope or a detectable label.

81. A method of treating cancer comprising administering an antibody molecule or conjugate according to claim 77 to the patient in need thereof.

82. An antibody molecule that binds periostin, wherein the antibody molecule comprises a VH domain comprising a framework and a set of complementarity determining regions HCDR1, HCDR2 and HCDR3, and a VL domain comprising a framework and a set of complementarity determining regions LCDR1, LCDR2 and LCDR3, wherein: HCDR3 has the amino acid sequence of SEQ ID NO: 53, LCDR3 has the amino acid sequence of SEQ ID NO: 56, HCDR1 has the amino acid sequence of SEQ ID NO: 51, HCDR2 has the amino acid sequence of SEQ ID NO: 52, LCDR1 has the amino acid sequence of SEQ ID NO: 54, and LCDR2 has the amino acid sequence of SEQ ID NO: 55.

83. The antibody molecule according to claim 82, wherein the VH domain has the amino acid sequence of SEQ ID NO: 49, and/or the VL domain has the amino acid sequence of SEQ ID NO: 50.

84. The antibody molecule according to claim 82, wherein the antibody molecule is or comprises a single chain Fv (scFv), is a small immunoprotein (SIP), is a diabody, or is an IgG molecule.

85. A conjugate comprising an antibody molecule according to claim 82 and a biocidal molecule, a cytotoxic molecule, an anti-inflammatory agent, a radioisotope or a detectable label.

86. A method of treating cancer comprising administering an antibody molecule or conjugate according to claim 82 to the patient in need thereof.

Description

BRIEF DESCRIPTION OF THE FIGURES

[0033] FIG. 1 is schematic diagram showing the 5 possible splice isoforms of the IIICS isoform of fibronectin.

[0034] FIG. 2A shows staining of human placenta (hPlacenta), human tumours (A375 and H460) and murine tumours (K1735 and F9) with antibodies SW01 and SW02, which bind to the IIICS isoform of fibronectin, and negative control antibodies (neg. ctr). The negative control antibodies used were anti-human Von Willebrand Factor (Anti huVWF) in the human placenta experiments and anti-murine CD31 (muCD31) in the tumour experiments. FIG. 2B shows Biacore data demonstrating binding of antibody SW01 to IIICS.

[0035] FIG. 3 shows staining of human placenta using the anti-human MMP3 antibody CH01 in scFv format. The anti-hen egg lysozyme antibody KSF in scFv format was used as a negative control. Staining by the two scFv antibodies is shown in red, staining with the vascular marker human Von Willebrand factor is shown in green and nucleii were stained in blue using DAPI.

[0036] FIG. 4A shows the ability of anti-human MMP3 antibody CH01 to bind to the biotinylated catalytic domains of human (HsMMP3), mouse (MmMMP3) and rat (RnMMP3) MMP3 in an ELISA. CH01 recognizes both human and mouse MMP3 and to a lesser extent rat MMP3. FIG. 4B shows Biacore data demonstrating binding of antibody CH01 to human and mouse MMP3.

[0037] FIG. 5 is a schematic diagram showing four known isoforms of periostin.

[0038] FIG. 6A shows Biacore data demonstrating binding of antibodies LG1, LG2 and LG3 (in scFv format) to periostin. FIG. 6B shows Biacore data demonstrating binding of antibody 1E1 (in SIP format) to periostin.

[0039] FIG. 7 shows Biacore data demonstrating binding of antibody G10 (in scFv format) to tenascin-W.

DETAILED DESCRIPTION

[0040] The invention includes the combination of the aspects and preferred features described except where such a combination is clearly impermissible or expressly avoided.

[0041] In one aspect, the present invention relates to an antibody which binds i) the IIICS isoform of fibronectin, ii) matrix-metalloproteinase 3 (MMP3), iii) periostin, or iv) tenascin-W).

Antibody Molecule

[0042] The term antibody molecule describes an immunoglobulin whether natural or partly or wholly synthetically produced. The term also covers any polypeptide or protein having a binding domain which is, or is substantially homologous to, an antibody binding domain.

[0043] Examples of antibodies are the immunoglobulin isotypes and their isotypic subclasses; fragments which comprise an antigen binding domain such single chain diabodies. The antibody molecule or fragment thereof may be human or humanised. It is possible to take monoclonal and other antibodies and use techniques of recombinant DNA technology to produce other antibodies or chimeric molecules which retain the specificity of the original antibody. Such techniques may involve introducing DNA encoding the immunoglobulin variable region, or the CDRs of an antibody to the constant regions, or constant regions plus framework regions, of a different immunoglobulin. See, for instance, EP-A-184187, GB 2188638A or EP-A-239400. A hybridoma or other cell producing an antibody may be subject to genetic mutation or other changes, which may or may not alter the binding specificity of antibodies produced.

[0044] As antibodies can be modified in a number of ways, the term antibody molecule should be construed as covering antibody fragments, derivatives, functional equivalents and homologues of antibodies, including any polypeptide comprising an immunoglobulin binding domain, whether natural or wholly or partially synthetic. Chimeric molecules comprising an immunoglobulin binding domain, or equivalent, fused to another polypeptide are therefore included. Cloning and expression of chimeric antibodies are described in EP-A-0120694 and EP-A-0125023.

