CHEMICAL CROSSLINKERS
20180185503 ยท 2018-07-05
Assignee
Inventors
Cpc classification
A61K47/64
HUMAN NECESSITIES
A61K38/47
HUMAN NECESSITIES
C12N9/96
CHEMISTRY; METALLURGY
C12N9/2465
CHEMISTRY; METALLURGY
C12N9/20
CHEMISTRY; METALLURGY
A61K38/30
HUMAN NECESSITIES
C07K14/65
CHEMISTRY; METALLURGY
A61K47/60
HUMAN NECESSITIES
International classification
A61K47/64
HUMAN NECESSITIES
C12N9/20
CHEMISTRY; METALLURGY
C12N9/96
CHEMISTRY; METALLURGY
C07K14/65
CHEMISTRY; METALLURGY
A61K38/30
HUMAN NECESSITIES
A61K38/47
HUMAN NECESSITIES
Abstract
Disclosed herein are methods of chemical conjugation comprising contacting a lysosomal enzyme with a first crosslinking agent to introduce aldehyde groups; contacting a lysosomal targeting peptide with a second crosslinking agent to introduce a hydrazide group at the N-terminal residue; contacting the lysosomal enzyme with aldehyde groups of step a. with the lysosomal targeting peptide with a hydrazide group at the N-terminal residue of step b; and forming a lysosomal enzyme-lysosomal targeting peptide conjugate.
Claims
1: A method of chemical conjugation comprising: a. contacting a lysosomal enzyme with a first crosslinking agent to introduce aldehyde groups; b. contacting a lysosomal targeting peptide with a second crosslinking agent to introduce a hydrazide group at the N-terminal residue; c. contacting the lysosomal enzyme with aldehyde groups of a with the lysosomal targeting peptide with a hydrazide group at the N-terminal residue of b; and d. forming a lysosomal enzyme-lysosomal targeting peptide conjugate. wherein the second crosslinking agent is a bifunctional crosslinker comprising acetone-, dimethylbenzyloxycarbonyl-, trimethylbenzyloxycarbonyl-protected hydrazide groups, or any combination thereof.
2: The method of claim 1, wherein the bifunctional crosslinker comprises Acetone-protected NHS-PEG.sub.4-hydrazide, Dimethylbenzylcarbonyl-protected NHS-PEG.sub.4-hydrazide, Trimethylbenzyloxycarbonyl-protected NHS-PEG.sub.4-hydrazide, or any combination thereof.
3: A method of making a modified lysosomal targeting peptide, comprising: contacting a lysosomal targeting peptide with a crosslinking agent to introduce a hydrazide group at the N-terminal residue.
4: The method of claim 3 wherein the lysosomal targeting peptide is vIGF2, claim 5: The method of claim 3, wherein the crosslinking agent comprises N-tert-butoxycarbonyl (tBoc)-protected hydrazide crosslinker (NHS-PEG4-tBoc-hydrazide).
6: The method of claim 3, wherein the crosslinking agent comprises acetone-, dimethylbenzyloxycarbonyl-, trimethylbenzyloxycarbonyl-protected hydrazide groups, or any combination thereof.
7: The method of claim 3, wherein the bifunctional crosslinker comprises Acetone-protected NHS-PEG.sub.4-hydrazide, Dimethylbenzylcarbonyl-protected NHS-PEG.sub.4-hydrazide, Trimethylbenzyloxycarbonyl-protected NHS-PEG.sub.4-hydrazide, or any combination thereof.
8: The method of claim 3, further comprising deprotecting the protected hydrazide groups of the modified lysosomal targeting peptide.
9: A method of linking one or more lysosomal targeting peptides to a lysosomal enzyme comprising: a. deprotecting a hydrazide-modified lysosomal targeting peptide in solution to form a deprotected hydrazide-modified lysosomal targeting peptide; b. and linking at least one deprotected hydrazine modified lysosomal targeting peptide to a lysosomal enzyme.
10: The method of claim 9, wherein the lysosomal targeting peptide is vIGF2.
