LIPASES, COMPOSITIONS, METHODS AND USES THEREOF

20230098388 · 2023-03-30

    Inventors

    Cpc classification

    International classification

    Abstract

    The present invention relates to a wild-type, non-engineered, microbial lipolytic enzyme with a higher specificity for short-chain fatty acids than for medium to long fatty acids, specially long fatty acids. This invention further relates to a process for preparing a food product, and to the use of the wild-type, non-engineered, microbial lipolytic enzyme.

    Claims

    1-15. (canceled)

    16. A method for preparing a food product, comprising adding to a raw material or intermediate product of the food product a lipase or host cell transformed to express a DNA sequence encoding a lipase, wherein the lipase is selected from: (i) lipases comprising the amino acid sequence of any one of SEQ ID NOs. 1-11, and (ii) lipases comprising an amino acid sequence having an identity to any one of SEQ ID NOs. 1-11 selected from at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, and at least 99%; wherein the DNA sequence encoding the lipase is selected from: (i) DNA sequences comprising the nucleotide sequence of any one of SEQ ID NOs. 12-23, and (ii) DNA sequences comprising a nucleotide sequence having an identity to any one of SEQ ID NOs. 12-23 selected from at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, and at least 99%.

    17. The method of claim 16, wherein the method comprises adding a host cell transformed to express the DNA sequence encoding the lipase, wherein the DNA sequence is selected from isolated DNA sequences, recombinant DNA sequences, and synthetic DNA sequences.

    18. The method of claim 16, wherein the method comprises adding a host cell transformed to express the DNA sequence encoding the lipase, wherein the DNA sequence further comprises a nucleotide sequence encoding a signal peptide.

    19. The method of claim 16, wherein the lipase has a higher specificity towards release of C.sub.4-fatty acids as compared to release of one or more of C.sub.10-fatty acids, C.sub.8-fatty acids, C.sub.6-fatty acids, C.sub.12-fatty acids, C.sub.18:2-fatty acids, C.sub.14-fatty acids, C.sub.18:0-fatty acids, C.sub.18:1-fatty acids, C.sub.8-fatty acids—C.sub.18:2-fatty acids, C.sub.10-fatty acids—C.sub.18:1-fatty acids, C.sub.12-fatty acids—C.sub.18:0-fatty acids, C.sub.14-fatty acids—C.sub.16:0-fatty acids, and C.sub.16-fatty acids—C.sub.18-fatty acids, when assessed in a dairy composition comprising milk fat.

    20. The method of claim 16, wherein the lipase has a higher specificity towards release of C.sub.4-fatty acids as compared to release of one or more of C.sub.10-fatty acids, C.sub.6-fatty acids, C.sub.8-fatty acids, C.sub.12-fatty acids, C.sub.14-fatty acids, C.sub.16-fatty acids, C.sub.18:1-fatty acids, C.sub.18:2-fatty acids, C.sub.18:3-fatty acids, and C.sub.16-C.sub.18-fatty acids, when assessed in a dairy composition comprising milk fat at a pH selected from a pH below 7, a pH of 6.6-6.8, a pH below 6, a pH of 3.8-5.6, a pH of 4.4-5.4, and a pH of 4.6-5.2.

    21. The method of claim 16, wherein the lipase has a higher specificity towards release of C.sub.4-fatty acids as compared to release of one or more of C.sub.10-fatty acids, C.sub.6-fatty acids, C.sub.8-fatty acids, C.sub.12-fatty acids, C.sub.14-fatty acids, C.sub.16-fatty acids, C.sub.18:1-fatty acids, C.sub.18:2-fatty acids, C.sub.18:3-fatty acids, and C.sub.16-C.sub.18-fatty acids, when assessed in a dairy composition comprising milk fat at a selected from a temperature below 20° C., a temperature below 15° C., a temperature below 10° C., and a temperature of 5-8° C.

    22. The method of claim 16, wherein the food product obtained by the method has one or more fatty acid profiles selected from: (a) comprising more C.sub.4-fatty acids than one or more other fatty acids selected from C.sub.6-fatty acids, C.sub.8-fatty acids, C10-fatty acids, C12-fatty acids, C14-fatty acids, C16-fatty acids, C18:1-fatty acids, C18:2-fatty acids and C18:3-fatty acids, and (b) comprising more C.sub.6-fatty acids than one or more other fatty acids selected from C.sub.8-fatty acids, C.sub.10-fatty acids, C.sub.12-fatty acids, C.sub.14-fatty acids, C.sub.16-fatty acids, C.sub.18:1-fatty acids, C.sub.18:2-fatty acids and C.sub.18:3-fatty acids.

    23. The method of claim 16, wherein the food product has one or more flavor profiles selected from reduced soapiness and increased butyric flavors, as compared to a food product made without the lipase and without the host cell transformed to express a a DNA sequence encoding the lipase.

    24. The method of claim 16, wherein the lipase is a microbial lipase selected from an isolated microbial lipase, a recombinant microbial lipase, and a synthetic microbial lipase.

    25. The method of claim 16, wherein the food product is a dairy product selected from a cheese, a processed cheese, a cheese-like product, an enzyme-modified cheese, a butter, a yogurt, a cream, and a seasoning.

    26. The method of claim 16, wherein the food product is a cheese selected from Feta cheese, Provolone cheese, Pecorino cheese, Parmesan cheese, Grana Padano cheese, Parmigiano Reggiano cheese, Romano cheese, Chester cheese, Danbo cheese, Manchego cheese, Saint Paulin cheese, Cheddar cheese, Monterey cheese, Colby cheese, Edam cheese, Gouda cheese, Muenster cheese, Swiss-type cheese, Gruyere cheese, Emmental cheese; Mozzarella cheese, Queso fresco cheese, Ricotta cheese, Cream cheese, Neufchatel cheese, Cottage cheese, Brie, Camembert, Gorgonzola and Danish blue cheese.

    27. The method of claim 16, wherein the food product is a non-dairy food product selected from a non-dairy cheese and a vegan cheese.

    28. A food product comprising a lipase, wherein the lipase is selected from: (i) lipases comprising the amino acid sequence of any one of SEQ ID NOs. 1-11, and (ii) lipases comprising an amino acid sequence having an identity to any one of SEQ ID NOs. 1-11 selected from at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, and at least 99%; wherein the food product has one or more fatty acid profiles selected from: (a) a fatty acid profile comprising more C.sub.4-fatty acids than one or more other fatty acids selected from C.sub.6-fatty acids, C.sub.8-fatty acids, C.sub.10-fatty acids, C.sub.12-fatty acids, C.sub.14-fatty acids, C.sub.16-fatty acids, C.sub.18:1-fatty acids, C.sub.18:2-fatty acids and C.sub.18:3-fatty acids, and (b) a fatty acid profile comprising more C.sub.6-fatty acids than one or more other fatty acids selected from C.sub.8-fatty acids, C.sub.10-fatty acids, C.sub.12-fatty acids, C.sub.14-fatty acids, C.sub.16-fatty acids, C.sub.18:1-fatty acids, C.sub.18:2-fatty acids and C.sub.18:3-fatty acids.

    29. The food product of claim 28, wherein the food product is a dairy product selected from a cheese, a processed cheese, a cheese-like product, an enzyme-modified cheese, a butter, a yogurt, a cream, and a seasoning.

    30. The food product of claim 28, wherein the food product is a cheese selected from Feta cheese, Provolone cheese, Pecorino cheese, Parmesan cheese, Grana Padano cheese, Parmigiano Reggiano cheese, Romano cheese, Chester cheese, Danbo cheese, Manchego cheese, Saint Paulin cheese, Cheddar cheese, Monterey cheese, Colby cheese, Edam cheese, Gouda cheese, Muenster cheese, Swiss-type cheese, Gruyere cheese, Emmental cheese; Mozzarella cheese, Queso fresco cheese, Ricotta cheese, Cream cheese, Neufchatel cheese, Cottage cheese, Brie, Camembert, Gorgonzola and Danish blue cheese.

    31. The food product of claim 28, wherein the food product is a non-dairy food product selected from a non-dairy cheese and a vegan cheese.

    32. An isolated lipase selected from: (i) lipases comprising the amino acid sequence of any one of SEQ ID NOs. 1-11, and (ii) lipases comprising an amino acid sequence having an identity to any one of SEQ ID NOs. 1-11 selected from at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, and at least 99%, wherein the lipase is expressed in Pichia pastoris and wherein the lipase has a higher specificity towards release of C.sub.4-fatty acids as compared to release of one or more of C.sub.10-fatty acids, C.sub.8-fatty acids, C.sub.6-fatty acids, C.sub.12-fatty acids, C.sub.18:2-fatty acids, C.sub.14-fatty acids, C.sub.18:0-fatty acids, C.sub.18:1-fatty acids, and C.sub.16-fatty acids, when assessed in a dairy composition comprising milk fat.

    33. An isolated nucleic acid molecule encoding a lipase and having a DNA sequence selected from: (i) DNA sequences comprising the nucleotide sequence of any one of SEQ ID NOs. 12-23, and (ii) DNA sequences comprising a nucleotide sequence having an identity to any one of SEQ ID NOs. 12-23 selected from at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, and at least 99%, wherein the lipase has a higher specificity towards release of C.sub.4-fatty acids as compared to release of one or more of C.sub.10-fatty acids, C.sub.8-fatty acids, C.sub.6-fatty acids, C.sub.12-fatty acids, C.sub.18:2-fatty acids, C.sub.14-fatty acids, C.sub.18:0-fatty acids, C.sub.18:1-fatty acids, and C.sub.16-fatty acids, when assessed in a dairy composition comprising milk fat.

    34. An isolated host cell engineered to express a lipase according to claim 32.

    35. An isolated host cell transformed with a nucleic acid molecule according to claim 33.

    Description

    DETAILED DESCRIPTION

    [0099] The present invention relates to a non-animal, wild-type derived from a microorganism lipase fulfilling the vegetarian and/or kosher requirements while simultaneously presenting a specificity and preference for the cleavage of short chain fatty acids, preferably presenting a higher specificity towards C.sub.4-fatty acids and/or C.sub.6-fatty acids rather other kinds of fatty acids or presenting a higher specificity towards C.sub.4-fatty acids and/or C.sub.6-fatty acids than a commercial microbial lipase.

    [0100] The purpose of this invention is to provide a microbial wild-type lipase with a higher specificity towards the release of C.sub.4-fatty acids and/or C.sub.6-fatty acids, from a dairy composition comprising milk fat and/or other fat, if compared with the release of medium and/or long chain fatty acids, preferably if compared with the release of long-chain fatty acids, or a higher specificity towards the release of C.sub.4-fatty acids and/or C.sub.6-fatty acids, from a dairy composition comprising milk fat and/or other fat, if compared to the release of C.sub.4-fatty acids and/or C.sub.6-fatty acids of a commercial microbial lipase, without the need to generate any mutation (addition, deletion and/or substitution) in the lipase sequence. Thus, this invention relates to an improved (or alternative) microbial wild-type lipase with specificity towards short-chain fatty acids versus the prior microbial lipases. Therefore, the lipases herein disclosed may be obtained from microorganisms that produce the lipase naturally. In this case, said lipase is a wild-type lipase.

    [0101] The microbial lipases wherein disclosed (SEQ ID NO:1-11) may be used to replace the microbial lipases currently available on the market.

    EXAMPLES

    Example 1

    Cloning and Expression

    [0102] A nucleotide sequence encoding for SEQ ID NO: 1 or SEQ ID NO: 2 or SEQ ID NO: 3 or SEQ ID NO: 4 or SEQ ID NO: 5 or SEQ ID NO: 6 or SEQ ID NO: 7 or SEQ ID NO: 8 or SEQ ID NO: 9 or SEQ ID NO: 10 or SEQ ID NO: 11 was integrated into a targeted locus of an expression host such as Pichia pastoris. Codon-optimized genes encoding for SEQ ID NO: 1 or SEQ ID NO: 2 or SEQ ID NO: 3 or SEQ ID NO: 4 or SEQ ID NO: 5 or SEQ ID NO: 6 or SEQ ID NO: 7 or SEQ ID NO: 8 or SEQ ID NO: 9 or SEQ ID NO: 10 or SEQ ID NO: 11 may or not be used. The nucleotide sequence encoding for SEQ ID NO: 1 is, for example, SEQ ID NO: 12 or SEQ ID NO: 23. The nucleotide sequence encoding for SEQ ID NO: 2 or SEQ ID NO: 3 or SEQ ID NO: 4 or SEQ ID NO: 5 or SEQ ID NO: 6 or SEQ ID NO: 7 or SEQ ID NO: 8 or SEQ ID NO: 9 or SEQ ID NO: 10 or SEQ ID NO: 11 can be, for example, SEQ ID NO: 13 or SEQ ID NO: 14 or SEQ ID NO: 15 or SEQ ID NO: 16 or SEQ ID NO: 17 or SEQ ID NO: 18 or SEQ ID NO: 19 or SEQ ID NO: 20, or SEQ ID NO: 21 or SEQ ID NO: 22, respectively.

    [0103] In an embodiment Pichia pastoris may be replaced by Saccharomyces spp., Saccharomyces cerevisiae, Schizosaccharomyces spp., Candida spp., Candida cylindracea, Kluyveromyces spp., Fusarium spp., Fusarium oxysporium, Aspergillus spp., Aspergillus oryzae or Aspergillus niger, Trichoderma spp., Escherichia coli or Bacillus spp., Bacillus subtilis, Bacillus licheniformis, Bacillus lentus, Bacillus brevis, Bacillus stearothermophilus, Bacillus alkalophilus, Bacillus amyloliquefaciens, Bacillus coagulans, Bacillus circulans, Bacillus lautus, Bacillus megaterium, Bacillus thuringiensis, Streptomyces spp., Streptomyces lividans or Streptomyces murinus, Corynebacterium spp., preferably Aspergillus oryzae, Aspergillus niger, or Bacillus subtilis.