[0045] The term specific may be used to refer to the situation in which the antibody molecule will not show any significant binding to molecules other than its specific binding partner(s). The term is also applicable where e.g. an antigen-binding site of an antibody molecule is specific for a particular epitope that is carried by a number of antigens, in which case the antibody molecule carrying the antigen-binding site will be able to bind to the various antigens carrying the epitope.

[0046] The antibody molecule may be monovalent or bivalent i.e. may have two antigen binding sites. Where the antibody molecule is bivalent, the two antigen binding sites may be identical or different. An antigen binding site describes the part of an antibody which comprises the area which specifically binds to and is complementary to part or all of an antigen. Where an antigen is large, an antibody molecule may only bind to a particular part of the antigen, which part is termed an epitope. An antigen binding site may be provided by one or more antibody variable domains (e.g. a so-called Fd antibody fragment consisting of a VH domain). Preferably, an antigen binding site comprises an antibody light chain variable region (VL) and an antibody heavy chain variable region (VH).

[0047] An antibody molecule of the invention preferably comprises the HCDR3 of antibody SW01, antibody SW02, antibody CH01, antibody LG1, antibody LG2, antibody LG3, antibody 1E1, or antibody G10. The HCDR3 is known to play a role in determining the specificity of an antibody molecule (Segal et al., (1974), PNAS, 71:4298-4302; Amit et al., (1986), Science, 233:747-753; Chothia et al., (1987), J. Mol. Biol., 196:901-917; Chothia et al., (1989), Nature, 342:877-883; Caton et al., (1990), J. Immunol., 144:1965-1968; Sharon et al., (1990a), PNAS, 87:4814-4817; Sharon et al., (1990b), J. Immunol., 144:4863-4869; Kabat et al., (1991b), J. Immunol., 147:1709-1719).

[0048] The antibody molecule may further comprise the HCDR1, HCDR2, LCDR1, LCDR2 and/or LCDR3 of antibody SW01, antibody SW02, antibody CH01, antibody LG1, antibody LG2, antibody LG3, antibody 1E1, or antibody G10.

[0049] The antibody may also comprise the VH and/or VL domain of antibody SW01, antibody SW02, antibody CH01, antibody LG1, antibody LG2, antibody LG3, antibody 1E1, or antibody G10.

[0050] An antibody molecule of the invention may have a VH domain having at least 70%, more preferably one of at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100%, sequence identity to the VH domain of antibody SW01, antibody SW02, antibody CH01, antibody LG1, antibody LG2, antibody LG3, antibody 1E1, or antibody G10.

[0051] An antibody molecule of the invention may have a VL domain having at least 70%, more preferably one of at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100%, sequence identity to the VL domain of antibody SW01, antibody SW02, antibody CH01, antibody LG1, antibody LG2, antibody LG3, antibody 1E1, or antibody G10.

[0052] Sequence identity is commonly defined with reference to the algorithm GAP (Wisconsin GCG package, Accelerys Inc, San Diego USA). GAP uses the Needleman and Wunsch algorithm to align two complete sequences that maximizes the number of matches and minimizes the number of gaps. Generally, default parameters are used, with a gap creation penalty=12 and gap extension penalty=4. Use of GAP may be preferred but other algorithms may be used, e.g. BLAST (which uses the method of Altschul et al. (1990) J. Mol. Biol. 215: 405-410), FASTA (which uses the method of Pearson and Lipman (1988) PNAS USA 85: 2444-2448), or the Smith-Waterman algorithm (Smith and Waterman (1981) J. Mol Biol. 147: 195-197), or the TBLASTN program, of Altschul et al. (1990) supra, generally employing default parameters. In particular, the psi-Blast algorithm (Nucl. Acids Res. (1997) 25 3389-3402) may be used.

[0053] Variants of these VH and VL domains and CDRs may also be employed in antibody molecules for use in as described herein. Suitable variants can be obtained by means of methods of sequence alteration, or mutation, and screening.

[0054] Particular variants for use as described herein may include one or more amino acid sequence alterations (addition, deletion, substitution and/or insertion of an amino acid residue), maybe less than about 20 alterations, less than about 15 alterations, less than about 10 alterations or less than about 5 alterations, 4, 3, 2 or 1.

[0055] Alterations may be made in one or more framework regions and/or one or more CDRs. In particular, alterations may be made in HCDR1, HCDR2 and/or HCDR3.

[0056] The antibody molecule may be a whole antibody or a fragment thereof, in particular an antigen-binding fragment thereof.

[0057] Whole antibodies include IgA, IgD, IgE, IgG or IgM. Preferably, the whole antibody is IgG.