11: The method according to claim 9, wherein the lysosomal enzyme comprises acid -glucosidase (rhGAA), acid -galactosidase A (GLA), acid -glucuronidase (GUS), acid -iduronidase A (IduA), acid iduronidate 2-sulfatase (I2S), -hexosaminidase A (HexA), -hexosaminidase B (HexB), acid -mannosidase A, -glucocerebrosidase (GlcCerase), acid lipase (LPA), or any combination thereof.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0013] The present disclosure is further understood when read in conjunction with the appended drawings. For the purpose of illustrating the subject matter, there are shown in the drawings exemplary embodiments of the subject matter; however, the presently disclosed subject matter is not limited to the specific methods, devices, and systems disclosed. In addition, the drawings are not necessarily drawn to scale. In the drawings:
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
DETAILED DESCRIPTION OF ILLUSTRATIVE EMBODIMENTS
[0023] The present subject matter can be understood more readily by reference to the following detailed description which forms a part of this disclosure. It is to be understood that this invention is not limited to the specific products, methods, conditions or parameters described and/or shown herein, and that the terminology used herein is for the purpose of describing particular embodiments by way of example only and is not intended to be limiting of the claimed invention.
[0024] Unless otherwise defined herein, scientific and technical terms used in connection with the present application shall have the meanings that are commonly understood by those of ordinary skill in the art. Further, unless otherwise required by context, singular terms shall include pluralities and plural terms shall include the singular.
[0025] As employed above and throughout the disclosure, the following terms and abbreviations, unless otherwise indicated, shall be understood to have the following meanings.
[0026] In the present disclosure the singular forms a, an, and the include the plural reference, and reference to a particular numerical value includes at least that particular value, unless the context clearly indicates otherwise. Thus, for example, a reference to a compound is a reference to one or more of such compounds and equivalents thereof known to those skilled in the art, and so forth. The term plurality, as used herein, means more than one. When a range of values is expressed, another embodiment includes from the one particular and/or to the other particular value. Similarly, when values are expressed as approximations, by use of the antecedent about, it is understood that the particular value forms another embodiment. All ranges are inclusive and combinable.
[0027] The chemical conjugation approach can be improved by novel bifunctional crosslinkers which can be utilized for modification of vIGF2 peptide to introduce a protected hydrazide group. The acid labile protecting groups can be efficiently removed using mild acidic buffers for better recovery of modified vIGF2 peptide. The deprotected hydrazide-modified vIGF2 peptide can then be lyophilized and stored as a dried powder to preserve the chemical reactivity of the hydrazide moiety. The deprotected hydrazide-modified vIGF2 peptide can be stored indefinitely until chemical coupling to lysosomal enzymes. These novel crosslinkers can therefore provide significantly more stable components and better control of chemical conjugation process to enable scale up of process.
[0028] This chemical conjugation approach involves modifying the amino (N)-terminus and one or more lysine residues on a recombinant human lysosomal enzyme using a first crosslinking agent to introduce novel acetone-protected hydrazide groups on recombinant human lysosomal enzymes. The first crosslinking agent modified recombinant human lysosomal enzyme can then be purified to remove excess crosslinkers and reaction byproducts. The purification can be performed using acidic pH buffers which preserves catalytic activity for lysosomal enzyme and displaces the acetone protecting group to expose the chemically reactive hydrazide groups. Separately, the amino (N)-terminus of a short extension linker region preceding vIGF2 peptide can be modified using a second crosslinking agent to introduce novel chemically reactive aldehyde group on vIGF2 peptide. The modified vIGF2 peptide can then be purified to remove excess crosslinkers and reaction byproducts and then lyophilized. In a final coupling reaction, the hydrazide-modified recombinant human lysosomal enzyme can be added directly to the lyophilized aldehyde-modified vIGF2 peptide to generate the vIGF2-enzyme conjugate. While this method is effective to generate vIGF2-enzyme conjugates, the final chemical conjugation reaction is preferably performed rapidly because the introduced hydrazide groups are not stable in aqueous solutions and thus, the chemical reactivity is diminished over a relatively short time (within 1-2 days). The scale up of process can therefore be challenging if the modification of lysosomal enzymes with bifunctional crosslinker and purification of hydrazide-modified lysosomal enzymes cannot be quickly completed (preferably within 1 day).
[0029] It would be preferable to change the order of modification whereby the lysosomal enzyme can be modified with a crosslinking agent to introduce aldehyde groups and the vIGF2 peptide would be modified with a crosslinking agent to introduce hydrazide. However, a majority of hydrazide-containing crosslinkers such as succinimidyl 6-hydrazinonicotinate acetone (S-Hynic) or related crosslinkers cause aggregation and/or precipitation of vIGF2 peptide and lead to significant loss of peptide. Appropriate crosslinkers and methods to modify vIGF2 peptide with bifunctional crosslinkers to introduce a protected hydrazide group on vIGF2 peptide are provided herein. The protecting group can be subsequently removed by incubation in acidic buffers and the hydrazide-modified vIGF2 peptide can be purified by reverse phase chromatography on HPLC. The purified hydrazide-modified vIGF2 peptide can then be lyophilized and stored as a dried powder. This strategy ensures that the hydrazide group remains chemically active for coupling to lysosomal enzymes. In a separate reaction, a recombinant lysosomal enzyme can be modified with a crosslinking agent to introduce novel aldehyde groups. After purification to remove excess crosslinker and reaction byproducts, the aldehyde-modified lysosomal enzymes can then be stored until coupling to vIGF2 peptide because the introduced aldehyde groups are chemically stable in aqueous solutions. This new strategy provides hold steps in the process where individual components (modified lysosomal enzyme and modified vIGF2) can be stored indefinitely until coupling to generate the vIGF2-enzyme conjugates. This new method therefore generates the individual components with substantially higher stability and provides better overall control of conjugation process which is conducive to scale up of process.