    [0104] A nucleotide sequence encoding for SEQ ID NO: 1 or SEQ ID NO: 2 or SEQ ID NO: 3 or SEQ ID NO: 4 or SEQ ID NO: 5 or SEQ ID NO: 6 or SEQ ID NO: 7 or SEQ ID NO: 8 or SEQ ID NO: 9 or SEQ ID NO: 10 or SEQ ID NO: 11 may also be cloned into a conventional cloning and expression vector. Codon-optimized genes encoding for SEQ ID NO: 1 or SEQ ID NO: 2 or SEQ ID NO: 3 or SEQ ID NO: 4 or SEQ ID NO: 5 or SEQ ID NO: 6 or SEQ ID NO: 7 or SEQ ID NO: 8 or SEQ ID NO: 9 or SEQ ID NO: 10 or SEQ ID NO: 11 may or not be used. The nucleotide sequence encoding for SEQ ID NO: 1 may be, for example, SEQ ID NO: 12 or SEQ ID NO: 23. The nucleotide sequence encoding for SEQ ID NO: 2 or SEQ ID NO: 3 or SEQ ID NO: 4 or SEQ ID NO: 5 or SEQ ID NO: 6 or SEQ ID NO: 7 or SEQ ID NO: 8 or SEQ ID NO: 9 or SEQ ID NO: 10 or SEQ ID NO: 11 can be, for example, SEQ ID NO: 13 or SEQ ID NO: 14 or SEQ ID NO: 15 or SEQ ID NO: 16 or SEQ ID NO: 17 or SEQ ID NO: 18 or SEQ ID NO: 19 or SEQ ID NO: 20, or SEQ ID NO: 21 or SEQ ID NO: 22, respectively.

    [0105] The recombinant cloning and expression vector may be further introduced in a host cell, such as a recombinant host cell, using standard transformation or transfection protocols known to the person skilled in the art and explained in literature (for example, in J. Sambrook, E. F. Fritsch, and T. Maniatis, 1989, Molecular Cloning: A Laboratory manual, 2.sup.nd edition, books 1-3, Cold Spring Harbor Laboratory Press).

    [0106] The microbial lipases (SEQ ID NO:1-11) herein disclosed were independently expressed as follows. Pichia pastoris was used as a host for lipase expression. Pichia pastoris was grown on YPD agar plates (Invitrogen) under selective conditions (100 μg/mL Zeocin) at 30° C. for 16 h. Seed fermentation was performed by inoculating 3 mL YPD liquid medium (Invitrogen) including 100 μg/mL Zeocin with a single colony from the respective YPD agar plates, followed by incubation at 30° C. and 250 rpm agitation for 16 h. Main fermentation was performed in 4 mL total volume by diluting seed fermentations with BMGY medium (Invitrogen) including 100 μg/mL Zeocin to an OD.sub.600 of 0.2, followed by incubation at 30° C. and 225 rpm agitation for 3 days in 24-well culture plates. Main fermentation samples were centrifuged to precipitate expression host cells and the supernatant was sterile filtered at 0.2 μm. The filtrate was used directly for lipase enzymatic activity characterization without further treatment. The activity was determined in tributyrin/agarose emulsion, for example as described below for Example 2 or by IDF method. In particular, the IDF method was used for dosing in Examples 3-6.

    Example 2

    Enzymatic Activity on Triacylglycerols (TAG) Substrates

    [0107] The enzymatic activity of each microbial lipase herein disclosed (SEQ ID NO:1-11) towards short chain fatty acids (C.sub.4, substrate tributyrin), as well as long chain fatty acids (C.sub.16 and C.sub.18, substrate olive oil), in 96-well plate assays, was performed as follows below. The same procedure (of determining the enzymatic activity towards short chain fatty acids (C.sub.4, substrate tributyrin)) and long chain fatty acids (C.sub.16 and C.sub.18, substrate olive oil), in 96-well plate assays) was also conducted for a commercial microbial lipase from Rhizomucour miehei (Palatase®, Palatase® 20000 L, 20,000 U/g available from Novozymes A/S). The commercial microbial lipase from Rhizomucour miehei is herein labelled as commercial microbial lipase A.

    [0108] Enzymatic activity for short chain fatty acids in plate: a tributyrin/agarose emulsion was generated by dissolving 1.4% low-melting agarose in 250 mM sodium acetate buffer pH 5.25 including 40 mM CaCl.sub.2, addition of 1% (v/v) tributyrin to the solubilized agarose at 60° C., and subsequent emulsification for 2 min using an IKA T25 Ultra-Turrax emulsifier at speed 13.5. A total volume of 50 μL emulsion was transferred to each well of a transparent 96-well assay plate and allowed to solidify at room temperature. Lipase reaction was started by adding 20 μL enzyme on top of the emulsion layer, in particular wherein 20 μL enzyme correspond to 20 μL of filtrate obtained from Example 1. Clearance of turbidity of the emulsion by enzymatic hydrolysis of substrate tributyrin was followed by measuring absorbance at 600 nm in a plate reader. Each assay was calibrated with various dilutions of commercial microbial lipase A with known enzymatic activity.

    [0109] Enzymatic activity for long chain fatty acids in plate: an olive oil/agarose emulsion was generated by dissolving 1.4% low-melting agarose in 250 mM sodium acetate buffer pH 5.25 including 40 mM CaCl.sub.2, addition of 2.5% (v/v) olive oil and 0.001% rhodamine B (w/v) to the solubilized agarose at 60° C., and subsequent emulsification for 2 min using an IKA T25 Ultra-Turrax emulsifier at speed 13.5. A total volume of 150 μL emulsion was transferred to each well of a non-transparent black 96-well assay plate and allowed to solidify at room temperature. Lipase reaction was started by adding 30 μL enzyme on top of the emulsion layer, in particular wherein 30 μL enzyme correspond to 30 μL of filtrate obtained from Example 1. Binding of rhodamine B to long chain fatty acids released by enzymatic hydrolysis of substrate olive oil was followed by measuring fluorescence at 355 nm excitation and 590 nm emission in a plate reader. Each assay was calibrated with various dilutions of commercial microbial lipase A with known enzymatic activity.

    [0110] Short chain fatty acid specificity C.sub.4/C.sub.16-C.sub.18 was determined, for each microbial lipase herein disclosed, by calculating the ratio of hydrolytic activities on substrate tributyrin (C.sub.4) and olive oil (C.sub.16-C.sub.18).

    [0111] The ratio C.sub.4/C.sub.16-C.sub.18 of each lipase (SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10 and/or SEQ ID NO: 11) is normalized for the ratio C.sub.4/C.sub.16-C.sub.18 of the microbial commercial lipase (A) used. Table 1 shows that the microbial lipases herein disclosed (SEQ ID NO: 1-11) have a higher specificity for the short chain fatty acid butyric acid (C.sub.4) as compared to commercial microbial lipase A, in particular the microbial lipases of herein disclosed (SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10 and/or SEQ ID NO: 11) are 2-770 times more C.sub.4-fatty acid specific than the commercial microbial lipase A.

    TABLE-US-00001 TABLE 1 Short chain fatty acid specificity (C.sub.4/C.sub.16-C.sub.18) determined with TAG substrates tributyrin and olive oil of lipases with SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 and commercial microbial lipase A and respective improvement factor (IF4). IF4 = (C.sub.4/C.sub.16-C.sub.18).sub.A or SEQ ID NO: 1-11/ C.sub.4/C.sub.16-C.sub.18 (C.sub.4/C.sub.16-C.sub.18).sub.A A 1.2 1.0 1 101.0 83.3 2 5.0 4.1 3 770.5 635.3 4 7.4 6.1 5 17.2 14.2 6 2.3 1.9 7 8.0 6.6 8 14.0 11.6 9 14.5 11.9 10 6.1 5.0 11 2.4 2.0

    Example 3

    Enzymatic Activity in Cream

    [0112] The lipases herein disclosed (SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10 or SEQ ID NO: 11), were additionally analyzed for their enzymatic activity towards milk fat and the released free fatty acids were quantified (Table 2). The same procedure was conducted for a commercial microbial lipase (commercial microbial lipase A) from Rhizomucour miehei (Palatase®) available from Novozymes A/S.

    [0113] Lipase activity on milk fat in cream was carried out as follows. Fresh whipping cream (38% fat) and equal amounts of water were mixed by stirring for 30 min. Enzymatic reaction was started by adding 20 μL lipase (from a 4000 LFU/L stock solution) to 1 mL cream/water mix and proceeded at 37° C. for 20 hours, in particular this dosage of enzyme applies both to the commercial microbial lipase A and to lipases of SEQ ID NO: 1-11. Subsequently, free fatty acids were extracted from the reaction and quantified by gas chromatography-mass spectrometry (GC-MS), using standard protocols in the art for quantifying fatty acids. Alternatively the disclosure of Jong C., de and Badings H. T. in J. High Resolution Chromatography. 13, 84-98 (1990) can also be used.

    [0114] Obtained fatty acid quantities of lipase reactions were corrected for the respective quantities determined for a similar cream sample without added lipase.

    [0115] Subsequently, specificity for butyric acid (C.sub.4:0), and caproic acid (C.sub.6:0), caprylic acid (C.sub.8:0) and capric acid (C.sub.10:0) and the respective improvement factors compared to commercial microbial lipase A were determined based on the obtained data from lipolysis in cream (Table 2). Short chain fatty acid specificities (C.sub.4/C.sub.16-C.sub.18; C.sub.6/C.sub.16-C.sub.18) were obtained by calculating the ratio of the molar fraction of C.sub.4:0 or C.sub.6:0 and the sum of molar fractions of C.sub.16:0, C.sub.18:0, C.sub.18:1 and C.sub.18:2. Improvement factors IF4 and IF6 were calculated by dividing specificity values for C.sub.4:0 and C.sub.6:0 by the respective values of commercial lipase A. Medium chain fatty acid specificities (C.sub.8/C.sub.16-C.sub.18; C.sub.10/C.sub.16-C.sub.18) were obtained by calculating the ratio of the molar fraction of C.sub.8:0 or C.sub.10:0 and the sum of molar fractions of C.sub.16:0, C.sub.18:0, C.sub.18:1 and C.sub.18:2.

    [0116] Improvement factors IF8 and IF10 were calculated by dividing specificity values for C.sub.8:0 and C.sub.10:0, respectively, by the respective values of commercial lipase A.

    [0117] The ratio C.sub.4/C.sub.16-C.sub.18 of each lipolytic lipase is determined by diving C.sub.4:0 by the sum of C.sub.16:0, C.sub.18:0, C.sub.18:1 and C.sub.18:2 of the respective lipolytic lipase. The ratio C.sub.4/C.sub.16-C.sub.18 is indicative of the specificity of the respective lipase for the release of butyric acid (C.sub.4) from milk fat, relative to the release of fatty acids with chain lengths C.sub.16-C.sub.18.

    [0118] The ratio C.sub.6/C.sub.16-C.sub.18 of each lipolytic lipase is determined by diving C.sub.6:0 by the sum of C.sub.16:0, C.sub.18:0, C.sub.18:1 and C.sub.18:2 of the respective lipolytic lipase. The ratio C.sub.6/C.sub.16-C.sub.18 is indicative of the specificity of the respective lipase for the release of caproic acid (C.sub.6) from milk fat, relative to the release of fatty acids with chain lengths C.sub.16-C.sub.18.

    [0119] The ratio C.sub.8/C.sub.16-C.sub.18 of each lipolytic lipase is determined by diving C.sub.8:0 by the sum of C.sub.16:0, C.sub.18:0, C.sub.18:1 and C.sub.18:2 of the respective lipolytic lipase. The ratio C.sub.8/C.sub.16-C.sub.18 is indicative of the specificity of the respective lipase for the release of caproic acid (C.sub.8) from milk fat, relative to the release of fatty acids with chain lengths C.sub.16-C.sub.18.

    [0120] The ratio C.sub.10/C.sub.16-C.sub.18 of each lipolytic lipase is determined by diving C.sub.10:0 by the sum of C.sub.16:0, C.sub.18:0, C.sub.18:1 and C.sub.18:2 of the respective lipolytic lipase. The ratio C.sub.10/C.sub.16-C.sub.18 is indicative of the specificity of the respective lipase for the release of caproic acid (C.sub.10) from milk fat, relative to the release of fatty acids with chain lengths C.sub.16-C.sub.18.