[0058] Antigen-binding fragments of whole antibodies include (i) the Fab fragment consisting of VL, VH, CL and CH1 domains; (ii) the Fd fragment consisting of the VH and CH1 domains; (iii) the Fv fragment consisting of the VL and VH domains of a single antibody; (iv) the dAb fragment (Ward et al. (1989) Nature 341, 544-546; McCafferty et al., (1990) Nature, 348, 552-554; Holt et al. (2003) Trends in Biotechnology 21, 484-490), which consists of a VH or a VL domain; (v) isolated CDR regions; (vi) F(ab)2 fragments, a bivalent fragment comprising two linked Fab fragments (vii) single chain Fv molecules (scFv), wherein a VH domain and a VL domain are linked by a peptide linker which allows the two domains to associate to form an antigen binding site (Bird et al. (1988) Science, 242, 423-426; Huston et al. (1988) PNAS USA, 85, 5879-5883); (viii) bispecific single chain Fv dimers (PCT/US92/09965) and (ix) diabodies, multivalent or multispecific fragments constructed by gene fusion (WO2013/014149; WO94/13804; Holliger et al. (1993a), Proc. Natl. Acad. Sci. USA 90 6444-6448). Fv, scFv or diabody molecules may be stabilized by the incorporation of disulphide bridges linking the VH and VL domains (Reiter et al. (1996), Nature Biotech, 14, 1239-1245). Minibodies comprising a scFv joined to a CH3 domain may also be made (Hu et al. (1996), Cancer Res., 56(13):3055-61). Other examples of binding fragments are Fab, which differs from Fab fragments by the addition of a few residues at the carboxyl terminus of the heavy chain CH1 domain, including one or more cysteines from the antibody hinge region, and Fab-SH, which is a Fab fragment in which the cysteine residue(s) of the constant domains bear a free thiol group.

[0059] A single chain Fv (scFv) may be comprised within a mini-immunoglobulin or small immunoprotein (SIP), e.g. as described in (Li et al., (1997), Protein Engineering, 10: 731-736). An SIP may comprise an scFv molecule fused to the CH4 domain of the human IgE secretory isoform IgE-S2 (?.sub.S2-CH4; Batista et al., (1996), J. Exp. Med., 184: 2197-205) forming an homo-dimeric mini-immunoglobulin antibody molecule

[0060] Preferably the antibody molecule comprises or consists of a single chain Fv, a small immunoprotein, a diabody, or a (whole) IgG molecule.

Conjugates

[0061] Conjugates of the invention comprise an antibody molecule of the invention and a therapeutic or diagnostic agent. The therapeutic agent may be a biocidal molecule, a cytotoxic molecule, a radioisotope, a photosensitizer, an enzyme, a hormone, or an anti-inflammatory agent. Preferably, the therapeutic agent is a biocidal molecule, a cytotoxic molecule, a radioisotope, or an anti-inflammatory agent. The biocidal molecule, cytotoxic molecule, or anti-inflammatory agent may be a cytokine.

[0062] The diagnostic agent may be radioisotope, e.g. a non-therapeutic radioisotope.

[0063] Radioisotopes which may be conjugated to a binding member of the invention include isotopes such as .sup.94mTc, .sup.99mTc, .sup.186Re, .sup.188Re, .sup.203Pb, .sup.67Ga, .sup.68Ga, .sup.47Sc, .sup.111In, .sup.97Ru, .sup.62Cu, .sup.64Cu, .sup.86Y, .sup.88Y, .sup.90Y, .sup.121Sn, .sup.161Tb, .sup.153Sm, .sup.166Ho, .sup.105Rh, .sup.177Lu, .sup.123I, .sup.124I, .sup.125I, .sup.131I, .sup.18F, .sup.211At and .sup.225Ac. Preferably, positron emitters, such as .sup.18F and .sup.124I, or gamma emitters, such as .sup.99mTc, .sup.111In and .sup.123I, are used for diagnostic applications (e.g. for PET), while beta-emitters, such as .sup.131I, .sup.90Y and .sup.177Lu, are preferably used for therapeutic applications. Alpha-emitters, such as .sup.211At and .sup.225Ac may also be used for therapy. In one example, the specific binding member may be conjugated to .sup.177Lu or .sup.90Y.

[0064] The specific binding member may be conjugated with the therapeutic agent by means of a peptide bond or linker, i.e. within a fusion polypeptide comprising said molecule and the specific binding member or a polypeptide chain component thereof. Other means for conjugation include chemical conjugation, especially cross-linking using a bifunctional reagent (e.g. employing DOUBLE-REAGENTS? Cross-linking Reagents Selection Guide, Pierce).

Linkers

[0065] The antibody molecule and the therapeutic or diagnostic agent may be connected to each other directly, for example through any suitable chemical bond or through a linker, for example a peptide linker.

[0066] The peptide linker may be a short (2-20, preferably 2-15, residue stretch of amino acids). Suitable examples of peptide linker sequences are known in the art. One or more different linkers may be used. The linker may be about 5 amino acids in length.

[0067] The chemical bond may be, for example, a covalent or ionic bond. Examples of covalent bonds include peptide bonds (amide bonds) and disulphide bonds. For example the antibody molecule and therapeutic or diagnostic agent may be covalently linked. For example by peptide bonds (amide bonds). Thus, the antibody molecule and therapeutic or diagnostic agent may be produced (secreted) as a single chain polypeptide. The individual components that form the antibody molecule or the therapeutic or diagnostic agent may also be connected directly, for example through any suitable chemical bond, or through a linker, for example a peptide linker. Examples of individual components which may be linked within the antibody molecule are CDRs or VH or VL sequences.