[0030] Suitable methods of chemical conjugation can comprise a) contacting a lysosomal enzyme with a first crosslinking agent to introduce aldehyde groups; b) contacting a lysosomal targeting peptide with a second crosslinking agent to introduce a hydrazide group at the N-terminal residue; contacting the lysosomal enzyme with aldehyde groups of step a) with the lysosomal targeting peptide with a hydrazide group at the N-terminal residue of step b); and forming a lysosomal enzyme-lysosomal targeting peptide conjugate.
[0031] The lysosomal targeting peptide may suitably comprise variant insulin-like growth factor 2 (vIGF2), preferably a variant of human insulin-like growth factor 2. In one embodiment, such a variant IGF 2 may include amino acid deletions and substitutions that permit vIGF2 peptide to maintain high affinity for the IGF-2/CI-MPR while reducing peptide binding affinity to IGF-1 and Insulin receptors. For example, the deletions and substitutions may comprises one or more of the following changes: deletion of N-terminal amino acid residues 1-4 since these residues are not needed for binding intended IGF2/CI-MPR receptor and also eliminates a proline at position 4 and the associated bend or kink in the protein at the N-terminus; glutamic acid residue at position 6 of wildtype human IGF2 substituted with arginine for reducing or eliminating peptide binding to serum IGF binding proteins (IGFBPs), tyrosine residue of wildtype human IGF 2 at position 27 substituted with leucine for reducing or eliminating peptide binding the insulin and IGF-1 receptors, and the lysine residue at position 65 of human IGF-2 substituted with arginine to prevent chemical modification of peptide at that position.
[0032] In still further embodiments, the variant IGF2 can include or be one of the following sequences:
TABLE-US-00001 SEQIDNO:1 AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRS CDLALLETYCATPAKSE SEQIDNO:2 SRTLCGGELVDTLQFVCGDRGFLFSRPASRVSRRSRGIVEECCFRSCDLA LLETYCATPARSE SEQIDNO:3 GGGGSRTLCGGELVDTLQFVCGDRGFLFSRPASRVSRRSRGIVEECCFRS CDLALLETYCATPARSE SEQIDNO:4 GGGGSGGGGSRTLCGGELVDTLQFVCGDRGFLFSRPASRVSRRSRGIVEE CCFRSCDLALLETYCATPARSE
[0033] Suitable first crosslinking agents include N-succinimidyl-4-formylbenzamide (S-4FB). A suitable second crosslinking agent includes N-tert-butoxycarbonyl (tBoc)-protected hydrazide crosslinker (NHS-PEG4-tBoc-hydrazide) or a methoxybenzyloxy carbonyl (BOM)-protected hydrazide (NHS-PEG4-BOM-hydrazide). In other suitable embodiments the second crosslinking agent can include acetone-, dimethylbenzyloxycarbonyl-, trimethylbenzyloxycarbonyl-protected hydrazide groups, or any combination thereof. In other suitable embodiments the bifunctional crosslinker can include acetone-protected NHS-PEG4-hydrazide, dimethylbenzylcarbonyl-protected NHS-PEG4-hydrazide, trimethylbenzyloxycarbonyl-protected NHS-PEG4-hydrazide, or any combination thereof.
[0034] Suitable lysosomal enzymes include acid -glucosidase (rhGAA), acid -galactosidase A (GLA), acid -glucuronidase (GUS), acid -iduronidase A (IduA), acid iduronidate 2-sulfatase (I2S), -hexosaminidase A (HexA), -hexosaminidase B (HexB), acid -mannosidase A, -glucocerebrosidase (GlcCerase), acid lipase (LPA), or any combination thereof. In other suitable embodiments the lysosomal enzyme can be mammalian and the mammalian lysosomal enzyme can be human.