    TABLE-US-00002 TABLE 2 Molar fractions of fatty acids released in cream by commercial microbial lipase A and SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10 and SEQ ID NO: 11. C.sub.4:0 C.sub.6:0 C.sub.8:0 C.sub.10:0 C.sub.12:0 C.sub.14:0 C.sub.16:0 C.sub.18:0 C.sub.18:1 C.sub.18:2 A 1.2 0.5 0.9 1.2 2.2 10.3 41.7 21.4 19.5 1.1 1 82.5 5.4 1.3 1.2 0.5 1.3 3.1 1.7 2.9 0.1 2 15.3 2.6 5.5 7.8 3.2 3.9 21.4 8.8 31.5 0.0 3 87.6 2.2 1.0 0.3 0.6 1.8 3.3 1.5 1.5 0.1 4 15.6 4.2 4.3 0.0 4.2 3.2 19.6 17.3 18.6 13.0 5 11.0 8.7 2.8 0.9 2.8 9.8 32.3 13.8 15.7 2.3 6 3.1 4.7 5.8 1.8 5.8 4.6 21.7 17.3 0.0 6.3 7 8.0 1.6 0.6 1.6 2.1 9.4 39.1 14.6 21.1 1.8 8 17.5 0.0 2.3 3.8 3.6 4.3 19.9 14.3 32.8 1.4 9 31.3 4.1 1.6 0.6 3.5 16.1 28.8 3.8 10.1 0.0 10 18.0 24.2 9.5 7.5 3.6 6.9 8.0 6.3 14.2 1.8 11 22.4 8.5 9.8 12.9 4.3 4.3 5.8 3.5 27.4 1.1

    TABLE-US-00003 TABLE 3 Short chain and medium chain fatty acid specificities (C.sub.4/ C.sub.16-C.sub.18, C.sub.6/C.sub.16-C.sub.18, C.sub.8/C.sub.16-C.sub.18, C.sub.10/C.sub.16-C.sub.18) and improvement factors (IF4, IF6, IF8, IF10) in cream by commercial microbial lipase A and SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10 and SEQ ID NO: 11. C.sub.4/ C.sub.6/ C.sub.8/ C.sub.10/ C.sub.16- C.sub.16- C.sub.16- C.sub.16- C.sub.18 C.sub.18 C.sub.18 C.sub.18 IF4 IF6 IF8 IF10 A 0.014 0.006 0.010 0.014 1.0 1.0 1.0 1.0 1 10.645 0.697 0.165 0.159 744.1 113.1 16.1 11.0 2 0.249 0.043 0.063 0.086 17.4 6.9 6.2 5.9 3 13.600 0.334 0.155 0.053 950.7 54.2 15.2 3.7 4 0.227 0.062 0.062 0.000 15.9 10.0 6.1 0.0 5 0.172 0.136 0.043 0.015 12.0 22.0 4.2 1.0 6 0.711 0.103 0.129 0.040 49.7 16.7 12.6 2.8 7 0.105 0.021 0.008 0.021 7.3 3.4 0.8 1.4 8 0.255 0.000 0.033 0.056 17.9 0.1 3.2 3.9 9 0.733 0096 0.039 0.015 51.2 15.6 3.8 1.0 10 0.594 0.797 0.314 0.247 41.5 129.2 30.7 17.0 11 0.595 0.226 0.261 0.342 41.6 26.6 25.5 23.7

    [0121] All the microbial lipolytic enzymes herein disclosed (SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10 and/or SEQ ID NO: 11) show an IF4 higher than 1, in cream, meaning they have a higher specificity for the short chain fatty acid butyric acid (C.sub.4:0) compared to commercial lipase A (Table 3) and can, therefore, be successfully used in a process for producing a food product wherein the presence of short chain fatty acid butyric acid (C.sub.4:0) is needed and desired, such as for reducing soapiness and increase in butyric flavors in a food product.

    [0122] Microbial lipolytic enzymes with SEQ ID NO: 1-7 and SEQ ID NO: 9-11 show an IF6 higher, than 1 in cream, meaning they have a higher specificity for the short chain fatty acid caproic acid (C.sub.6:0) compared to commercial lipase A.

    [0123] Microbial lipolytic enzymes with SEQ ID NO: 1-6 and SEQ ID NO: 8-11 show an IF8 higher, than 1 in cream, meaning they have a higher specificity for the medium chain fatty acid caprylic acid (C.sub.8:0) compared to commercial lipase A.

    [0124] Microbial lipolytic enzymes with SEQ ID NO: 1-3, SEQ ID NO: 6-8 and SEQ ID NO: 10-11 show an IF10 higher, than 1 in cream, meaning they have a higher specificity for the medium chain fatty acid capric acid (C.sub.10:0) compared to commercial lipase A.

    [0125] Microbial lipolytic enzyme with SEQ ID NO: 1 has a higher specificity for C.sub.4:0 than for any other fatty acid, in cream. The same applies for microbial lipolytic enzymes having SEQ ID NO: 3 or SEQ ID NO: 9 (Table 2).

    Example 4

    Enzymatic Activity in Cheese

    [0126] SEQ ID NO: 1 was further tested in cheese, in particular in Feta cheese and in Provolone cheese (Table 4). Example 4 was carried out with an identical dosage of enzyme (commercial microbial lipase A and SEQ ID NO: 1), in particular with a dosage of about 1.7 LFU/L of enzyme per liter of milk was used for the production of Feta cheese and between 5-10× for the Provolone cheese. The dosage was determined by the IDF method.

    [0127] Microbial lipase SEQ ID NO: 1 was added during the cheese making process. The cheese making process of, for example Feta cheese or Provolone cheese, is well known in the art and to the skilled person. Subsequently, free fatty acids were extracted from cheeses after 1 month of ripening and quantified by GC-MS or as disclosed in Example 3. Obtained fatty acid quantities of lipase reactions were corrected for the respective quantities determined for a similar cheese without added lipase. Short chain fatty acid specificities were obtained by calculating the ratio of the molar fraction of C.sub.4:0 or C.sub.6:0 and the sum of molar fractions of C.sub.16:0, C.sub.18:0, C.sub.18:1 and C.sub.18:2. Improvement factors IF4 and IF6 were calculated by dividing specificity values for C.sub.4:0 and C.sub.6:0 by the respective values of commercial lipase A.

    TABLE-US-00004 TABLE 4 Molar fractions of fatty acids released in Feta cheese and Provolone cheese by commercial microbial lipase A and SEQ ID NO: 1, after 1-month of ripening, as well as short chain fatty acid specificities (C.sub.4/C.sub.16-C.sub.18 and C.sub.6/C.sub.16-C.sub.18) and improvement factors (IF4 and IF6). C.sub.4/ C.sub.6/ C.sub.16- C.sub.16- C.sub.4:0 C.sub.6:0 C.sub.8:0 C.sub.10:0 C.sub.12:0 C.sub.14:0 C.sub.16:0 C.sub.18:0 C.sub.18:1 C.sub.18:2 C.sub.18 C.sub.18 IF4 IF6 Feta cheese A 2.0 0.8 2.3 4.6 6.2 14.6 35.2 9.4 22.5 2.5 0.029 0.012 1.0 1.0 1 50.3 5.5 0.0 3.7 6.3 5.5 12.3 0.0 11.2 0.0 2.135 0.231 74.5 19.9 Provolone cheese A 8.7 2.1 2.2 3.6 4.9 11.6 28.6 7.0 27.2 4.0 0.130 0.032 1.0 1.0 1 82.8 3.4 1.4 1.1 1.0 0.9 3.1 1.4 2.1 0.7 11.402 0.468 87.7 14.8

    [0128] SEQ ID NO: 1 has a higher specificity for C.sub.4:0-fatty acids than commercial microbial lipase A, in Feta cheese and in Provolone cheese, and a higher specificity for C.sub.4:0-fatty acids than for any other fatty acid, both Feta cheese and Provolone cheese, which is in line with the results obtained in cream (Example 3). Further, SEQ ID NO: 1 also has a higher specificity for C.sub.6:0-fatty acids than commercial microbial lipase A, in Feta cheese and in Provolone cheese, which is also in line with the results obtained in cream (Example 3).

    [0129] SEQ ID NO: 1 also shows a lower specificity for medium to long chain fatty acids such as C.sub.8:0, C.sub.10:0, C.sub.14:0, C.sub.16:0, C.sub.18:0, C.sub.18:1 or C.sub.18:2 fatty acids when compared to commercial microbial lipase A in Feta cheese. Furthermore, SEQ ID NO: 1 also shows a lower specificity for medium to long chain fatty acids such as C.sub.8:0, C.sub.10:0, C.sub.12:0, C.sub.14:0, C.sub.16:0, C.sub.18:0, C.sub.18:1 or C.sub.18:2 fatty acids when compared to commercial microbial lipase A in Provolone cheese. These results are in line with the results obtained in cream (Example 3). Thus, a cheese produced using a microbial lipase comprising SEQ ID NO: 1 or wherein the microbial lipase is microbial lipase of SEQ ID NO: 1 is less soapy and more butyric than a cheese produced with a known microbial lipase. Identical results are expected for SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10 and/or SEQ ID NO: 11.

    [0130] Identical results are also expected for other types of cheese, such as Pecorino, Parmesan, Grana Padano, Parmigiano Reggiano, Romano, Chester, Danbo, Manchego, Saint Paulin, Cheddar, Monterey, Colby, Edam, Gouda, Muenster, Swiss type, Gruyere, Emmental; pasta filata cheeses such as Mozzarella, and Queso fresco cheese; fresh cheese such as Ricotta, Cream cheese, Neufchatel or Cottage cheese; cream cheese, white mold cheese such as Brie and Camembert cheese, blue mold cheese such as Gorgonzola and Danish blue cheese; processed cheese, cheese-like product, or an enzyme-modified cheese.

    [0131] The microbial lipases herein disclosed are responsible for an increase in the C.sub.4-fatty acid specificity in comparison with the prior art microbial lipases, thus leading to a reduced soapiness of cheese and an increase in the butyric flavor of cheese.

    Example 5

    Sensorial Evaluation

    [0132] A sensorial evaluation of cheese, in particular in Feta cheese aged 3-months, was also performed by rating the taste according to sensational parameters butyric and soapy on a scale from 1 (none) to 6 (intense). The Feta cheese was produced using identical conditions using a commercial A or SEQ ID NO: 1 or SEQ ID NO: 3 or SEQ ID NO: 5. The amount or dosage of enzyme (commercial microbial lipase A, SEQ ID NO: 1 or SEQ ID NO: 3 or SEQ ID NO: 5) used was 1.7 LFU/L of milk determined by the IDF method (Table 5).

    TABLE-US-00005 TABLE 5 Sensorial evaluation carried out with Feta cheese aged 3-months using of commercial microbial lipase A, SEQ ID NO: 1, SEQ ID NO: 3 and SEQ ID NO: 5. Feta cheese aged 3-months Butyric Soapy A 3 5 1 4 1 3 4 1 5 4 3

    [0133] Table 5 shows a reduction of soapiness in Feta cheese, aged 3-months when SEQ ID NO: 1 or 3 or 5 is used when compared with commercial lipase A, while simultaneously an increase in the butyric flavor is observed for the same samples.

    Example 6

    Enzymatic Activity in Cheese

    [0134] SEQ ID NO: 1, 2, 3, 6, 8, 10 and 11 were further tested in cheese, in particular in Feta cheese. Example 6 was carried out with an identical dosage of enzyme (the commercial microbial lipase A and SEQ ID NO: 1, 2, 3, 6, 8, 10 and 11), in particular the a dosage of enzyme was of about 2.3 LFU/L of milk, determined by the IDF method, for the production of Feta cheese.

    [0135] Microbial lipases SEQ ID NO: 1, 2, 3, 6, 8, 10 and 11 were individually added during the cheese making process. Subsequently, free fatty acids were extracted from cheeses after 1-month (Table 6) and 2-months (Table 8) of ripening and quantified by GC-MS or as disclosed in Example 3. Obtained fatty acid quantities of lipase reactions were corrected for the respective quantities determined for a similar cheese without added lipase. Short- and medium-chain fatty acid specificities were obtained by calculating the ratio of the molar fraction of C.sub.4:0, C.sub.6:0, C.sub.8:0 or C.sub.1.0:0 and the sum of molar fractions of C.sub.16:0, C.sub.16:1, C.sub.18:0, C.sub.18:1, C.sub.18:2 and C.sub.18:3 (Tables 7 and 9). Improvement factors IF4, IF6, IF8 and IF10 were calculated by dividing specificity values for C.sub.4:0, C.sub.6:0 C.sub.8:0 or C.sub.10:0 by the respective values of commercial lipase A (Tables 7 and 9).