Methods of Treatment and Diagnosis

[0068] An antibody molecule or conjugate of the invention may be used in a method of treatment of the human or animal body, such as a method of treatment (which may include prophylactic treatment) of a disease or disorder in a patient (typically a human patient) comprising administering the antibody molecule or conjugate to the patient.

[0069] Accordingly, such aspects of the invention provide methods of treatment comprising administering an antibody molecule or conjugate of the invention, pharmaceutical compositions comprising such an antibody molecule or conjugate for the treatment of a condition or disease, and a method of making a medicament or pharmaceutical composition comprising formulating the antibody molecule or conjugate of the present invention with a physiologically acceptable carrier or excipient.

[0070] An antibody molecule or conjugate as herein described may be used in a method of treating an inflammatory disorder, inhibiting angiogenesis, treating cancer, and/or treating an autoimmune disease in a patient. The method may comprise targeting a therapeutic agent to the neovasculature in vivo. The agent may be any therapeutic agent discussed herein, which is suitable for treatment of the disease or disorder in question.

[0071] Also contemplated is a method of treating an inflammatory disorder, inhibiting angiogenesis, treating cancer, and/or treating an autoimmune disease in a patient by targeting a therapeutic agent to the neovasculature in a patient, the method comprising administering a therapeutically effective amount of an antibody molecule or conjugate as herein described to the patient.

[0072] An antibody molecule or conjugate as herein described may also be used in a method of imaging, detecting, or diagnosing a disease or disorder in a patient. A method of imaging, detecting, or diagnosing a disease or disorder comprising administering an antibody or conjugate as described herein to a patient is similarly contemplated. The disease or disorder may be an inflammatory disorder, angiogenesis, cancer, and/or an autoimmune disease. The method may comprise targeting a diagnostic agent, such as a detectable label, to the neovasculature in vivo.

[0073] Inflammatory disorders include any disease or disorder which is characterised by an inflammatory abnormality. Such disease include, for example, immune system disorders, such as autoimmune diseases, and cancer.

[0074] Angiogenesis is a feature of many known diseases and disorders and inhibition of angiogenesis using an antibody or conjugate of the invention may be used to treat such diseases and disorders. Similarly, diseases and disorders characterised by angiogenesis may be imaged, detected, or diagnosed using an antibody or conjugate described herein. Disease characterised by angiogenesis include, for example, rheumatoid arthritis, diabetic retinopathy, age-related muscular degeneration, angiomas, tumours and cancer.

[0075] As mentioned above, conditions which may be treated, imaged, detected, or diagnosed using an antibody or conjugate as described herein include cancer, as well as other tumours and neoplastic conditions.

[0076] Exemplary cancers include any type of solid or non-solid cancer or malignant lymphoma and especially liver cancer, lymphoma, leukaemia (e.g. acute myeloid leukaemia), sarcomas, skin cancer, bladder cancer, breast cancer, uterine cancer, ovarian cancer, prostate cancer, lung cancer, colorectal cancer, cervical cancer, head and neck cancer, oesophageal cancer, pancreatic cancer, renal cancer, stomach cancer and cerebral cancer. Cancers may be familial or sporadic. Cancers may be metastatic or non-metastatic. The cancer, tumour, or neoplastic condition may express i) the IIICS isoform of fibronectin, ii) matrix-metalloproteinase 3 (MMP3), iii) periostin, and/or iv) tenascin-W.

[0077] Autoimmune disease which may be treated, imaged, detected, or diagnosed using an antibody or conjugate as described herein include lupus erytematosus, rheumatoid arthritis, and psoriathic arthritis.

[0078] A further disease or disorder which may treated, imaged, detected, or diagnosed using an antibody or conjugate described herein is osteoarthritis.

Pharmaceutical Compositions

[0079] A further aspect of the present invention relates to a pharmaceutical composition comprising at least one antibody molecule or conjugate of the invention and optionally a pharmaceutically acceptable excipient.

[0080] Pharmaceutical compositions of the present invention typically comprise a therapeutically effective amount of an antibody molecule or conjugate according to the invention and optionally auxiliary substances such as pharmaceutically acceptable excipient(s). Said pharmaceutical compositions are prepared in a manner well known in the pharmaceutical art. A carrier or excipient may be a liquid material which can serve as a vehicle or medium for the active ingredient. Suitable carriers or excipients are well known in the art and include, for example, stabilisers, antioxidants, pH-regulating substances, controlled-release excipients. The pharmaceutical composition of the invention may be adapted, for example, for parenteral use and may be administered to the patient in the form of solutions or the like.

[0081] Pharmaceutical compositions comprising the antibody molecule or conjugate of the present invention may be administered to a patient. Administration is preferably in a therapeutically effective amount, this being sufficient to show benefit to the patient. Such benefit may be amelioration of at least one symptom. The actual amount administered, and rate and time-course of administration, will depend on the nature and severity of what is being treated. Prescription of treatment, e.g. decisions on dosage etc., is within the responsibility of general practitioners and other medical doctors. Treatments may be repeated at daily, twice-weekly, weekly, or monthly intervals at the discretion of the physician.