[0035] The lysosomal targeting peptide with a hydrazide group at the N-terminal residue is typically added to the lysosomal enzyme at about four-fold molar excess. Aniline can also be suitably added at that time. The methods provided herein can further comprise one or more purification steps of the lysosomal enzyme-lysosomal targeting peptide conjugate. For example, purification can be carried out using size-exclusion chromatography.
[0036] The methods provided herein can further comprise evaluating the lysosomal enzyme-lysosomal targeting peptide conjugate's ability to bind the IGF2/CI-MPR receptor. Binding of the lysosomal enzyme-lysosomal targeting peptide conjugate typically saturates at or above about 25 nM of lysosomal enzyme-lysosomal targeting peptide conjugate. Accordingly, the lysosomal enzyme-lysosomal targeting peptide conjugate can maintain the correct protein confirmation by enabling high affinity binding to the IGF2/CI-MPR receptor.
[0037] Suitable bifunctional crosslinkers can comprise acetone-, dimethylbenzyloxycarbonyl-, trimethylbenzyloxycarbonyl-protected hydrazide groups, or any combination thereof. In other suitable embodiments the bifunctional crosslinker can comprise Acetone-protected NHS-PEG4-hydrazide, Dimethylbenzylcarbonyl-protected NHS-PEG4-hydrazide, Trimethylbenzyloxycarbonyl-protected NHS-PEG4-hydrazide, or any combination thereof.
[0038] Suitable modified lysosomal targeting peptides can comprise a protected hydrazide group. In other suitable embodiments the modified lysosomal targeting peptide can comprise modified vIGF2 peptide. In other suitable embodiments the hydrazide group is protected by acetone-, dimethylbenzyloxycarbonyl-, trimethylbenzyloxycarbonyl-groups, or any combination thereof. In other suitable embodiments the modified lysosomal targeting peptide is in a powder. In other suitable embodiments the modified lysosomal targeting peptide is lyophilized.
[0039] Suitable methods of making a modified lysosomal targeting peptide include contacting a lysosomal targeting peptide with a crosslinking agent to introduce a hydrazide group at the N-terminal residue. A suitable lysosomal targeting peptide is vIGF2. A suitable crosslinking agent includes N-tert-butoxycarbonyl (tBoc)-protected hydrazide crosslinker (NHS-PEG4-tBoc-hydrazide). The crosslinking agent can comprise acetone-, dimethylbenzyloxycarbonyl-, trimethylbenzyloxycarbonyl-protected hydrazide groups, or any combination thereof. The bifunctional crosslinker can comprises acetone-protected NHS-PEG4-hydrazide, dimethylbenzylcarbonyl-protected NHS-PEG4-hydrazide, trimethylbenzyloxycarbonyl-protected NHS-PEG4-hydrazide, or any combination thereof. The methods provided herein can further comprise deprotecting the protected hydrazide groups of the modified lysosomal targeting peptide. As well, a further step of lyophilizing the modified lysosomal targeting peptide can be implemented to form a powder.
[0040] Suitable methods of linking one or more lysosomal targeting peptides to a lysosomal enzyme can comprise deprotecting a hydrazide-modified lysosomal targeting peptide in solution to form a deprotected hydrazide-modified lysosomal targeting peptide; and linking at least one deprotected hydrazine modified lysosomal targeting peptide to a lysosomal enzyme. The lysosomal targeting peptide can comprise vIGF2, and the lysosomal enzyme can comprise acid -glucosidase (rhGAA), acid -galactosidase A (GLA), acid -glucuronidase (GUS), acid -iduronidase A (IduA), acid iduronidate 2-sulfatase (I2S), -hexosaminidase A (HexA), -hexosaminidase B (HexB), acid -mannosidase A, -glucocerebrosidase (GlcCerase), acid lipase (LPA), or any combination thereof.
[0041] Suitable lysosomal enzyme-lysosomal targeting peptide conjugates can comprise a lysosomal enzyme crosslinked to one or more lysosomal targeting peptides (e.g., vIGF2) via one or more bifunctional crosslinkers. Suitable bifunctional crosslinkers can comprise acetone-protected NHS-PEG4-hydrazide, dimethylbenzylcarbonyl-protected NHS-PEG4-hydrazide, trimethylbenzyloxycarbonyl-protected NHS-PEG4-hydrazide, N-succinimidyl-4-formylbenzamide (S-4FB), or any combination thereof. The lysosomal enzyme suitably comprises acid -glucosidase (rhGAA), acid -galactosidase A (GLA), acid -glucuronidase (GUS), acid -iduronidase A (IduA), acid iduronidate 2-sulfatase (I2S), -hexosaminidase A (HexA), -hexosaminidase B (HexB), acid -mannosidase A, -glucocerebrosidase (GlcCerase), acid lipase (LPA), or any combination thereof.