    TABLE-US-00006 TABLE 6 Molar fractions of fatty acids released in Feta cheese by commercial microbial lipase A and SEQ ID NO: 1, 2, 3, 6, 10 and 11, after 1-monthh of ripening. All lipases were dosage at 2.3 LFU/L. C.sub.4:0 C.sub.6:0 C.sub.8:0 C.sub.10:0 C.sub.12:0 C.sub.14:0 C.sub.16:0 C.sub.16:1 C.sub.18:0 C.sub.18:1 C.sub.18:2 C.sub.18:3 A 4.3 3.1 8.5 15.6 12.7 15.4 24.8 1.5 4.7 8.2 0.8 0.4 1 84.2 3.8 2.1 2.3 1.7 1.4 2.2 0.2 0.9 0.9 0.2 0.0 2 22.8 17.6 9.1 9.6 3.9 5.7 15.4 0.8 5.2 8.7 0.9 0.3 3 88.0 6.7 1.5 0.9 1.9 0.7 0.0 0.3 0.0 0.0 0.0 0.0 6 5.2 8.7 15.8 17.7 9.9 10.3 15.1 1.2 5.4 9.1 1.1 0.4 10 15.9 26.7 18.2 14.6 5.4 5.4 5.7 0.8 1.6 5.0 0.5 0.2 11 24.9 9.0 13.2 19.6 5.8 4.9 6.5 1.2 1.1 12.1 1.3 0.5

    TABLE-US-00007 TABLE 7 Short- and medium-chain fatty acid specificities (C.sub.4/C.sub.16- C.sub.18, C.sub.6/C.sub.16-C.sub.18, C.sub.8/C.sub.16-C.sub.18, C.sub.10/C.sub.16-C.sub.18) and improvement factors (IF4, IF6, IF8, IF10) in Feta cheese by commercial microbial lipase A and SEQ ID NO: 1, 2, 3, 6, 10 and 11, after 1-monthh of ripening. All lipases were dosage at 2.3 LFU/L. C.sub.4/ C.sub.6/ C.sub.8/ C.sub.10/ C.sub.16- C.sub.16- C.sub.16- C.sub.16- C.sub.18 C.sub.18 C.sub.18 C.sub.18 IF4 IF6 IF8 IF10 A 0.107 0.076 0.211 0.386 1.0 1.0 1.0 1.0 1 18.733 0.837 0.478 0.511 175.7 11.1 2.3 1.3 2 0.730 0.564 0.291 0.307 6.8 7.5 1.4 0.8 3 291.602 22.318 4.936 2.953 2734.9 294.8 23.4 7.7 6 0.160 0.270 0.489 0.546 1.5 3.6 2.3 1.4 10 1.158 1.943 1.327 1.060 10.9 25.7 6.3 2.7 11 1.097 0.397 0.583 0.864 10.3 5.2 2.8 2.2

    [0136] All the tested microbial lipolytic enzymes show an IF4 higher than 1, in Feta cheese, after 1-month of ripening. Thus, the tested enzymes have a higher specificity for the short chain fatty acid butyric acid (C.sub.4:0) compared to commercial lipase A (Table 7) and can, therefore, be successfully used in a process for producing a food product wherein the presence of short chain fatty acid butyric acid (C.sub.4:0) is needed and desired, such as for reducing soapiness and increase in butyric flavors in a food product. This observation, of an IF higher than 1 for the tested lipases, is in line with the results of Example 3, where data was obtained in cream. Further, specifically for SEQ ID NO: 1, this observation is also in line with the results of Example 4.

    [0137] Further, these enzymes show an IF6, IF8 and IF10 higher than 1, in Feta cheese, after 1-month of ripening, meaning they have a higher specificity for the short chain fatty acid caproic acid (C.sub.6:0) and for medium chain fatty acid caprylic acid (C.sub.8:0) and capric acid (C.sub.10:0) compared to commercial lipase A, with the exception of SEQ ID NO: 2 which has a IF10 below 1. The results obtained for these sequences (SEQ ID NO: 1, 2, 3, 6, 10 and 11) and their specificity for C.sub.6:0-fatty acids, C.sub.8:0-fatty acids and C.sub.10:0-fatty acids are essentially in line with the results obtained in cream (Example 3).

    [0138] In conclusion, the results obtained in cheese, after 1-month of ripening (Example 4 and 6) are in line with the results obtained in cream (Example 3), showing that the results obtained in cream can be used to plausibly extrapolate the behavior of the non-tested sequences from cream to cheese.

    TABLE-US-00008 TABLE 8 Molar fractions of fatty acids released in Feta cheese by commercial microbial lipase A and SEQ ID NO: 1, 2, 3, 6, 8, 10 and 11, after 2-monthh of ripening. All lipases were dosage at 2.3 LFU/L. C.sub.4:0 C.sub.6:0 C.sub.8:0 C.sub.10:0 C.sub.12:0 C.sub.14:0 C.sub.16:0 C.sub.16:1 C.sub.18:0 C.sub.18:1 C.sub.18:2 C.sub.18:3 A 4.3 2.3 9.3 17.3 13.7 14.3 20.1 1.5 4.2 10.9 1.4 0.7 1 69.4 5.6 5.3 6.4 2.3 2.8 4.0 0.4 0.3 3.1 0.3 0.1 2 17.8 17.5 9.6 13.6 5.0 6.3 15.4 0.8 5.0 7.9 0.8 0.3 3 94.2 0.9 2.0 0.7 0.0 0.0 0.8 0.0 1.0 0.4 0.0 0.0 6 6.5 4.8 11.2 15.9 11.2 12.7 17.4 1.5 5.0 12.0 1.4 0.6 8 36.6 14.2 9.1 12.7 3.8 5.6 9.8 0.6 2.4 4.5 0.6 0.3 10 16.0 27.9 18.6 17.0 5.3 5.4 3.4 0.6 0.7 4.6 0.4 0.2 11 32.7 7.5 13.2 22.0 4.6 4.0 3.7 0.8 1.0 9.3 0.8 0.4

    TABLE-US-00009 TABLE 9 Short- and medium-chain fatty acid specificities (C.sub.4/C.sub.16-C.sub.18, C.sub.6/ C.sub.16-C.sub.18, C.sub.8/C.sub.16-C.sub.18, C.sub.10/C.sub.16-C.sub.18) and improvement factors (IF4, IF6, IF8, IF10) in Feta cheese by commercial microbial lipase A and SEQ ID NO: 1, 2, 3, 6, 8, 10 and 11, after 2-monthh of ripening. All lipases were dosage at 2.3 LFU/L. C.sub.4/ C.sub.6/ C.sub.8/ C.sub.10/ C.sub.16- C.sub.16- C.sub.16- C.sub.16- C.sub.18 C.sub.18 C.sub.18 C.sub.18 IF4 IF6 IF8 IF10 A 0.112 0.059 0.239 0.444 1.0 1.0 1.0 1.0 1 8.357 0.669 0.635 0.776 74.8 11.2 2.7 1.7 2 0.588 0.577 0.319 0.449 5.3 9.7 1.3 1.0 3 42.932 0.410 0.908 0.304 384.3 6.9 3.8 0.7 6 0.172 0.126 0.296 0.420 1.5 2.1 1.2 0.9 8 2.024 0.785 0.504 0.705 18.1 13.2 2.1 1.6 10 1.607 2.807 1.870 1.707 14.4 47.2 7.8 3.8 11 2.044 0.469 0.829 1.377 18.3 7.9 3.5 3.1

    [0139] All the tested microbial lipolytic enzymes show an IF4 higher than 1, in Feta cheese, after 2-month of ripening. Thus, the tested enzymes have a higher specificity for the short chain fatty acid butyric acid (C.sub.4:0) compared to commercial lipase A (Table 7) and can, therefore, be successfully used in a process for producing a food product wherein the presence of short chain fatty acid butyric acid (C.sub.4:0) is needed and desired, such as for reducing soapiness and increase in butyric flavors in a food product.

    [0140] Microbial lipolytic enzymes with SEQ ID NO: 1, 2, 3, 6, 8, 10 and 11 show an IF6 and IF8 higher than 1, meaning they have a higher specificity for the short chain fatty acid caproic acid (C.sub.6:0) and for medium chain fatty acid caprylic acid (C.sub.8:0) compared to commercial lipase A.

    [0141] The tested enzymes, with the exception of SEQ ID NO: 3, also shown an IF10 higher than 1, and have, therefore, a higher specificity for medium chain fatty capric acid (C.sub.10:0) compared to commercial lipase A.

    [0142] Further and as previously mentioned this invention relates to flavor enhancement but also with shortening of the ripening times for ripened cheeses. The comparison between free fatty acid profiles after 1-month or 2-months of ripening shows that it is possible to successfully reduce ripening time from 2-months (or more) to 1-month (or less), while the cheese still presents the desired short-chain fatty acid profile.

    [0143] Identical results to those disclosed in Example 6 are also expected for other types of cheese, such as Pecorino, Parmesan, Grana Padano, Parmigiano Reggiano, Romano, Chester, Danbo, Manchego, Saint Paulin, Cheddar, Monterey, Colby, Edam, Gouda, Muenster, Swiss type, Gruyere, Emmental; pasta filata cheeses such as Mozzarella, and Queso fresco cheese; fresh cheese such as Ricotta, Cream cheese, Neufchatel or Cottage cheese; cream cheese, white mold cheese such as Brie and Camembert cheese, blue mold cheese such as Gorgonzola and Danish blue cheese; processed cheese, cheese-like product, or an enzyme-modified cheese.

    [0144] In conclusion, the present invention discloses microbial wild-type lipases with a higher specificity for short chain fatty acids, specially C.sub.4-fatty acid, than the known prior art microbial lipases, leading to a reduction in soapiness and an increase in butyric flavors of a food product such as cheese. Therefore, this invention provides microbial wild-type lipases which fulfill the vegetarian and/or kosher requirements, while simultaneously showing higher specificity for short chain fatty acids, specially C.sub.4-fatty acid and lower specificity for medium to long chain fatty acids from milk fat and/or other fat, specially showing lower specificity for long chain fatty acids from milk fat and/or other fat, thereby avoiding an extremely unpleasant soapy taste in a food product, like cheese.

    [0145] The present invention can be applied to other kinds of food products wherein the purpose is to reduce the unpleasant soapy taste of said food product.

    [0146] Finally, if needed, the ripening time of the food product can be reduced from 2-months to 1-month, in particular in Feta cheese, while still maintaining the proper and desired short-chain fatty acid profile.

    [0147] The use of the terms “a” and “an” and “the” and similar references in the context of describing the invention (especially in the context of the following claims) are to be construed to cover both the singular and the plural, unless otherwise indicated herein or clearly contradicted by context. The terms “comprising”, “having”, “including” and “containing” are to be construed as open-ended terms (i.e., meaning “including, but not limited to,”) unless otherwise noted. Recitation of ranges of values herein are merely intended to serve as a shorthand method of referring individually to each separate value falling within the range, unless otherwise indicated herein, and each separate value is incorporated into the specification as if it were individually recited herein. All methods described herein can be performed in any suitable order unless otherwise indicated herein or otherwise clearly contradicted by context. The use of any and all examples, or exemplary language (e.g., “such as”) provided herein, is intended merely to better illuminate the invention and does not pose a limitation on the scope of the invention unless otherwise claimed. No language in the specification should be construed as indicating any non-claimed element as essential to the practice of the invention.