[0082] A pharmaceutical composition of the invention may be administered to a patient in need of treatment via any suitable route, usually by injection into the bloodstream and/or directly into the site to be treated. The precise dose and its frequency of administration will depend upon a number of factors, the route of treatment, the size and location of the area to be treated.

[0083] Pharmaceutical compositions for oral administration may be in tablet, capsule, powder or liquid form. A tablet may comprise a solid carrier such as gelatin or an adjuvant. Liquid pharmaceutical compositions generally comprise a liquid carrier such as water, petroleum, animal or vegetable oils, mineral oil or synthetic oil. Physiological saline solution, dextrose or other saccharide solution or glycols such as ethylene glycol, propylene glycol or polyethylene glycol may be included

[0084] For intravenous injection, or injection at the site of affliction, the pharmaceutical composition will be in the form of a parenterally acceptable aqueous solution which is pyrogen-free and has suitable pH, isotonicity and stability. Those of relevant skill in the art are well able to prepare suitable solutions using, for example, isotonic vehicles such as Sodium Chloride Injection, Ringer's Injection, Lactated Ringer's Injection. Preservatives, stabilisers, buffers, antioxidants and/or other additives may be included, as required.

[0085] A pharmaceutical composition may be administered alone or in combination with other treatments, either simultaneously or sequentially dependent upon the condition to be treated.

Kits

[0086] Another aspect of the invention provides a therapeutic kit for use in the treatment of a disease or disorder comprising an antibody molecule or conjugate as described herein. The components of a kit are preferably sterile and in sealed vials or other containers.

[0087] A kit may further comprise instructions for use of the components in a method described herein. The components of the kit may be comprised or packaged in a container, for example a bag, box, jar, tin or blister pack.

[0088] Further aspects and embodiments of the invention will be apparent to those skilled in the art given the present disclosure including the following experimental exemplification.

[0089] All documents mentioned in this specification are incorporated herein by reference in their entirety.

[0090] and/or where used herein is to be taken as specific disclosure of each of the two specified features or components with or without the other. For example A and/or B is to be taken as specific disclosure of each of (i) A, (ii) B and (iii) A and B, just as if each is set out individually herein.

[0091] Unless context dictates otherwise, the descriptions and definitions of the features set out above are not limited to any particular aspect or embodiment of the invention and apply equally to all aspects and embodiments which are described.

[0092] Certain aspects and embodiments of the invention will now be illustrated by way of example and with reference to the figures described above.

EXAMPLES

Example 1Preparation and Characterisation of Two New Antibodies Against the IIICS Isoform of Fibronectin

[0093] Antibodies SW01 and SW02 were isolated in single-chain Fv (scFv) configuration from phage display libraries which include the libraries described in PCT/EP2009/006487, in Weber et al. (PLoS One, 2014, 9 (6) doi: 10/1361) and in Silacci et al. (Protein Engineering Design & Selection, 2006, 19, 471-478) according to the screening technique described by Silacci et al. (Protein Engineering Design & Selection, 2006, 19, 471-478) using fibronectin IIICS as the screening antigen.

[0094] The SW01 and SW02 antibodies when used in monomeric scFv format, bind to the IIICS (89V) and IIICS (120V) isoforms (FIG. 1). Furthermore, using ELISA antibodies SW01 and SW02 were shown to recognize both the human and the rat recombinant IIICS (120V) isoform.

[0095] Antibodies SW01 and SW02 display good performance in immunofluorescence analyses. FIG. 2A shows staining of human placenta, human tumours (A375, H460) and murine tumours (K1735, F9) by SW01 and SW02 in SIP format. Specifically, SW01 and SW02 show distinct staining of vascular and perivascular structures in these tissues/tumours. As negative controls (neg ctr) an anti-human von Willebrand factor antibody (anti huVWF) was used for the human placenta experiments and an anti-murine CD31 antibody (muCD31) was used for the tumor experiments.

[0096] Binding of antibody SW01 and SW02 to IIICS was further confirmed by Biacore analysis. The results are shown in FIG. 2B.

Immunofluorescence on Tumour Sections:

[0097] Cryostat sections (10 ?m) of tumors were fixed in ice-cold acetone, rehydrated with PBS and blocked with 20% foetal bovine serum in PBS.

[0098] The SW01 and SW02 anti-IIICS antibodies and the KSF anti-hen egg lysozyme antibodies (all in SIP format) were diluted in 3% BSA to a final concentration of 5 ?g/mL and then added to the tissue sections. Rabbit-a-Human IgE antibody (Dako) and rat-a-mouse-CD31 antibody (BD Biosciences) were used for co-staining of SIP antibody fusion proteins and endothelial cells from blood vessels, respectively. Anti-Rabbit-Alexa488 and anti-Rat-Alexa594 (Invitrogen) secondary antibodies were used for detection.

Immunofluorescence on Human Placenta:

[0099] Cryostat sections (10 ?m) of human placenta were fixed in ice-cold acetone, rehydrated with PBS and blocked with 20% foetal bovine serum in PBS.