EXAMPLES
[0042] The following examples, while illustrative individual embodiments, are not intended to limit the scope of the described invention, and the reader should not interpret them in this way.
Example 1
[0043] A new chemical conjugation approach was utilized for chemical coupling of vIGF2 peptide onto lysosomal enzymes to increase their binding to the IGF2/CI-MPR receptor. This approach is different from what had been previously described such that the lysosomal enzymes are modified with a first crosslinking agent to introduce aldehyde groups while vIGF2 peptide is modified with a second crosslinking agent to introduce a hydrazide group at the N-terminal residue. Specifically, recombinant wildtype human acid -glucosidase (rhGAA) was concentrated to 7.5 mg/ml via a concentrator device equipped with a 50 kDa molecular weight cutoff membrane and then buffer exchanged into 50 mM sodium phosphate (pH 6.5)/100 mM NaCl/0.05% polysorbate-80 by dialysis at 4 C. overnight. rhGAA was then chemically modified with a 20-fold molar excess of N-succinimidyl-4-formylbenzamide (S-4FB; Solulink) crosslinker for 2 hrs at ambient temperature to introduce novel benzaldehyde groups. The benzaldehyde-modified rhGAA is then purified in 50 mM NaOAc (pH 4.8)/50 mM NaCl buffer to remove excess crosslinker and reaction byproducts and stored at 4 C. until chemical coupling to vIGF2 peptide.
[0044] In a separate reaction, purified vIGF2 peptide was reconstituted at 0.6 mg/ml in 50 mM sodium phosphate (pH 7.5)/50 mM NaCl/0.05% polysorbate-80 and modified with a 20- to 40-fold molar excess of N-tert-butoxycarbonyl (tBoc)-protected hydrazide crosslinker (NHS-PEG4-tBoc-hydrazide; Quanta Biodesign). The modification of vIGF2 peptide was monitored using a using a 4.6250 mm, 5 m, 300 C4 Jupiter column (Phenomenex, Torrence, Calif.) on an Agilent Technologies (Palo Alto, Calif.) HPLC system (C4 RP-HPLC) as shown in
[0045] The benzaldehyde-modified rhGAA was chemically conjugated to the deprotected hydrazide-modified vIGF2 peptide in a final reaction by adding the lysosomal enzyme directly to the lyophilized peptide at a 4-fold molar excess of peptide. Aniline, a chemical catalyst of this reaction, was added to a final concentration of 10 mM and the reaction was incubated overnight at ambient temperature with gentle rocking. The vIGF2-rhGAA conjugate was purified the following day using size exclusion chromatography to remove excess vIGF2 peptide using 50 mM sodium phosphate (pH 6.2)/100 mM NaCl/0.05% (v/v) polysorbate-80 buffer.
[0046] To determine whether the modified vIGF2 peptide retained the correct protein structure after removal of the tBoc protecting group, the vIGF2-GAA conjugate was evaluated for its ability to bind the IGF2/CI-MPR receptor in plate binding assays as shown in
Example 2
[0047] The NHS-PEG4-tBoc-hydrazide crosslinker was shown to efficiently modify vIGF2 peptide to introduce novel hydrazide group while maintaining good solubility for the peptide. However, the tBoc protecting group was difficult to remove using mild acid conditions and used high concentrations of TFA (15%) and 4-hr incubations for deprotection. Under these harsh conditions, we were still only able to recover 50% of the deprotected hydrazide-modified vIGF2 peptide. The approach would be further improved if crosslinkers can be designed with more labile protecting groups for efficient removal and better recovery of modified peptide.