    [0148] List of preferred embodiments in a claim format [0149] 1. Lipase comprising an amino acid sequence having at least 90% identity with SEQ ID NO: 1 or SEQ ID NO: 2 or SEQ ID NO: 3 or SEQ ID NO: 4 or SEQ ID NO: 5 or SEQ ID NO: 6 or SEQ ID NO: 7 or SEQ ID NO: 8 or SEQ ID NO: 9 or SEQ ID NO: 10 or SEQ ID NO: 11, preferably SEQ ID NO: 1 or SEQ ID NO: 3 or SEQ ID NO: 9 or SEQ ID NO: 11, more preferably SEQ ID NO: 1 or SEQ ID NO: 3 or SEQ ID NO: 11, even more preferably SEQ ID NO: 1, or having at least 95%, 96%, 97%, 98% or 99% identity with SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9 or SEQ ID NO: 10 or SEQ ID NO: 11, preferably SEQ ID NO: 1 or SEQ ID NO: 3 or SEQ ID NO: 9 or SEQ ID NO: 11, more preferably SEQ ID NO: 1 or SEQ ID NO: 3 or SEQ ID NO: 11, even more preferably SEQ ID NO: 1, or wherein the sequence is SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9 or SEQ ID NO: 10 or SEQ ID NO: 11, preferably SEQ ID NO: 1, preferably SEQ ID NO: 1 or SEQ ID NO: 3 or SEQ ID NO: 9 or SEQ ID NO: 11, more preferably SEQ ID NO: 1 or SEQ ID NO: 3 or SEQ ID NO: 11, even more preferably SEQ ID NO: 1. [0150] 2. Lipase according to the previous item, wherein said lipase has a higher specificity towards the release of C.sub.4-fatty acids from a dairy composition comprising milk fat and/or other fat if compared with the release of C.sub.10-fatty acids. [0151] 3. Lipase according to any of the previous items, wherein said lipase has a higher specificity towards the release of C.sub.4-fatty acids from a dairy composition comprising milk fat and/or other fat if compared with the release of C.sub.8-fatty acids, or if compared with the release of C.sub.6-fatty acids, or if compared with the release of C.sub.12-fatty acids or if compared with the release of C.sub.18:2-fatty acids or if compared with the release of C.sub.14-fatty acids or if compared with the release of C.sub.18:0-fatty acids or if compared with the release of C.sub.18:1-fatty acids or if compared with the release of C.sub.16-fatty acids, or if compared with the release of C.sub.8-fatty acids—C.sub.18:2-fatty acids, or if compared with the release of C.sub.10-fatty acids—C.sub.18:1-fatty acids, or if compared with the release of C.sub.12-fatty acids—C.sub.18:0-fatty acids, or if compared with the release of C.sub.14-fatty acids—C.sub.16:0-fatty acids or if compared with the release of C.sub.16-C.sub.18-fatty acids. [0152] 4. Lipase according to any of the previous items, wherein said lipase has a higher specificity towards the release of C.sub.4-fatty acids from a dairy composition comprising milk fat and/or other fat if compared with the release of C.sub.10-fatty acids at a pH below 7, preferably 6.6-6.8, or at a pH below 6, preferably at a pH between 3.8-5.6, more preferably at a pH between 4.4-5.4, even more preferably at a pH between 4.6-5.2, or if compared with the release of C.sub.6-fatty acids or if compared with the release of C.sub.8-fatty acids or if compared with the release of C.sub.12-fatty acids or if compared with the release of C.sub.14-fatty acids or if compared with the release of C.sub.16-fatty acids or if compared with the release of C.sub.18:1-fatty acids or if compared with the release of C.sub.18:2-fatty acids or if compared with the release of C.sub.18:3-fatty acids or if compared with the release of C.sub.16-C.sub.18-fatty acids. [0153] 5. Lipase according to any of the previous items, wherein said wherein said lipase has a higher specificity towards the release of C.sub.4-fatty acids from a dairy composition comprising milk fat and/or other fat if compared with the release of C.sub.10-fatty acids at a temperature below 20° C., preferably below 15° C., more preferably below 10° C., even more preferably between 5-8° C., or if compared with the release of C.sub.6-fatty acids or if compared with the release of C.sub.8-fatty acids or if compared with the release of C.sub.12-fatty acids or if compared with the release of C.sub.14-fatty acids or if compared with the release of C.sub.16-fatty acids or if compared with the release of C.sub.18:1-fatty acids or if compared with the release of C.sub.18:2-fatty acids or if compared with the release of C.sub.18:3-fatty acid or if compared with the release of C.sub.16-C.sub.18-fatty acids. [0154] 6. Lipase according to any of the previous items, wherein said lipase is a microbial lipase, preferably an isolated microbial lipase, a recombinant microbial lipase or a synthetic microbial lipase. [0155] 7. Isolated DNA sequence or recombinant DNA sequence or synthetic DNA sequence encoding a lipase according to any of the preceding items, preferably wherein the isolated DNA sequence or recombinant DNA sequence or synthetic DNA is selected from a sequence having at least 90%, or at least 95%, or at least 96%, or at least 97%, or at least 98% or at least 99%, or 100% sequence identity with SEQ ID NO: 12 or SEQ ID NO: 13 or SEQ ID NO: 14 or SEQ ID NO: 15 or SEQ ID NO: 16 or SEQ ID NO: 17 or SEQ ID NO: 18 or SEQ ID NO: 19 or SEQ ID NO: 20 or SEQ ID NO: 21 or SEQ ID NO: 22 or SEQ ID NO: 23. [0156] 8. DNA sequence according to the preceding item further comprising a signal peptide sequence. [0157] 9. Vector comprising an isolated DNA sequence or recombinant DNA sequence or synthetic DNA sequence according to any of the previous items 7-8. [0158] 10. Host cell, preferably a recombinant host cell, comprising a sequence according to any of the previous items 1-8 or a vector according to previous item 9. [0159] 11. Host cell according to the previous item, wherein the host cell is selected from Pichia pastoris, Aspergillus or Bacillus subtilis, preferably Pichia pastoris or B. subtilis, more preferably Pichia pastoris. [0160] 12. Method for preparing a food product comprising a step of using a lipase comprising an amino acid sequence having at least 90%, or at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99% or 100% identity with SEQ ID NO: 1 or SEQ ID NO: 2 or SEQ ID NO: 3 or SEQ ID NO: 4 or SEQ ID NO: 5 or SEQ ID NO: 6 or SEQ ID NO: 7 or SEQ ID NO: 8 or SEQ ID NO: 9 or SEQ ID NO: 10 or SEQ ID NO: 11, preferably having at least 90%, or at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99% or 100% identity with SEQ ID NO: 1 or SEQ ID NO: 2 or SEQ ID NO: 3 or SEQ ID NO: 9 or SEQ ID NO: 11; or [0161] using a DNA sequence encoding a lipase, wherein the DNA sequence is selected from a sequence having at least 90%, or at least 95%, or at least 96%, or at least 97%, or at least 98% or at least 99%, or 100% sequence identity with SEQ ID NO: 12 or SEQ ID NO: 13 or SEQ ID NO: 14 or SEQ ID NO: 15 or SEQ ID NO: 16 or SEQ ID NO: 17 or SEQ ID NO: 18 or SEQ ID NO: 19 or SEQ ID NO: 20 or SEQ ID NO: 21 or SEQ ID NO: 22 or SEQ ID NO: 23, preferably having at least 90%, or at least 95%, or at least 96%, or at least 97%, or at least 98% or at least 99%, or 100% sequence identity with SEQ ID NO: 12 or SEQ ID NO: 13 or SEQ ID NO: 14 or SEQ ID NO: 20 or SEQ ID NO: 22 or SEQ ID NO: 23; preferably wherein the DNA sequence is an isolated DNA sequence or a recombinant DNA sequence or a synthetic DNA sequence, more preferably wherein the DNA sequence comprises a signal peptide sequence. [0162] 13. Method according to the previous item 12, wherein said lipase has a higher specificity towards the release of C.sub.4-fatty acids from a dairy composition comprising milk fat and/or other fat if compared with the release of C.sub.10-fatty acids or if compared with the release of C.sub.8-fatty acids, or if compared with the release of C.sub.6-fatty acids, or if compared with the release of C.sub.12-fatty acids or if compared with the release of C.sub.18:2-fatty acids or if compared with the release of C.sub.14-fatty acids or if compared with the release of C.sub.18:0-fatty acids or if compared with the release of C.sub.18:1-fatty acids or if compared with the release of C.sub.16-fatty acids, or if compared with the release of C.sub.8-fatty acids—C.sub.18:2-fatty acids, or if compared with the release of C.sub.10-fatty acids—C.sub.18:1-fatty acids, or if compared with the release of C.sub.12-fatty acids—C.sub.18:0-fatty acids, or if compared with the release of C.sub.14-fatty acids—C.sub.16:0-fatty acids or if compared with the release of C.sub.16-C.sub.18-fatty acids. [0163] 14. Method according to any of the previous items 12-13, wherein said lipase has a higher specificity towards the release of C.sub.4-fatty acids from a dairy composition comprising milk fat and/or other fat if compared with the release of C.sub.10-fatty acids at a pH below 7, preferably 6.6-6.8, or at a pH below 6, preferably at a pH between 3.8-5.6, more preferably at a pH between 4.4-5.4, even more preferably at a pH between 4.6-5.2, or if compared with the release of C.sub.6-fatty acids or if compared with the release of C.sub.8-fatty acids or if compared with the release of C.sub.12-fatty acids or if compared with the release of C.sub.14-fatty acids or if compared with the release of C.sub.16-fatty acids or if compared with the release of C.sub.18:1-fatty acids or if compared with the release of C.sub.18:2-fatty acids or if compared with the release of C.sub.18:3-fatty acid or if compared with the release of C.sub.16-C.sub.18-fatty acids. [0164] 15. Method according to any of the previous items 12-14, wherein said wherein said lipase has a higher specificity towards the release of C.sub.4-fatty acids from a dairy composition comprising milk fat and/or other fat if compared with the release of C.sub.10-fatty acids at a temperature below 20° C., preferably below 15° C., more preferably below 10° C., even more preferably between 5-8° C., or if compared with the release of C.sub.6-fatty acids or if compared with the release of C.sub.8-fatty acids or if compared with the release of C.sub.12-fatty acids or if compared with the release of C.sub.14-fatty acids or if compared with the release of C.sub.16-fatty acids or if compared with the release of C.sub.18:1-fatty acids or if compared with the release of C.sub.18:2-fatty acids or if compared with the release of C.sub.18:3-fatty acid or if compared with the release of C.sub.16-C.sub.18-fatty acids. [0165] 16. Method according to any of the previous items 12-15, wherein said lipase is a microbial lipase, preferably an isolated microbial lipase, a recombinant microbial lipase or a synthetic microbial lipase. [0166] 17. Method according to any of the previous items 12-16, wherein the food product is a dairy product selected from a cheese, or a processed cheese, or a cheese-like product, or an enzyme-modified cheese, or a butter, or a yogurt, or a cream, or a seasoning. [0167] 18. Method according to the previous items 12-17, wherein the dairy product is a cheese, preferably wherein the cheese is Feta cheese, or Provolone cheese, or Pecorino cheese, or Parmesan cheese, or Grana Padano cheese, or Parmigiano Reggiano cheese, or Romano cheese, or Chester cheese, or Danbo cheese, or Manchego cheese, or Saint Paulin cheese, or Cheddar cheese, or Monterey cheese, or Colby cheese, or Edam cheese, or Gouda cheese, or Muenster cheese, or Swiss type cheese, or Gruyere cheese, or Emmental cheese; or pasta filata cheeses such as Mozzarella, and Queso fresco cheese; or fresh cheese such as Ricotta, Cream cheese, Neufchatel or Cottage cheese; or cream cheese, or white mold cheese such as Brie and Camembert cheese, or blue mold cheese such as Gorgonzola and Danish blue cheese. [0168] 19. Method according to previous item 12, wherein the food product is a non-dairy product, preferably a non-dairy cheese or vegan cheese, preferably wherein the lipase has a higher specificity towards the release of C.sub.4-fatty acids from a composition comprising fat such as vegetable fat or from a water-in-oil emulsion if compared with the release of C.sub.10-fatty acids or if compared with the release of C.sub.8-fatty acids, or if compared with the release of C.sub.6-fatty acids, or if compared with the release of C.sub.12-fatty acids or if compared with the release of C.sub.18:2-fatty acids or if compared with the release of C.sub.14-fatty acids or if compared with the release of C.sub.18:0-fatty acids or if compared with the release of C.sub.18:1-fatty acids or if compared with the release of C.sub.16-fatty acids, or if compared with the release of C.sub.8-fatty acids—C.sub.18:2-fatty acids, or if compared with the release of C.sub.10-fatty acids—C.sub.18:1-fatty acids, or if compared with the release of C.sub.12-fatty acids—C.sub.18:0-fatty acids, or if compared with the release of C.sub.14-fatty acids—C.sub.16:0-fatty acids or if compared with the release of C.sub.16-C.sub.18-fatty acids. [0169] 20. Food product comprising a lipase, wherein the lipase comprises an amino acid sequence having at least 90%, or at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99% or 100% identity with SEQ ID NO: 1 or SEQ ID NO: 2 or SEQ ID NO: 3 or SEQ ID NO: 4 or SEQ ID NO: 5 or SEQ ID NO: 6 or SEQ ID NO: 7 or SEQ ID NO: 8 or SEQ ID NO: 9 or SEQ ID NO: 10 or SEQ ID NO: 11, preferably having at least 90%, or at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99% or 100% identity with SEQ ID NO: 1 or SEQ ID NO: 2 or SEQ ID NO: 3 or SEQ ID NO: 9 or SEQ ID NO: 11, and [0170] wherein the food product comprises more C.sub.4-fatty acids than C.sub.10-fatty acids or than any other fatty acid selected from C.sub.6-fatty acids or C.sub.8-fatty acids or C.sub.12-fatty acids or C.sub.14-fatty acids or C.sub.16-fatty acids or C.sub.18:1-fatty acids or C.sub.18:2-fatty acids or C.sub.18:3-fatty acids and/or [0171] wherein the food product comprises more C.sub.6-fatty acids than C.sub.10-fatty acids or than any other fatty acid selected from C.sub.8-fatty acids or C.sub.12-fatty acids or C.sub.14-fatty acids or C.sub.16-fatty acids or C.sub.18:1-fatty acids or C.sub.18:2-fatty acids or C.sub.18:3-fatty acids. [0172] 21. Food product according to the previous item 20, wherein the food product is a dairy product selected from a cheese, a processed cheese, a cheese-like product, or a butter, a yogurt, a cream, a seasoning, preferably wherein the cheese is Feta cheese, or Provolone cheese, or Pecorino cheese, or Parmesan cheese, or Grana Padano cheese, or Parmigiano Reggiano cheese, or Romano cheese, or Chester cheese, or Danbo cheese, or Manchego cheese, or Saint Paulin cheese, or Cheddar cheese, or Monterey cheese, or Colby cheese, or Edam cheese, or Gouda cheese, or Muenster cheese, or Swiss type cheese, or Gruyere cheese, or Emmental cheese; or pasta filata cheeses such as Mozzarella, and Queso fresco cheese; or fresh cheese such as Ricotta, Cream cheese, Neufchatel or Cottage cheese; or cream cheese, or white mold cheese such as Brie and Camembert cheese, or blue mold cheese such as Gorgonzola and Danish blue cheese, more preferably Feta cheese or Provolone cheese; or wherein the food product is a non-dairy product such as a non-dairy cheese or vegan cheese. [0173] 22. Use of a lipase, for producing a food product, [0174] wherein the food product is a dairy product selected from a cheese, or a processed cheese, or an enzyme-modified cheese (EMC), or a cheese-like product, or a butter, or a yogurt, or a cream, or a seasoning, preferably for producing cheese, such as Feta cheese, or Provolone cheese, or Pecorino cheese, or Parmesan cheese, or Grana Padano cheese, or Parmigiano Reggiano cheese, or Romano cheese, or Chester cheese, or Danbo cheese, or Manchego cheese, or Saint Paulin cheese, or Cheddar cheese, or Monterey cheese, or Colby cheese, or Edam cheese, or Gouda cheese, or Muenster cheese, or Swiss type cheese, or Gruyere cheese, or Emmental cheese; or pasta filata cheeses such as Mozzarella, and Queso fresco cheese; or fresh cheese such as Ricotta, Cream cheese, Neufchatel or Cottage cheese; or cream cheese, or white mold cheese such as Brie and Camembert cheese, or blue mold cheese such as Gorgonzola and Danish blue cheese; more preferably the cheese is Feta cheese or Provolone cheese; or [0175] wherein the food product is a non-dairy product such as a non-dairy cheese or vegan cheese; [0176] and wherein the lipase comprises an amino acid sequence having at least 90%, or at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99% or 100% identity with SEQ ID NO: 1 or SEQ ID NO: 2 or SEQ ID NO: 3 or SEQ ID NO: 4 or SEQ ID NO: 5 or SEQ ID NO: 6 or SEQ ID NO: 7 or SEQ ID NO: 8 or SEQ ID NO: 9 or SEQ ID NO: 10 or SEQ ID NO: 11, preferably having at least 90%, or at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99% or 100% identity with SEQ ID NO: 1 or SEQ ID NO: 2 or SEQ ID NO: 3 or SEQ ID NO: 9 or SEQ ID NO: 11. [0177] 23. Use of a lipase for producing or releasing more C.sub.4-fatty acids and/or C.sub.6-fatty acids from a dairy composition comprising milk fat and/or other fat, such as vegetable fat, than for producing or releasing more C.sub.8-fatty acids, C.sub.10-fatty acids, C.sub.12-fatty acids, C.sub.14-fatty acids, C.sub.16-fatty acids, C.sub.18:0-fatty acids, C.sub.18:1-fatty acids, or C.sub.18:2-fatty acids, or C.sub.18:3-fatty acids, wherein the lipase comprises an amino acid sequence having at least 90%, or at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99% or 100% identity with SEQ ID NO: 1 or SEQ ID NO: 2 or SEQ ID NO: 3 or SEQ ID NO: 4 or SEQ ID NO: 5 or SEQ ID NO: 6 or SEQ ID NO: 7 or SEQ ID NO: 8 or SEQ ID NO: 9 or SEQ ID NO: 10 or SEQ ID NO: 11, preferably having at least 90%, or at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99% or 100% identity with SEQ ID NO: 1 or SEQ ID NO: 2 or SEQ ID NO: 3 or SEQ ID NO: 9 or SEQ ID NO: 11, preferably wherein said lipase has a higher specificity towards the release of C.sub.4-fatty acids from a dairy composition comprising milk fat and/or other fat if compared with the release of C.sub.10-fatty acids or if compared with the release of C.sub.8-fatty acids, or if compared with the release of C.sub.6-fatty acids, or if compared with the release of C.sub.12-fatty acids or if compared with the release of C.sub.18:2-fatty acids or if compared with the release of C.sub.14-fatty acids or if compared with the release of C.sub.18:0-fatty acids or if compared with the release of C.sub.18:1-fatty acids or if compared with the release of C.sub.16-fatty acids, or if compared with the release of C.sub.8-fatty acids—C.sub.18:2-fatty acids, or if compared with the release of C.sub.10-fatty acids—C.sub.18:1-fatty acids, or if compared with the release of C.sub.12-fatty acids—C.sub.18:0-fatty acids, or if compared with the release of C.sub.14-fatty acids—C.sub.16:0-fatty acids or if compared with the release of C.sub.16-C.sub.18-fatty acids. [0178] 24. Use of a lipase for producing or releasing more C.sub.4-fatty acids and/or C.sub.6-fatty acids in a food product than for producing or releasing more C.sub.8-fatty acids, C.sub.10-fatty acids, C.sub.12-fatty acids, C.sub.14-fatty acids, C.sub.16-fatty acids, C.sub.18:0-fatty acids, C.sub.18:1-fatty acids, or C.sub.18:2-fatty acids, or C.sub.18:3-fatty acids in the food product, wherein the lipase comprises an amino acid sequence having at least 90%, or at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99% or 100% identity with SEQ ID NO: 1 or SEQ ID NO: 2 or SEQ ID NO: 3 or SEQ ID NO: 4 or SEQ ID NO: 5 or SEQ ID NO: 6 or SEQ ID NO: 7 or SEQ ID NO: 8 or SEQ ID NO: 9 or SEQ ID NO: 10 or SEQ ID NO: 11, preferably having at least 90%, or at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99% or 100% identity with SEQ ID NO: 1 or SEQ ID NO: 2 or SEQ ID NO: 3 or SEQ ID NO: 9 or SEQ ID NO: 11, [0179] preferably wherein the food product is a dairy product selected from a cheese, or a processed cheese, or enzyme-modified cheese, or a cheese-like product, or a butter, or a yogurt, or a cream, or a seasoning, or [0180] preferably wherein the food product is a non-dairy product such as a non-dairy cheese or vegan cheese. [0181] 25. Use according to the previous item 24, wherein the food product is a dairy product selected from a cheese and wherein the cheese is Feta cheese, or Provolone cheese, or Pecorino cheese, or Parmesan cheese, or Grana Padano cheese, or Parmigiano Reggiano cheese, or Romano cheese, or Chester cheese, or Danbo cheese, or Manchego cheese, or Saint Paulin cheese, or Cheddar cheese, or Monterey cheese, or Colby cheese, or Edam cheese, or Gouda cheese, or Muenster cheese, or Swiss type cheese, or Gruyere cheese, or Emmental cheese; or pasta filata cheeses such as Mozzarella, and Queso fresco cheese; or fresh cheese such as Ricotta, Cream cheese, Neufchatel or Cottage cheese; or cream cheese, or white mold cheese such as Brie and Camembert cheese, or blue mold cheese such as Gorgonzola and Danish blue cheese, preferably Feta cheese or Provolone cheese. [0182] 26. Lipase consisting of an amino acid sequence having at least 90%, or at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99% or 100% identity with SEQ ID NO: 1 or SEQ ID NO: 2 or SEQ ID NO: 3 or SEQ ID NO: 4 or SEQ ID NO: 5 or SEQ ID NO: 6 or SEQ ID NO: 7 or SEQ ID NO: 8 or SEQ ID NO: 9 or SEQ ID NO: 10 or SEQ ID NO: 11, preferably having at least 90%, or at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99% or 100% identity with SEQ ID NO: 1 or SEQ ID NO: 2 or SEQ ID NO: 3 or SEQ ID NO: 9 or SEQ ID NO: 11; [0183] wherein the lipase is expressed in Pichia pastoris and has a higher specificity towards the release of C.sub.4-fatty acids from a dairy composition comprising milk fat and/or other fat if compared with the release of C.sub.10-fatty acids, or if compared with the release of C.sub.8-fatty acids, or if compared with the release of C.sub.6-fatty acids, or if compared with the release of C.sub.12-fatty acids or if compared with the release of C.sub.18:2-fatty acids or if compared with the release of C.sub.14-fatty acids or if compared with the release of C.sub.18:0-fatty acids or if compared with the release of C.sub.18:1-fatty acids or if compared with the release of C.sub.16-fatty acids, or if compared with the release of C.sub.8-fatty acids—C.sub.18:2-fatty acids, or if compared with the release of C.sub.10-fatty acids—C.sub.18:1-fatty acids, or if compared with the release of C.sub.12-fatty acids—C.sub.18:0-fatty acids, or if compared with the release of C.sub.14-fatty acid—C.sub.16:0-fatty acids or if compared with the release of C.sub.16-C.sub.18-fatty acids. [0184] 27. Lipase according to item 26, wherein the lipase is used in any of the methods or uses herein disclosed.