[0100] The SW01 and SW02 anti-IIICS antibodies and the KSF anti-hen egg lysozyme antibody (all in SIP format) were biotinylated and diluted in 3% BSA to a final concentration of 5 ?g/mL and then added to the tissue. Rabbit-anti-Human Von Willebrand antibody (Dako) was used for staining of endothelial cells from blood vessels. Anti-Rabbit-Alexa594 and Streptavidin-Alexa488 (Invitrogen) secondary antibodies were used for detection.

Biacore Analysis:

[0101] Binding of antibodies SW01 and SW02 to IIICS was further determined by Biacore analysis. A CM5 chip was coated with 14(89V)15 (a recombinant polypeptide which includes domain 14, extra domain-89V of IIICS and domain 15 of fibronectin) to achieve a final coating density of 1400 resonance units (RU). The SW01 and SW02 antibodies produced in SIP format were diluted in 30 mM Na.sub.2HPO.sub.4, 20 mM NaH.sub.2PO.sub.4, 100 mM NaCl pH 7.4 to provide solutions with the following concentrations:

1) SIP(SW01): 500 nM, 250 nM, and 125 nM

2) SIP(SW02): 250 nM, 125 nM, and 62.5 nM

[0102] The flow rate for the Biacore analysis was set at 10 ?L/min. 10 ?L of each antibody sample were injected into the system. Analysis was performed in HBS-EP buffer. After each injection, the chip was regenerated by the injection of 5 ?L of 10 mM HCl.

Example 2Preparation and Characterisation of a New Antibody Against MMP3

[0103] The CH01 antibody was isolated in scFv configuration from phage display libraries which include the libraries described in PCT/EP2009/006487, in Weber et al. (PLoS One, 2014, 9 (6) doi: 10/1361) and in Silacci et al. (Protein Engineering Design & Selection, 2006, 19, 471-478) according to the screening technique described by Silacci et al. (Protein Engineering Design & Selection, 2006, 19, 471-478) using a recombinant version of the catalytic domain of human MMP3 (amino acids 100-273). The antigen was produced in a bacterial expression system and biotinylated according to the standard protocol.

[0104] Antibody CH01 displays good staining of neovascular structures as shown by Immunofluorescence analyses. FIG. 3 shows staining of human placenta samples, in which 10 ?m thick tissue samples were stained with the anti-human MMP3 antibody CH01 in scFv format. The anti-hen egg lysozyme antibody KSF in scFv format was used as an isotype-negative control for the staining. ScFv staining is shown in red, the vascular marker human Von Willebrand factor is shown in green and nucleii were stained in blue using DAPI. Unlike the negative control, the CH01 antibody stains neovascular structures in the placenta specimens.

[0105] The cross-reactivity of the CH01 antibody for the MMP3 of different species was analysed by determining binding of the CH01 antibody to the biotinylated catalytic domains of human, mouse and rat MMP3 in an ELISA. The results shown in FIG. 4A, indicate that CH01 recognize both mouse and human MMP3 and to a lesser extent rat MMP3.

[0106] Binding of antibody CH01 to the catalytic domain of human and mouse MMP3 was also confirmed by Biacore analysis. The results are shown in FIG. 4B.

Immunofluorescence on Human Placenta Samples:

[0107] Dual staining for MMP3 and von Willebrand factor (vWF, an endothelial marker) was performed on human placenta samples. 10 ?m thick frozen specimens were defrosted at room temperate and treated with ice-cold acetone, rehydrated in PBS and blocked with 3% BSA. Affinity-purified myc-tagged scFv antibodies (final concentration 5 mg/ml) were first incubated with the tissue sample, followed by the biotinylated monoclonal anti-myc 9E10 antibody (5 mg/ml) and the endothelial marker antibody. Bound scFvs were detected with Strepavidin Alexa 594 (Molecular Probes). The anti-vWF antibody (DAKO) was detected using goat anti-rabbit IgG Alexa 488. DAPI was used for nuclei staining. The anti-hen egg lysozyme antibody scFv(KSF) was used as an isotype-negative control for the staining.

Cross-Reactivity ELISA:

[0108] Streptawell High Bind strips (Roche) were coated with biotinylated Human, Mouse or Rat MMP3 catalytic domain at 100 nM. ScFv fragments were incubated for 1 hour, bound antibody was detected with the anti-Myc antibody 9E10 and an HRP-conjugated anti-Murine F.sub.c antibody (Sigma). The plate coating density was assessed by detecting the MMP3 catalytic domains using an HRP-conjugated anti-6?His antibody (Sigma). Colorimetric detection of antibody-antigen binding was performed using BM-Blue POD soluble substrate (Roche).

Biacore Analysis:

[0109] Purified CH01 in scFv format was injected over a CM5 chip coated with both human and mouse MMP3 catalytic domains. Response units were normalised to give a baseline value of zero. Samples were injected at a flow rate of 10 ?L/min in 50 mM Tris-HCl pH 7.4, 200 mM NaCl, 1 mM CaCl.sub.2.