[0048] Novel bifunctional crosslinkers have been developed for efficient attachment to vIGF2 peptide and to introduce protected hydrazide groups while maintaining good solubility for peptide. These new crosslinkers contain acetone-, dimethylbenzyloxycarbonyl-, or trimethylbenzyloxycarbonyl-protected hydrazide groups as shown in
Example 3
[0049] Recombinant human acid -glucosidase (rhGAA) was concentrated to 8-10 mg/ml at small scale (i.e., <100 mg) using centrifugal concentrator devices (e.g., Amicon Ultra with 50 kDa nominal molecular weight cutoff (MWCO) membrane; Millipore) and then buffer exchanged into Modification Buffer [50 mM sodium phosphate (pH 6.5)/100 mM NaCl/100mM glucose/2% mannitol/0.05% polysorbate-80] via dialysis overnight at 4 C. For larger scale preparations (e.g., >200 mg rhGAA), protein concentration and buffer exchange can be achieved by diafiltration/concentration using a tangential flow filtration (TFF) system with a 50 kDa MWCO membrane. rhGAA protein concentration is determined by UV absorbance spectroscopy at 280 nm using the molar extinction coefficient (c) of 166,117 M.sup.1cm.sup.1. The rhGAA protein concentration was then adjusted to 7.5 mg/ml by dilution with Modification Buffer and incubated with a 25-fold molar excess of the bifunctional crosslinker succinimidyl 4-formylbenzoate (SFB) at about 20 C. for 4 hours to introduce novel benzaldehyde (aromatic aldehyde) groups on rhGAA. Benzaldehyde-modified rhGAA was dialyzed against 50 mM NaOAc (pH 4.8)/100 mM NaCl/0.05% polysorbate-80 at 4 C. with multiple changes of buffer to remove excess crosslinker and reaction byproducts. The chemically modified rhGAA is stable in this buffer and can be stored indefinitely until chemical conjugation to vIGF2 peptide. Importantly, the introduced benzaldehyde groups on rhGAA remain chemically reactive for conjugation to hydrazide- or aminooxy-modified vIGF2 peptide. We have also determined that benzaldehyde-modified rhGAA can be stored in 50 mM sodium phosphate (pH 6.0)/100 mM NaCl/0.05% polysorbate-80 with no adverse effects on GAA stability or coupling efficiency.
[0050] To determine the extent of chemical modification and to identify the specific amino acid residues that are modified, peptide maps from the benzaldehyde-modified rhGAA were generated and directly compared to the starting unmodified starting rhGAA sample by liquid chromatography/mass spectroscopy analysis (LC-MS). Briefly, a reference peptide map for the starting unmodified rhGAA sample was generated by digesting rhGAA into peptide fragments using a mixture of specific proteases followed by C18 reverse phase high performance liquid chromatography and analysis of individual peptide fragments by mass spectroscopy. Four different preparations of benzaldehyde-modified rhGAA were digested and processed in the same manner and compared to the reference peptide map for unmodified starting rhGAA. Our LC-MS results indicate that an average of approximately 2 novel benzaldehyde groups is introduced on rhGAA using this chemical modification procedure. Moreover, the LC-MS results show that chemical modification of rhGAA is not randomly distributed across the different lysine residues in rhGAA. Rather, chemical modification of rhGAA appears to be much more ordered and confined to a few lysine residues as shown in Table 1. The LC-MS data show that 90% of Lys.sup.902 is modified with the benzaldehyde moiety while approximately 50% of Lys.sup.732 and Lys.sup.838 are modified. A significantly smaller fraction of Lys.sup.113(8%) and Lys.sup.161 (17%) are modified under these experimental conditions. The experimental error for this LC-MS analysis was estimated to be 10%.
TABLE-US-00002 TABLE 1 Identification of chemically modified amino acid residues in rhGAA Residues Modified Estimated Modified GAA Batch Lys.sup.113 Lys.sup.161 Lys.sup.732 Lys.sup.848 Lys.sup.902 Residues A (Feb. 1, 2013) 8% 17% 53% 40% 90% 2.11 B (Apr. 4, 2013) 9% 16% 52% 45% 89% 2.14 C (Apr. 9, 2013) 8% 17% 53% 40% 90% 2.11 D (Apr. 12, 2013) 6% 17% 53% 43% 89% 2.13 AVE 8 1.3% 17 0.6% 53% 0.6% 42% 2.4% 89% 0.5% 2.12
[0051] The LC-MS data were informative and have very important implications for the described chemical conjugation approach. There are 15 different lysine residues within rhGAA; each theoretically has the same potential for chemical modification. Our empirical data however are contrary to this hypothesis and show that the chemical modification process appears to be much more ordered than anticipated wherein only a few, select lysine residues were consistently modified with benzaldehyde groups for 4 different batches of SFB-modified rhGAA using the method described herein. Moreover, the LC-MS data indicate that there is preferential modification of lysine residues such that Lys.sup.902 is always modified with crosslinker while approximately half of Lys.sup.732 and Lys.sup.838 residues are modified with crosslinker. Only a small fraction of Lys.sup.113 and Lys.sup.161 were modified with benzaldehyde group. These data suggest that the observed preferential modification was dependent on the accessibility and chemical competency of individual lysine residues for chemical modification with crosslinker. For example, lysine residues may be protonated and involved with forming salt bridges (i.e., electrostatic interactions) with negatively charged aspartic acid or glutamic acid residues and not available for chemical modification. The LC-MS data suggest that Lys.sup.902is the most accessible and chemically competent for modification and likely the likely the first residue modified. Further, Lys.sup.732 and Lys.sup.838 are less accessible than Lys.sup.902 for chemical modification but Lys.sup.732 and Lys.sup.838 have similar accessibility relative to each other since an approximately equivalent fraction of each is modified. These data suggest that either Lys.sup.732 or Lys.sup.838 is the second lysine residue modified. Lys.sup.113 and Lys.sup.161 are only partially accessible for chemical modification such that only a small fraction of rhGAA contains benzaldehyde at these lysine residues. No chemical modification of the amino (N-)terminus was observed for rhGAA but this enzyme is known to be naturally modified (cyclized) in cells to form pyroglutamate that is not chemically competent for modification with bifunctional crosslinkers.