    REFERENCES

    Non Patent Literature

    [0185] Iwai, M. et al. Studies on Lipase II. Hydrolytic and esterifying actions of crystalline lipase of Aspergillus niger. J. Gen. Appl. Microbiol. 10, 13-22 (1964)

    [0186] Oi, S. et al. Purification and Some Properties of a Fungal Lipase Preparation Used for Milk Flavouring. Agr. Biol. Chem. 33, 729-38 (1969)

    [0187] Somkuti, G. A. et al. Lipase Activity of Mucor pusillus. Appl. Microbiol. 16, 617-19 (1968)

    [0188] Kamoun, J. et al. Biochemical characterization of Yarrowia lipolytica LIPS, a secreted lipase with a cleavable C-terminal region. Biochim. Biophys. Acta 1851, 129-140 (2015)

    [0189] Aloulou, A. et al. Purification and biochemical characterization of the LIP2 lipase from Yarrowia lipolytica. Biochim. Biophys. Acta—Mol. Cell Biol. Lipids 1771, 228-237 (2007)

    [0190] Sheng, J., Wang, F., Wang, H. & Sun, M. Cloning, characterization and expression of a novel lipase gene from marine psychrotrophic Yarrowia lipolytica. Ann. Microbiol. 62, 1071-1077 (2012)

    [0191] J. Sambrook, E. F. Fritsch, and T. Maniatis, 1989, Molecular Cloning: A Laboratory manual, 2.sup.nd edition, books 1-3, Cold Spring Harbor Laboratory Press

    [0192] Jong C., de and Badings H.T. Determination of free fatty acids in milk and cheese procedures for extraction, clean up, and capillary gas chromatographic analysis J. High Resolution Chromatography, 13, 84-98 (1990)

    Patent Literature

    [0193] U.S. Pat. Nos. 4,726,954; 4,636,468; US2005059130; EP2290059; EP3081644; EP2254996; EP1776455