Example 3Preparation and Characterisation of Four New Antibodies Against Periostin

[0110] The LG1, LG2, LG3 and 1E1 antibodies were isolated in scFv configuration from phage display libraries which include the libraries described in PCT/EP2009/006487, in Weber et al. (PLoS One, 2014, 9 (6) doi: 10/1361) and in Silacci et al. (Protein Engineering Design & Selection, 2006, 19, 471-478) according to the screening technique described by Silacci et al. (Protein Engineering Design & Selection, 2006, 19, 471-478). To generate antibodies against periostin, a recombinant version of the FAS domains (from 1 to 4; FIG. 5) was produced in a mammalian cell expression system. The antigen was biotinylated according to the standard protocol.

[0111] Binding of antibodies LG1, LG2 and LG3 (in scFv format) and 1E1 (in SIP format) to periostin was confirmed by Biacore analysis. The results are shown in FIGS. 6A and 6B.

Biacore Analysis:

[0112] Monomeric fractions of purified antibodies were analyzed by surface plasmon resonance (BIAcore, 3000 system). Recombinant Human Periostin was covalently coupled to the surface of the CM-3 sensor Chip. Thirty microliters of each sample were injected at the flow rate of 10 ?L/min. The regeneration of the chip was performed with 5 ?L of 10 mM HCl.

Example 4Preparation and Characterisation of a New Antibody Against Tenascin-W

[0113] The G10 antibody was isolated in scFv configuration from phage display libraries which include the libraries described in PCT/EP2009/006487, in Weber et al. (PLoS One, 2014, 9 (6) doi: 10/1361) and in Silacci et al. (Protein Engineering Design & Selection, 2006, 19, 471-478) according to the screening technique described by Silacci et al. (Protein Engineering Design & Selection, 2006, 19, 471-478). The G10 antibody was isolated by screening the libraries against a recombinant fragment corresponding to residues 262-534 (numbering including the leader sequence) of human tenascin-W. The recombinant fragment also contained an N-terminal Methionine and a C-terminal His6 tag. The sequence of this peptide is shown in SEQ ID NO: 65.

[0114] The binding of G10 to Tenascin-W was confirmed by Biacore analysis. The results are shown in FIG. 7.

Biacore Analysis:

[0115] A monomeric fraction of the purified G10 antibody was analyzed by surface plasmon resonance (BIAcore, 3000 system). A recombinant peptide consisting of amino acids 262-534 of tenascin-W was covalently coupled to the surface of the CM-5 sensor Chip. Twenty-five microliters of each sample were injected at the flow rate of 10 ?L/min. The regeneration of the chip was performed with 5 ?L of 10 mM glycine-HCl, pH 2.5 (GE Healthcare).