[0052] These collective data indicate that the described chemical modification procedure can be utilized to reproducibly yield rhGAA with an average of 2.12 introduced benzaldehyde groups for coupling to vIGF2 peptide. Since the number of vIGF2 peptide conjugated to rhGAA is dependent on the number of introduced benzaldehyde groups, these results indicate that an average of 2 vIGF2 peptides can be conjugated to rhGAA.
[0053] After chemical modification with SFB, benzaldehyde-modified rhGAA is very stable in slightly acidic buffers such as 50 mM sodium phosphate (pH 6.0)/100 mM NaCl/0.05% polysorbate-80 or 50 mM NaOAc (pH 4.8)/100 mM NaCl/0.05% polysorbate-80 and can be stored long-term prior to chemical conjugation which is highly desirable to enable scale up of this conjugation process.
Example 4
[0054] Benzaldehyde-modified rhGAA can be utilized for chemical conjugation to vIGF2 peptide via specific chemical groups such as hydrazide to form a hydrazone linkage as follows. Lyophilized, purified vIGF2 peptide was reconstituted at 0.6 mg/ml in 50 mM sodium phosphate (pH 7.5)/50 mM NaCl/0.05% polysorbate-80 and incubated with a 20-fold molar excess of the bifunctional crosslinker N-tert-butoxycarbonyl (tBoc)-protected hydrazide crosslinker (NHS-PEG4-tBoc-hydrazide; Quanta Biodesign) at ambient temperature to introduce a novel tBoc-protected hydrazide group at the N-terminus. The reaction was monitored by C4 reverse phase high performance liquid chromatography (C4 RP-HPLC) to assess the progression and extent of modification of vIGF2. C4 RP-HPLC method utilized a 4.6250 mm 5 m, 300 C4 Jupiter column (Phenomenex, Torrence, Calif.) on an Agilent Technologies (Palo Alto, Calif.) HPLC system consisting of a 1100 series quaternary pump, automated sampler, thermo stated column compartment and diode-array detector (DAD) with Agilent ChemStation Software (Rev. B.04.03). Mobile phases consisted of Buffer A: 0.1% trifluoracetic acid (TFA) in water and Buffer B: 0.1% TFA in acetonitrile (MeCN). Peptide samples were loaded onto C4 column pre-equilibrated with 26% acetonitrile (MeCN/0.1% TFA). After 2 minutes, the column was developed using a 26-33% linear gradient of MeCN/0.1% TFA over 13 minutes. As shown in
[0055] These collective data therefore confirm that this alternative chemical conjugation can be utilized for generating vIGF2-rhGAA enzyme conjugates which have substantially better binding to the intended IGF2/CI-MPR receptor for improved cellular uptake and delivery of therapeutic drug to lysosomes of target cells. This alternative chemical modification/conjugation procedure generates stable intermediate components that can be stored indefinitely prior to final chemical conjugation and purification. Different batches of stable intermediates can also be pooled to form larger batches for the final conjugation reaction. The methods described herein therefore represent important advancements to enable scale up chemical conjugation process for generating improved ERTs.