    TABLE-US-00010 SEQUENCE LISTING >SEQ ID NO: 1 MVLSTVIGEWFSRVLFGTVAPSPLTATAPISQDFYDTALTFSHLSNVAYCINTPLESLKSDFSCGVACSHFPNMELV EEFGGEFFETSITGFLSIDHVKKEKYVVYRGTYDIGDVYTDIQLSQSPFLVTPSALGSTANLCEGCTIHDGWNKAYN ETMGIIGDKLADHVNSNPDYRLVVTGHSLGAAIAVLSATSLKVNGQDPYLYTYGQPRIGNANFANFVSKQWFGEGDG LSMDSDRRYFRLTHWNDLFVGFPAFKDYVHSVGEIYIDYFTVQPPLNKVFSCAGPESMSCYRKDFNALARLDIVKNH LAYFDWISLCTLNIGRRDLERGRKFEGTWLYGGLANGSTIF >SEQ ID NO: 2 AVLQKRVYTSTETSHIDQESYNFFEKYARLANIGYCVGPGTKIFKPFNCGLQCAHFPNVELIEEFHDPRLIFDVSGY LAVDHASKQIYLVIRGTHSLEDVITDIRIMQAPLTNFDLAANISSTATCDDCLVHNGFIQSYNNTYNQIGPKLDSVI EQYPDYQIAVTGHSLGGAAALLFGINLKVNDHDPLVVTLGQPIVGNAGFANWVDKLFFGQENPDVSKVSKDRKLYRI THRGDIVPQVPFWDGYQHCSGEVFIDWPLIHPPLSNVVMCQGQSNKQCSAGNTLLQQVNVIGNHLQYFVTEGVCGI >SEQ ID NO: 3 QTAPITQETYDFVLKYGWLSNVAYCVRAPGPFALQSDFTCGNSCAHFPDVTLDYQFGGNFFSTSVTGFLAHDHTKKE KYIVFRGTFSIADAITDIQTIQQPYMTSIPPLNTTDINSTNPSASINCPGCQVHDGFQKAYRETMVNVQDRLVDFLG NNTDYKLIVTGHSLGAVTALFMGINLKNLGYDPTLINYGQPRLGNKAFADYVDALFFKQGDDGLTINPERRMYRVTH WNDFFVGWPAGYSHTLGEVYISDPTGINAPIEDVYSCAGPENNQCHHGSFNLLERLNILKNHCGYLNWIFYCAINVD KREMMIDPPRVGKRVEHWSGKFSDVESTEGLMYEAIYPM >SEQ ID NO: 4 APAPAPMQRRDISSTVLDNIDLFAQYSAAAYCSSNIESTGTTLTCDVGNCPLVEAAGATTIDEFDDSSSYGDPTGFI AVDPTNELIVLSFRGSSDLSNWIADLDFGLTSVSSICDGCEMHKGFYEAWEVIADTITSKVEAAVSSYPDYTLVFTG HSYGAALAAVAATVLRNAGYTLDLYNFGQPRIGNLALADYITDQNMGSNYRVTHTDDIVPKLPPELLGYHHFSPEYW ITSGNDVTVTTSDVTEVVGVDSTAGNDGTLLDSTTAHRWYTIYISECS >SEQ ID NO: 5 VPMLQSRATSDPAEWTELHRAAQLSSAAYTGCTGSAFDVTITKQINELVTDTQGFIGYSTEKKRITVAMRGSTSATD IANDVDTTLVEPTLSGVNFPSGAKMMHGIYSPWSSVHDDVISEVKSLVEQYPDYTIESTGHSLGGSLTYISYIALAQ NFPGKTIISNALAAYPIGNEAFANFGASQNGTLNRGNNADDGVPNMYVMWPWDFVHYGTEYYSSGTQASTVKCSGER DTSCSAGNGQVGVTAGHFSNFGIAMGMAGC >SEQ ID NO: 6 APASNDATIADVSSTFTLPPIIKDRVAFSNDIADTDYFNLTKRASETVGGNTMDLPSNAPALPAVPKAGDVVIATAA QIAEYKKYAALASTAYCRSVVPLNLWTCVNCLRFAPDGKLIKTFSSVISDTNGFVLRSDAQKTIYVVFRGTNSIRSA ITDLVFTLISYPPVSGARVHTGFYASYQAVVSDYFPVVQSQLTSYPSYKVVVTGHSLGGAHALLAGMDLYQREKRLT ASNLFIHTAGCPRVGNPTFANYVASTGITFTRSVNQRDIVPHVPPTYAGYLHPGVEVWARTSSTVQICTSNTESNMC SNSIEPFTSFTDHLSYYGITEGVCI >SEQ ID NO: 7 SPVQLARRAISSELLERFTLFSQFATLSACDQNINHTGQSLTCDYGTCGLVAADNTTVINAFHSDNGPTGYIALDHT RQLIVLTFRGTVSKSDGDTDLDIVLTSIDDVCTGCKAHHGFWVYWSAVASQATTQLQDATSAYPSYRLSVVGHSLGG GIAALAGTVLRTQGFTLDIWTFGGPKPGNLKLAEFITNQQPPNSIYRATHTTDPIPKVPLNLPFLDWSQPSPEYWIT QETGVQVTTDGVEYIEGINSKAGNAGSDRDLRWPNPEHGWYFGNMSVCASPSDASS >SEQ ID NO: 8 APSQLVPRAVSSGTLDQLTLFAQYSAASYCANNVNSPGDAITCSGGYCPKLQSAGVKSLFEFDDSTEFGDVAGFLSV DTANKLLVLSFRGSRTISNWIANLDFGQADASSLCIGCKAHSGFLKAWTVVSDDVMPPLVSAMAKYPGFRLVLTGHS FGGAVAALGATALRKAGYKLDLYTYGQPRVGNTALATYMTNQGSMYRVTHSNDIVPKLPPPLLGYTHASPEYWITSG DNVAVTTKDITQVNGIGSKDGNAGSNGDSIPAHNWYIVNIDGCK >SEQ ID NO: 9 APQKRSVSSTVLAQLSRYAQWSAAAYCSGNTSGANQVVSCSANNCPDVQASGATMLYEFDSTNTYGDAAGFLAADTT QQQIILSFRGSRTTSNWIANLDTELTSSTLCSGCEVHQGFWLDYQTVAATLKAQIDAALNTYPGYSLVVTGHSLGGA LAMLAGLDLNSQGYAPTIYTYGQPRVGNLALAQYITNVGNQWRVTHADDAVPKLPPRLFGFSHASPEYWITSGDNVA VTTGDVTVVTGVNSLGGNDGTLTASVSAHNWYLVDIDACK >SEQ ID NO: 10 APALPLEVRDSGVSQAVYDDLVVYAKYSSAVYQPFCPRPLGSWMIKAFDTKGTQGFVARDDARKEIIVAFRGSFEIV DILIDIQIILTPLSTPGVSNVGSARVHTGFQKAYNFVIDEVQSLMKSQIDAYPSYKLVVTGHSLGGAVATFAALALK SKYPSKSLRLFTYGAPRVGDAAFASLVESRLGINNIYRGVHTWDGVPTLLGRWLGYRHYGTEYWQHKDPSKPENVRK CNGGEDTSCSNSIISTGINPPHAFQFGQVMAINPLLCF >SEQ ID NO: 11 MVSFGARIKDFFSVLLFGAASTSSSTKTALVSQGFYDAALDFSHLSNIAYCVNAPITPLKSDFSCGQSCVHFPDIEL VHIFGGDFFSTSITGYLALDHVKKEKYVVFRGTFSIADAITDIQFQQSSFLVNVPALNTFTANDTAPEAQIDCKQCK IHDGFSKAFTETWHNIGDLLEQHLDSYPDYQLYVTGHSLGAAMALLGATSIKLRGYDPILINYGQPRVGNKAFADYI SALWFGNGDGLEINQQRRLYRMTHWNDVFVGLPNWDGYTHSNGEVYIKGKYVNPPLKDVFSCAGGENSKCYRSEFNL LAQINLLQNHLCYIDYIGFCALNVGRRELNDLPHYNGPYKYGHKTEEQFIAEGLELSN >SEQ ID NO: 12 ATGGTTTTGTCTACTGTTATTGGTGAATGGTTCTCTAGAGTTTTGTTTGGTACTGTTGCTCCATCTCCTTTGACTGC TACTGCTCCAATCTCTCAAGATTTCTACGATACTGCTTTGACTTTTTCTCATTTGTCTAACGTTGCTTACTGTATCA ACACTCCATTGGAATCTTTGAAGTCTGATTTCTCTTGTGGTGTTGCTTGTTCTCACTTTCCTAACATGGAGTTGGTT GAAGAGTTCGGTGGTGAATTTTTCGAGACTTCTATTACTGGTTTCTTGTCTATCGATCATGTTAAGAAAGAGAAGTA CGTTGTTTACAGAGGTACTTACGATATCGGAGATGTTTACACTGATATCCAATTGTCTCAATCTCCATTCTTGGTTA CTCCTTCTGCTTTGGGTTCTACTGCTAATTTGTGTGAAGGTTGTACTATTCACGATGGTTGGAACAAGGCTTATAAT GAGACTATGGGTATTATTGGAGATAAATTGGCTGATCATGTTAACTCTAATCCTGATTACAGATTGGTTGTTACTGG TCACTCTTTGGGTGCTGCTATTGCTGTTTTGTCTGCTACTTCTTTGAAGGTTAACGGTCAAGATCCATACTTGTATA CTTACGGTCAACCTAGAATCGGTAACGCTAACTTCGCTAACTTCGTTTCTAAGCAATGGTTTGGTGAAGGAGATGGT TTGTCTATGGATTCTGATAGAAGATACTTCAGATTGACTCATTGGAACGATTTGTTTGTTGGTTTCCCAGCTTTTAA GGATTACGTTCACTCTGTTGGTGAAATCTACATCGATTACTTCACTGTTCAACCACCTTTGAACAAGGTTTTCTCTT GTGCTGGTCCTGAGTCTATGTCTTGTTACAGAAAGGATTTCAACGCTTTGGCTAGATTGGATATCGTTAAAAATCAT TTGGCTTACTTCGATTGGATTTCTTTGTGTACTTTGAACATTGGTAGAAGAGATTTGGAAAGAGGTAGAAAGTTTGA GGGTACTTGGTTGTATGGTGGTTTGGCTAATGGTTCTACTATTTTC >SEQ ID NO: 13 GCTGTTTTGCAAAAGAGAGTTTACACTTCTACTGAAACTTCTCATATCGATCAAGAATCTTACAACTTTTTCGAGAA GTATGCTAGATTGGCTAATATTGGTTATTGTGTTGGTCCAGGTACTAAGATTTTTAAGCCTTTCAACTGTGGTTTGC AATGTGCTCATTTCCCAAACGTTGAATTGATCGAAGAGTTTCACGATCCTAGATTGATTTTCGATGTTTCTGGTTAC TTGGCTGTTGATCATGCTTCTAAGCAAATCTACTTGGTTATTAGAGGTACTCACTCTTTGGAGGATGTTATCACTGA TATCAGAATCATGCAAGCTCCATTGACTAACTTTGATTTGGCTGCTAATATTTCTTCTACTGCTACTTGTGATGATT GTTTGGTTCACAACGGTTTCATTCAATCTTACAACAACACTTACAATCAAATTGGTCCAAAGTTGGATTCTGTTATT GAGCAATACCCTGATTATCAAATTGCTGTTACTGGTCATTCTTTGGGTGGTGCTGCTGCTTTGTTGTTCGGTATTAA CTTGAAGGTTAATGATCACGATCCATTGGTTGTTACTTTGGGTCAACCTATTGTTGGTAACGCTGGTTTCGCTAATT GGGTTGATAAGTTGTTTTTCGGTCAAGAAAACCCAGATGTTTCTAAGGTTTCTAAGGATAGAAAGTTGTACAGAATC ACTCATAGAGGAGATATTGTTCCACAAGTTCCTTTTTGGGATGGTTATCAACATTGTTCTGGAGAGGTTTTCATTGA TTGGCCTTTGATTCACCCACCTTTGTCTAATGTTGTTATGTGTCAAGGTCAATCTAACAAACAATGTTCTGCTGGTA ACACTTTGTTGCAACAAGTTAACGTTATTGGTAATCACTTGCAATACTTCGTTACTGAAGGTGTTTGTGGTATT >SEQ ID NO: 14 CAAACTGCTCCAATCACTCAAGAAACTTACGATTTCGTTTTGAAGTACGGTTGGTTGTCTAACGTTGCTTACTGTGT TAGAGCTCCAGGTCCTTTTGCTTTGCAATCTGATTTCACTTGTGGTAACTCTTGTGCTCATTTCCCTGATGTTACTT TGGATTACCAATTCGGTGGTAACTTTTTCTCTACTTCTGTTACTGGTTTCTTGGCTCACGATCACACTAAGAAAGAA AAGTACATCGTTTTTAGAGGTACTTTCTCTATCGCTGATGCTATTACTGATATCCAAACTATCCAACAACCATACAT GACTTCTATTCCACCTTTGAACACTACTGATATCAACTCTACTAATCCATCTGCTTCTATTAATTGTCCTGGTTGTC AAGTTCACGATGGTTTTCAAAAAGCTTACAGAGAGACTATGGTTAACGTTCAAGATAGATTGGTTGATTTCTTGGGT AACAACACTGATTACAAGTTGATCGTTACTGGTCACTCTTTGGGTGCTGTTACTGCTTTGTTTATGGGTATTAACTT GAAAAATTTGGGTTACGATCCAACTTTGATTAACTATGGTCAACCTAGATTGGGTAATAAGGCTTTCGCTGATTACG TTGATGCTTTGTTTTTCAAACAAGGAGATGATGGTTTGACTATTAACCCAGAAAGAAGAATGTACAGAGTTACTCAT TGGAACGATTTCTTTGTTGGTTGGCCTGCTGGTTACTCTCACACTTTGGGTGAAGTTTATATTTCTGACCCAACTGG TATTAACGCTCCTATTGAAGATGTTTACTCTTGTGCTGGTCCAGAGAACAATCAATGTCATCACGGTTCTTTTAATT TGTTGGAAAGATTGAACATCTTGAAGAATCATTGTGGTTACTTGAACTGGATTTTCTATTGTGCTATTAATGTTGAT AAGAGAGAAATGATGATTGATCCACCTAGAGTTGGTAAAAGAGTTGAGCACTGGTCTGGTAAATTTTCTGATGTTGA ATCTACTGAGGGTTTGATGTACGAGGCTATCTACCCTATG >SEQ ID NO: 15 GCTCCAGCTCCTGCTCCAATGCAAAGAAGAGATATCTCTTCTACTGTTTTGGATAACATCGATTTGTTCGCTCAATA CTCTGCTGCTGCTTATTGTTCTTCTAACATTGAATCTACTGGTACTACTTTGACTTGTGATGTTGGTAATTGTCCTT TGGTTGAAGCTGCTGGTGCTACTACTATCGATGAGTTCGATGATTCTTCTTCTTACGGAGATCCTACTGGTTTCATT GCTGTTGATCCAACTAACGAGTTGATTGTTTTGTCTTTTAGAGGTTCTTCTGATTTGTCTAATTGGATTGCTGATTT GGATTTCGGTTTGACTTCTGTTTCTTCTATTTGTGATGGTTGTGAAATGCATAAGGGTTTTTACGAAGCTTGGGAGG TTATTGCTGATACTATCACTTCTAAGGTTGAGGCTGCTGTTTCTTCTTACCCTGATTATACTTTGGTTTTCACTGGT CACTCTTATGGTGCTGCTTTGGCTGCTGTTGCTGCTACTGTTTTGAGAAATGCTGGTTACACTTTGGATTTGTATAA CTTTGGTCAACCAAGAATTGGTAATTTGGCTTTGGCTGATTACATCACTGATCAAAACATGGGTTCTAACTACAGAG TTACTCATACTGATGATATTGTTCCTAAGTTGCCACCTGAATTGTTGGGTTACCATCACTTTTCTCCAGAGTATTGG ATTACTTCTGGTAACGATGTTACTGTTACTACTTCTGATGTTACTGAAGTTGTTGGTGTTGATTCTACTGCTGGTAA