TABLE-US-00001 Sequencelisting AminoacidsequencesofantibodySW01specificfor theIICSisoformoffibronectin SEQIDNO:1(SW01-VH) EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSA ISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKNR YIFDYWGQGTLVTVSS SEQIDNO:2(SW01-VL) SELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGKN NRPSGIPDRFSGSSSGNTASLTITGAQAEDEADYYCNSSPKAPRPVVFGG GTKLTVLG SEQIDNO:3(SW01-VHCDR1) GFTFSSYAMS SEQIDNO:4(SW01-VHCDR2) AISGSGGSTYYADSVKG SEQIDNO:5(SW01-VHCDR3) NRYIFDY SEQIDNO:6(SW01-VLCDR1) QGDSLRSYYA SEQIDNO:7(SW01-VLCDR2) GKNNRPS SEQIDNO:8(SW01-VLCDR3) NSSPKAPRPVV AminoacidsequencesofantibodySW02specificfor theIIICSisoformoffibronectin SEQIDNO:9(SW02-VH) EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSA ISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKGR FLFDYWGQGTLVTVSS SEQIDNO:10(SW02-VL) SELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGKN NRPSGIPDRFSGSSSGNTASLTITGAQAEDEADYYCNSSPLYNPYVVFGG GTKLTVLG SEQIDNO:11(SW02-VHCDR1) GFTFSSYAMS SEQIDNO:12(SW02-VHCDR2) AISGSGGSTYYADSVKG SEQIDNO:13(SW02-VHCDR3) GRFLFDY SEQIDNO:14(SW02-VLCDR1) QGDSLRSYYAS SEQIDNO:15(SW02-VLCDR2) GKNNRPS SEQIDNO:16(SW02-VLCDR3) NSSPLYNPYVV AminoacidsequencesofantibodyCH01specificfor MMP3 SEQIDNO:17(CH01-VH) EVQLLESGGGLVQPGGSLRLSCAASGFTFSPYAMSWVRQAPGKGLEWVSA ITGQGGVTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKIS SFHFDYWGQGTLVTVSS SEQIDNO:18(CH01-VL) EIVLTQSPGTLSLSPGERATLSCRASQSVSSHHLAWYQQKPGQAPRLLI YDASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQPRGAPTTF GQGTKVEIK SEQIDNO:19(CH01-VHCDR1) GFTFSPYAMS SEQIDNO:20(CH01-VHCDR2) AITGQGGVTYYADSVKG SEQIDNO:21(CH01-VHCDR3) ISSFHFDY SEQIDNO:22(CH01-VLCDR1) RASQSVSSHHLA SEQIDNO:23(CH01-VLCDR2) DASSRAT SEQIDNO:24(CH01-VLCDR3) QQPRGAPTT AminoacidsequencesofantibodyLG1specificfor periostin SEQIDNO:25(LG1-VH) EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSA ISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKHT PSFDYWGQGTLVTVSS SEQIDNO:26(LG1-VL) SELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGK NNRPSGIPDRFSGSSSGNTASLTITGAQAEDEADYYCNSPYRPKKLVVFG GGTKLTVLG SEQIDNO:27(LG1-VHCDR1) GFTFSSYAMS SEQIDNO:28(LG1-VHCDR2) AISGSGGSTYYADSVKG SEQIDNO:29(LG1-VHCDR3) HTPSFDY SEQIDNO:30(LG1-VLCDR1) QGDSLRSYYAS SEQIDNO:31(LG1-VLCDR2) GKNNRPS SEQIDNO:32(LG1-VLCDR3) NSPYRPKKLVV AminoacidsequencesofantibodyLG2specificfor periostin SEQIDNO:33(LG2-VH) EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSA ISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKAR YPFDYWGQGTLVTVSS SEQIDNO:34(LG2-VL) SELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGKN NRPSGIPDRFSGSSSGNTASLTITGAQAEDEADYYCNSFGRALPSVVFGG GTKLTVLG SEQIDNO:35(LG2-VHCDR1) GFTFSSYAMS SEQIDNO:36(LG2-VHCDR2) AISGSGGSTYYADSVKG SEQIDNO:37(LG2-VHCDR3) ARYPFDY SEQIDNO:38(LG2-VLCDR1) QGDSLRSYYAS SEQIDNO:39(LG2-VLCDR2) GKNNRPS SEQIDNO:40(LG2-VLCDR3) NSFGRALPSVV AminoacidsequencesofantibodyLG3specificfor periostin SEQIDNO:41(LG3-VH) EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVS AISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKR ARLFDYWGQGTLVTVSS SEQIDNO:42(LG3-VL) EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIY GASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQGGSLPLTFG QGTKVEIK SEQIDNO:43(LG3-VHCDR1) GFTFSSYAMS SEQIDNO:44(LG3-VHCDR2) AISGSGGSTYYADSVKG SEQIDNO:45(LG3-VHCDR3) RARLFDY SEQIDNO:46(LG3-VLCDR1) RASQSVSSSYLA SEQIDNO:47(LG3-VLCDR2) GASSRAT SEQIDNO:48(LG3-VLCDR3) QQGGSLPLT Aminoacidsequencesofantibody1E1specificfor periostin SEQIDNO:49(1E1-VH) EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSA ISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKHE PYIGFDYVVGQGTLVTVSS SEQIDNO:50(1E1-VL) SELTQDPAVSVALGQTVRITCQGDSLRTFYASWYQQKPGQAPVLVIYGKN NRPSGIPDRFSGSSSGNTASLTITGAQAEDEADYYCNSSLYPRTPVVFGG GTKLTVLG SEQIDNO:51(1E1-VHCDR1) GFTFSSYAMS SEQIDNO:52(1E1-VHCDR2) AISGSGGSTYYADSVKG SEQIDNO:53(1E1-VHCDR3) HEPYIGFDY SEQIDNO:54(1E1-VLCDR1) QGDSLRTFYAS SEQIDNO:55(1E1-VLCDR2) GKNNRPS SEQIDNO:56(1E1-VLCDR3) NSSLYPRTPVV AminoacidsequencesofantibodyG10specificfor tenascinW SEQIDNO:57(G10-VH) EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSA ISGSGGSTYYADSVKGQFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKAN PWAFDYWGQGTLVTVSS SEQIDNO:58(G10-VL) SELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGKN NRPSGIPDRFSGSSSGNTASLTITGAQAEDEADYYCNSSGSQRSPVVFGG GTKLTVLG SEQIDNO:59(G10-VHCDR1) GFTFSSYAMS SEQIDNO:60(G10-VHCDR2) AISGSGGSTYYADSVKG SEQIDNO:61(G10-VHCDR3) ANPWAFDY SEQIDNO:62(G10-VLCDR1) QGDSLRSYYAS SEQIDNO:63(G10-VLCDR2) GKNNRPS SEQIDNO:64(G10-VLCDR3) NSSGSQRSPVV Aminoacidsequenceoftherecombinanttenascin-W peptideusedtoisolatetheG10antibody SEQIDNO:65 MVVTPQGLQLLKNTEDSLLVSWEPSSQVNHYLLSYYPLGKELSGKQIQVP KEQHSYEILGLLPGTKYIVTLRNVKNEVSSSPQHLLATTDLAVLGTAWVT DETENSLDVEWENPSTEVDYYKLRYGPMTGQEVAEVTVPKSSDPKSRYDI TGLHPGTEYKITVVPMRGELEGKPILLNGRTEIDSPINVVTDRVTEDTAT VSWDPVQAVIDKYVVRYTSADGDTKEMAVHKDESSTVLTGLKPGEAYKVY VWAERGNQGSKKADTNALTEIDSPHHHHHH