Example 5
[0056] In addition to utilizing tBoc-protected hydrazide crosslinkers for modification of vIGF2 peptide, other crosslinkers with different protection groups can also be utilized. We have chemically synthesized a bifunctional crosslinker containing a methylbenzyloxy carbonyl (BOM)-protected hydrazide (NHS-PEG4-BOM-hydrazide) for introducing a novel hydrazide group to the N-terminus of vIGF2 peptide. After removal of the BOM protection group, the chemically reactive hydrazide group is exposed for subsequent conjugation to benzaldehyde-modified lysosomal enzymes via a resultant hydrazone linkage as follows. Lyophilized, purified vIGF2 peptide was reconstituted at 0.6 mg/ml in 50 mM sodium phosphate (pH 7.5)/50 mM NaCl/0.05% polysorbate-80 and incubated with a 20-fold molar excess of NHS-PEG4-BOM-hydrazide at ambient temperature to introduce a novel BOM-protected hydrazide group at the N-terminus. The reaction was monitored by C4 RP-HPLC to assess the progression and extent of modification of vIGF2. A significant shift (increase) in the retention time is observed upon chemical modification of vIGF2 peptide to attach PEG4-BOM-hydrazide (
[0057] De-protected hydrazide-modified vIGF2 peptide can then be chemically conjugated to benzaldehyde-modified rhGAA as described above in Example 2 for tBoc-deprotected hydrazide-vIGF2 peptide. These data show that vIGF2 peptide can be chemically modified with bifunctional crosslinkers containing various protected hydrazide groups and after removal of protecting group, the same chemically reactive hydrazide was generated for conjugating vIGF2 peptide to benzaldehyde-modified lysosomal enzymes.
Example 6
[0058] Benzaldehyde-modified rhGAA can also be utilized for chemical conjugation to aminooxy-modified vIGF2 peptide via a very stable oxime linkage as follows. Lyophilized, purified vIGF2 peptide was reconstituted at 0.6 mg/ml in 50 mM sodium phosphate (pH 7.5)/50 mM NaCl/0.05% polysorbate-80 and incubated with a 20-fold molar excess of Phthalimidooxy-PEG12-NHS ester (Quanta Biodesign) at ambient temperature to introduce a novel phthalimidooxy group at the N-terminus. After completion of chemical modification of vIGF2 peptide (typically by 2 hrs), phthalimidooxy-modified vIGF2 peptide was then incubated with 0.5M hydrazine at ambient temperature for 30-60 min to convert the intermediate phthalimidooxy group to the desired aminooxy group. C4 RP-HPLC was utilized for monitoring the chemical modification reaction and the conversion of the phthalimidooxy group to aminooxy group. As shown in
[0059] vIGF2-rhGAA was characterized by receptor plate binding assays to determine whether the oxime-linked vIGF2 peptide would increase rhGAA binding to the intended IGF2/CI-MPR receptor. As shown in
Example 7
[0060] vIGF2 peptide can also be chemically conjugated to lysosomal enzymes via an oxime linkage using tBoc-protected aminooxy bifunctional crosslinker. This approach yields aminooxy-modified vIGF2 peptide for chemical conjugation to benzaldehyde-modified lysosomal enzymes without requiring chemical conversion using potentially dangerous hydrazine. Briefly, lyophilized, purified vIGF2 peptide was reconstituted at 0.6 mg/ml in 50 mM sodium phosphate (pH 7.5)/50 mM NaCl/0.05% polysorbate-80 and incubated with a 20-fold molar excess of the bifunctional crosslinker tBoc-protected aminooxy crosslinker (with either NHS- or pentafluorobenzene group) at ambient temperature to introduce a novel tBoc-protected aminooxy group at the N-terminus and monitored by C4 RP-HPLC. As shown in
Example 8
[0061] An alternative method to generate oxime linked vIGF2-rhGAA using a single crosslinker can be achieved by coupling aminooxy-modified vIGF2 peptide to chemically oxidized rhGAA as follows. rhGAA was buffer exchanged into 0.1M NaOAc (pH 5.2) via dialysis or size exclusion chromatography (SEC) and the protein concentration was adjusted to 5 mg/ml with same buffer. rhGAA was then incubated with 2mM sodium meta-periodate at 4 C. for 30 min to oxidize carbohydrates (mostly terminal sialic acids and galactose) on N-glycans of rhGAA to generate chemically reactive aldehyde groups for chemical conjugation to aminooxy-modified vIGF2 peptide. Chemically oxidized rhGAA was then dialyzed against 0.1M NaOAc (pH 5.2) or subjected to SEC to remove excess sodium meta-periodate. Oxidized rhGAA (stored at approximately 4 mg/ml) was added directly to the dry aminooxy-modified vIGF2 peptide at a molar ratio of 1 mole rhGAA:4 moles vIGF2 peptide and incubated at about 20 C. for approximately 16 hours to form the resultant oxime linkage. vIGF2 peptide-conjugated rhGAA was then purified by SEC in 50 mM sodium phosphate (pH 6.0)/100 mM NaCl/2% mannitol/0.05% polysorbate-80 buffer to remove excess vIGF2 peptide as described before.
[0062] vIGF2-rhGAA was characterized by receptor plate binding assays to determine whether the oxime-linked vIGF2 peptide would increase rhGAA binding to the intended IGF2/CI-MPR receptor. As shown in