TGATGGTACTTTGTTGGATTCTACTACTGCTCACAGATGGTACACTATCTACATTTCTGAGTGTTCT >SEQ ID NO: 16 GTTCCAATGTTGCAATCTAGAGCTACTTCTGATCCTGCTGAATGGACTGAGTTGCATAGAGCTGCTCAATTGTCTTC TGCTGCTTACACTGGTTGTACTGGTTCTGCTTTCGATGTTACTATCACTAAGCAAATTAACGAATTGGTTACTGATA CTCAAGGTTTCATTGGTTACTCTACTGAGAAGAAAAGAATCACTGTTGCTATGAGAGGTTCTACTTCTGCTACTGAT ATTGCTAACGATGTTGATACTACTTTGGTTGAACCAACTTTGTCTGGTGTTAATTTTCCTTCTGGTGCTAAGATGAT GCATGGTATCTACTCTCCATGGTCTTCTGTTCACGATGATGTTATCTCTGAGGTTAAGTCTTTGGTTGAGCAATACC CTGATTATACTATTGAATCTACTGGTCACTCTTTGGGTGGTTCTTTGACTTACATCTCTTACATCGCTTTGGCTCAA AACTTCCCAGGTAAAACTATCATCTCTAACGCTTTGGCTGCTTATCCTATTGGTAACGAGGCTTTTGCTAATTTCGG TGCTTCTCAAAACGGTACTTTGAATCGTGGTAACAATGCTGATGATGGTGTTCCAAATATGTACGTTATGTGGCCTT GGGATTTCGTTCATTACGGTACTGAATACTACTCTTCTGGTACTCAAGCTTCTACTGTTAAATGTTCTGGAGAGAGA GATACTTCTTGTTCTGCTGGTAACGGTCAAGTTGGTGTTACTGCTGGTCACTTTTCTAATTTCGGTATTGCTATGGG TATGGCTGGTTGT >SEQ ID NO: 17 GCTCCTGCTTCTAATGATGCTACTATTGCTGATGTTTCTTCTACTTTCACTTTGCCACCTATTATTAAGGATAGAGT TGCTTTTTCTAACGATATCGCTGATACTGATTACTTCAACTTGACTAAGAGAGCTTCTGAAACTGTTGGTGGTAATA CTATGGATTTGCCATCTAACGCTCCAGCTTTGCCTGCTGTTCCAAAGGCTGGAGATGTTGTTATTGCTACTGCTGCT CAAATTGCTGAGTACAAGAAATATGCTGCTTTGGCTTCTACTGCTTACTGTAGATCTGTTGTTCCTTTGAATTTGTG GACTTGTGTTAACTGTTTGAGATTTGCTCCAGATGGTAAATTGATTAAAACTTTCTCTTCTGTTATTTCTGATACTA ACGGTTTCGTTTTGAGATCTGATGCTCAAAAGACTATCTACGTTGTTTTCAGAGGTACTAACTCTATCAGATCTGCT ATCACTGATTTGGTTTTTACTTTGATCTCTTACCCACCTGTTTCTGGTGCTAGAGTTCATACTGGTTTCTACGCTTC TTATCAAGCTGTTGTTTCTGATTACTTTCCTGTTGTTCAATCTCAATTGACTTCTTACCCATCTTATAAGGTTGTTG TTACTGGTCATTCTTTGGGTGGTGCTCACGCTTTGTTGGCTGGTATGGATTTGTACCAAAGAGAAAAGAGATTGACT GCTTCTAATTTGTTTATTCACACTGCTGGTTGTCCTAGAGTTGGTAATCCAACTTTCGCTAACTACGTTGCTTCTAC TGGTATCACTTTTACTAGATCTGTTAACCAAAGAGATATTGTTCCTCATGTTCCACCTACTTACGCTGGTTATTTGC ACCCAGGTGTTGAAGTTTGGGCTAGAACTTCTTCTACTGTTCAAATCTGTACTTCTAACACTGAATCTAACATGTGT TCTAACTCTATCGAGCCTTTTACTTCTTTCACTGATCATTTGTCTTACTATGGTATTACTGAGGGTGTTTGTATT >SEQ ID NO: 18 TCTCCAGTTCAATTGGCTAGAAGAGCTATTTCTTCTGAATTGTTGGAGAGATTCACTTTGTTCTCTCAATTTGCTAC TTTGTCTGCTTGTGATCAAAACATCAACCATACTGGTCAATCTTTGACTTGTGATTACGGTACTTGTGGTTTGGTTG CTGCTGATAACACTACTGTTATTAATGCTTTCCATTCTGATAACGGTCCTACTGGTTATATTGCTTTGGATCACACT AGACAATTGATCGTTTTGACTTTTAGAGGTACTGTTTCTAAGTCTGATGGAGATACTGATTTGGATATCGTTTTGAC TTCTATCGATGATGTTTGTACTGGTTGTAAAGCTCATCACGGTTTCTGGGTTTACTGGTCTGCTGTTGCTTCTCAAG CTACTACTCAATTGCAAGATGCTACTTCTGCTTACCCATCTTATAGATTGTCTGTTGTTGGTCATTCTTTGGGTGGT GGTATTGCTGCTTTGGCTGGTACTGTTTTGAGAACTCAAGGTTTCACTTTGGATATTTGGACTTTTGGTGGTCCAAA GCCTGGTAACTTGAAGTTGGCTGAATTCATTACTAACCAACAACCACCTAATTCTATCTACAGAGCTACTCACACTA CTGATCCAATTCCTAAGGTTCCATTGAATTTGCCATTTTTGGATTGGTCTCAACCATCTCCTGAATACTGGATTACT CAAGAGACTGGTGTTCAAGTTACTACTGATGGTGTTGAATACATCGAGGGTATTAACTCTAAAGCTGGTAATGCTGG TTCTGATAGAGATTTGAGATGGCCAAACCCTGAGCACGGTTGGTATTTTGGTAATATGTCTGTTTGTGCTTCTCCTT CTGATGCTTCTTCT >SEQ ID NO: 19 GCTCCTTCTCAATTGGTTCCAAGAGCTGTTTCTTCTGGTACTTTGGATCAATTGACTTTGTTTGCTCAATACTCTGC TGCTTCTTATTGTGCTAACAATGTTAACTCTCCTGGAGATGCTATTACTTGTTCTGGTGGTTACTGTCCAAAGTTGC AATCTGCTGGTGTTAAGTCTTTGTTCGAATTCGATGATTCTACTGAGTTTGGAGATGTTGCTGGTTTCTTGTCTGTT GATACTGCTAATAAGTTGTTGGTTTTGTCTTTTAGAGGTTCTAGAACTATCTCTAACTGGATCGCTAATTTGGATTT CGGTCAAGCTGATGCTTCTTCTTTGTGTATTGGTTGTAAGGCTCATTCTGGTTTCTTGAAAGCTTGGACTGTTGTTT CTGATGATGTTATGCCACCTTTGGTTTCTGCTATGGCTAAATACCCTGGTTTTAGATTGGTTTTGACTGGTCACTCT TTCGGTGGTGCTGTTGCTGCTTTGGGTGCTACTGCTTTGAGAAAGGCTGGTTACAAGTTGGATTTGTACACTTACGG TCAACCAAGAGTTGGTAACACTGCTTTGGCTACTTACATGACTAATCAAGGTTCTATGTACAGAGTTACTCATTCTA ACGATATCGTTCCTAAGTTGCCACCTCCATTGTTGGGTTACACTCACGCTTCTCCAGAATATTGGATTACTTCTGGA GATAACGTTGCTGTTACTACTAAGGATATCACTCAAGTTAACGGTATCGGTTCTAAAGATGGTAACGCTGGTTCTAA TGGAGATTCTATTCCTGCTCATAACTGGTATATTGTTAATATTGATGGTTGTAAA >SEQ ID NO: 20 GCTCCACAAAAGAGATCTGTTTCTTCTACTGTTTTGGCTCAATTGTCTAGATACGCTCAATGGTCTGCTGCTGCTTA TTGTTCTGGTAACACTTCTGGTGCTAATCAAGTTGTTTCTTGTTCTGCTAACAATTGTCCTGATGTTCAAGCTTCTG GTGCTACTATGTTGTACGAATTCGATTCTACTAACACTTACGGAGATGCTGCTGGTTTCTTGGCTGCTGATACTACT CAACAACAAATCATCTTGTCTTTTAGAGGTTCTAGAACTACTTCTAACTGGATTGCTAATTTGGATACTGAATTGAC TTCTTCTACTTTGTGTTCTGGTTGTGAGGTTCATCAAGGTTTCTGGTTGGATTACCAAACTGTTGCTGCTACTTTGA AAGCTCAAATTGATGCTGCTTTGAATACTTACCCAGGTTATTCTTTGGTTGTTACTGGTCACTCTTTGGGTGGTGCT TTGGCTATGTTGGCTGGTTTGGATTTGAACTCTCAAGGTTACGCTCCAACTATCTACACTTATGGTCAACCTAGAGT TGGTAATTTGGCTTTGGCTCAATACATCACTAACGTTGGTAACCAATGGAGAGTTACTCATGCTGATGATGCTGTTC CAAAGTTGCCACCTAGATTGTTTGGTTTCTCTCACGCTTCTCCTGAGTACTGGATTACTTCTGGAGATAACGTTGCT GTTACTACTGGAGATGTTACTGTTGTTACTGGTGTTAACTCTTTGGGTGGTAATGATGGTACTTTGACTGCTTCTGT TTCTGCTCATAACTGGTATTTGGTTGATATCGATGCTTGTAAA >SEQ ID NO: 21 GCTCCAGCTTTGCCTTTGGAAGTTAGAGATTCTGGTGTTTCTCAAGCTGTTTACGATGATTTGGTTGTTTACGCTAA GTATTCTTCTGCTGTTTATCAACCATTTTGTCCAAGACCTTTGGGTTCTTGGATGATTAAGGCTTTTGATACTAAAG GTACTCAAGGTTTCGTTGCTAGAGATGATGCTAGAAAGGAAATCATCGTTGCTTTTAGAGGTTCTTTCGAGATTGTT GATATCTTGATCGATATCCAAATCATCTTGACTCCATTGTCTACTCCTGGTGTTTCTAACGTTGGTTCTGCTAGAGT TCATACTGGTTTCCAAAAGGCTTACAACTTCGTTATCGATGAGGTTCAATCTTTGATGAAGTCTCAAATCGATGCTT ACCCTTCTTACAAGTTGGTTGTTACTGGTCACTCTTTGGGTGGTGCTGTTGCTACTTTCGCTGCTTTGGCTTTGAAG TCTAAGTACCCATCTAAGTCTTTGAGATTGTTTACTTACGGTGCTCCTAGAGTTGGAGATGCTGCTTTCGCTTCTTT GGTTGAATCTAGATTGGGTATTAACAACATCTACAGAGGTGTTCATACTTGGGATGGTGTTCCAACTTTGTTGGGTA GATGGTTGGGTTACAGACATTATGGTACTGAGTATTGGCAACACAAGGATCCATCTAAACCTGAAAACGTTAGAAAG TGTAATGGTGGAGAGGATACTTCTTGTTCTAACTCTATCATCTCTACTGGTATTAATCCACCTCACGCTTTTCAATT CGGTCAAGTTATGGCTATTAACCCTTTGTTGTGTTTT >SEQ ID NO: 22 ATGGTTTCTTTCGGTGCTAGAATTAAGGATTTCTTTTCTGTTTTGTTGTTTGGTGCTGCTTCTACTTCTTCTTCTAC TAAAACTGCTTTGGTTTCTCAAGGTTTTTATGATGCTGCTTTGGATTTCTCTCATTTGTCTAACATCGCTTACTGTG TTAACGCTCCAATTACTCCTTTGAAGTCTGATTTTTCTTGTGGTCAATCTTGTGTTCATTTCCCAGATATTGAATTG GTTCACATTTTTGGTGGAGATTTCTTTTCTACTTCTATCACTGGTTATTTGGCTTTGGATCACGTTAAGAAAGAGAA GTACGTTGTTTTTAGAGGTACTTTCTCTATCGCTGATGCTATCACTGATATCCAATTCCAACAATCTTCTTTCTTGG TTAACGTTCCAGCTTTGAATACTTTCACTGCTAACGATACTGCTCCTGAAGCTCAAATCGATTGTAAGCAGTGTAAG ATTCACGATGGTTTTTCTAAGGCTTTCACTGAAACTTGGCATAACATTGGAGATTTGTTGGAGCAACACTTGGATTC TTACCCAGATTATCAATTGTACGTTACTGGTCACTCTTTGGGTGCTGCTATGGCTTTGTTGGGTGCTACTTCTATTA AGTTGAGAGGTTACGATCCAATCTTGATTAATTACGGTCAACCTAGAGTTGGTAACAAAGCTTTCGCTGATTATATT TCTGCTTTGTGGTTTGGTAATGGAGATGGTTTGGAAATTAACCAACAAAGAAGATTGTACAGAATGACTCATTGGAA CGATGTTTTCGTTGGTTTGCCTAACTGGGATGGTTACACTCACTCTAACGGAGAGGTTTACATCAAGGGTAAATACG TTAACCCACCTTTGAAGGATGTTTTCTCTTGTGCTGGTGGTGAAAACTCTAAGTGTTACAGATCTGAGTTTAATTTG TTGGCTCAAATTAACTTGTTGCAAAACCATTTGTGTTACATCGATTACATCGGTTTCTGTGCTTTGAACGTTGGTAG AAGAGAGTTGAATGATTTGCCACATTACAACGGTCCTTACAAGTATGGTCACAAAACTGAAGAGCAATTCATTGCTG AAGGTTTGGAGTTGTCTAAT >SEQ ID NO: 23 ATGGTCCTGTCCACTGTTATCGGAGAATGGTTTTCAAGAGTTTTGTTTGGTACTGTCGCCCCATCACCACTCACCGC CACAGCCCCCATTTCTCAGGACTTCTACGATACCGCTCTCACGTTCTCTCACCTATCTAATGTTGCTTACTGTATCA ACACCCCTCTTGAGTCCCTCAAGTCCGACTTTTCCTGCGGTGTCGCATGTTCTCACTTCCCAAACATGGAACTTGTT GAAGAGTTCGGTGGAGAATTTTTCGAAACTTCTATTACTGGTTTTCTATCTATCGACCATGTCAAAAAGGAAAAGTA CGTTGTGTACAGAGGCACCTATGACATTGGTGACGTTTATACTGACATTCAATTAAGCCAATCCCCATTCTTGGTTA CCCCTTCTGCCCTGGGTTCTACAGCAAATCTGTGTGAGGGTTGTACTATCCACGATGGTTGGAACAAAGCATACAAC GAAACCATGGGTATTATCGGAGACAAGCTCGCTGACCACGTTAACTCCAACCCAGATTACAGATTGGTCGTAACTGG ACATTCACTTGGTGCTGCTATTGCTGTACTATCTGCAACCTCTCTTAAGGTCAATGGCCAAGATCCTTACCTTTACA CTTACGGTCAGCCTCGTATTGGTAATGCTAACTTCGCAAACTTTGTGAGTAAGCAATGGTTCGGTGAGGGTGACGGT CTATCTATGGACTCGGACAGACGTTATTTCAGACTGACTCACTGGAACGACCTCTTTGTTGGTTTCCCTGCTTTCAA GGACTACGTGCACTCTGTCGGAGAGATTTACATAGACTATTTCACCGTTCAACCACCACTCAACAAAGTTTTCTCTT GTGCTGGGCCTGAGTCTATGTCCTGTTACAGAAAGGACTTCAACGCCCTTGCTAGACTTGATATTGTGAAAAACCAC CTAGCTTACTTCGATTGGATCTCTCTGTGCACCCTAAACATCGGCAGACGTGATCTGGAGAGGGGTAGAAAGTTCGA GGGTACTTGGCTCTACGGTGGACTGGCTAACGGATCCACTATCTTC