IL-11RA ANTIBODIES
20180186872 ยท 2018-07-05
Assignee
Inventors
Cpc classification
C07K2319/75
CHEMISTRY; METALLURGY
C07K16/2866
CHEMISTRY; METALLURGY
A61P17/02
HUMAN NECESSITIES
C07K2317/24
CHEMISTRY; METALLURGY
A61P43/00
HUMAN NECESSITIES
C07K2317/76
CHEMISTRY; METALLURGY
C07K2317/92
CHEMISTRY; METALLURGY
C07K2319/32
CHEMISTRY; METALLURGY
International classification
C07K16/24
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
Abstract
IL-11Ra antibodies are disclosed. Also disclosed are compositions comprising the IL-11Ra antibodies, and methods using the IL-11Ra antibodies.
Claims
1-35. (canceled)
36. An antibody or antigen binding fragment, optionally isolated, which is capable of binding to IL-11R?, comprising a light chain variable region sequence and a heavy chain variable region sequence, wherein: the light chain variable region sequence has at least 80% sequence identity to the light chain variable region sequence of SEQ ID NO:7, and the heavy chain variable region sequence has at least 80% sequence identity to the heavy chain variable region sequence of SEQ ID NO: 16.
37. The antibody or antigen binding fragment according to claim 36, wherein: the light chain variable region sequence has at least 85% sequence identity to the light chain variable region sequence of SEQ ID NO:7, and the heavy chain variable region sequence has at least 85% sequence identity to the heavy chain variable region sequence of SEQ ID NO: 16.
38. The antibody or antigen binding fragment according to claim 36, wherein the light chain variable region sequence comprises the following CDRs: TABLE-US-00005 i) LC-CDR1: QSISNN; (SEQIDNO:33) ii) LC-CDR2: YAS; (SEQIDNO:34) and iii) LC-CDR3: QQRYSWPLT; (SEQIDNO:35) and wherein the heavy chain variable region sequence comprises the following CDRs: TABLE-US-00006 iv) HC-CDR1: GYTFTNYW; (SEQIDNO:60) v) HC-CDR2: IGPSDSKT; (SEQIDNO:61) vi) HC-CDR3: ARGDYVLFTY. (SEQIDNO:62)
39. The antibody or antigen binding fragment according to claim 36, which is capable of inhibiting IL-11 trans signalling.
40. The antibody or antigen binding fragment according to claim 36, wherein the antibody or antigen binding fragment is a humanised antibody or antigen binding fragment.
41. The antibody or antigen binding fragment according claim 36, conjugated to a drug moiety or a detectable moiety.
42. A method of treating fibrosis or a disease/disorder characterised by fibrosis, comprising administering an antibody or antigen binding fragment to a subject suffering from fibrosis or a disease/disorder characterised by fibrosis, wherein the antibody or antigen binding fragment is capable of binding to IL-11R?, and comprises a light chain variable region sequence and a heavy chain variable region sequence, wherein: the light chain variable region sequence has at least 80% sequence identity to the light chain variable region sequence of SEQ ID NO:7, and the heavy chain variable region sequence has at least 80% sequence identity to the heavy chain variable region sequence of SEQ ID NO: 16.
43. The method according to claim 42, wherein: the light chain variable region sequence has at least 85% sequence identity to the light chain variable region sequence of SEQ ID NO:7, and the heavy chain variable region sequence has at least 85% sequence identity to the heavy chain variable region sequence of SEQ ID NO: 16.
44. The method according to claim 42, wherein the light chain variable region sequence comprises the following CDRs: TABLE-US-00007 i) LC-CDR1: QSISNN; (SEQIDNO:33) ii) LC-CDR2: YAS; (SEQIDNO:34) and iii) LC-CDR3: QQRYSWPLT; (SEQIDNO:35) and wherein the heavy chain variable region sequence comprises the following CDRs: TABLE-US-00008 iv) HC-CDR1: GYTFTNYW; (SEQIDNO:60) v) HC-CDR2: IGPSDSKT; (SEQIDNO:61) vi) HC-CDR3: ARGDYVLFTY. (SEQIDNO:62)
45. The method according to claim 42, wherein the antibody or antigen binding fragment is capable of inhibiting IL-11 trans signalling.
46. The method according to claim 42, wherein the antibody or antigen binding fragment is a humanised antibody or antigen binding fragment.
47. The method according to claim 42, wherein the antibody or antigen binding fragment is conjugated to a drug moiety or a detectable moiety.
48. A method of treating cancer, comprising administering an antibody or antigen binding fragment to a subject suffering from cancer, wherein the antibody or antigen binding fragment is capable of binding to IL-11R?, and comprises a light chain variable region sequence and a heavy chain variable region sequence, wherein: the light chain variable region sequence has at least 80% sequence identity to the light chain variable region sequence of SEQ ID NO:7, and the heavy chain variable region sequence has at least 80% sequence identity to the heavy chain variable region sequence of SEQ ID NO: 16.
49. The method according to claim 48, wherein: the light chain variable region sequence has at least 85% sequence identity to the light chain variable region sequence of SEQ ID NO:7, and the heavy chain variable region sequence has at least 85% sequence identity to the heavy chain variable region sequence of SEQ ID NO: 16.
50. The method according to claim 48, wherein the light chain variable region sequence comprises the following CDRs: TABLE-US-00009 i) LC-CDR1: QSISNN; (SEQIDNO:33) ii) LC-CDR2: YAS; (SEQIDNO:34) and iii) LC-CDR3: QQRYSWPLT; (SEQIDNO:35) and wherein the heavy chain variable region sequence comprises the following CDRs: TABLE-US-00010 iv) HC-CDR1: GYTFTNYW; (SEQIDNO:60) v) HC-CDR2: IGPSDSKT; (SEQIDNO:61) vi) HC-CDR3: ARGDYVLFTY. (SEQIDNO:62)
51. The method according to claim 48, wherein the antibody or antigen binding fragment is capable of inhibiting IL-11 trans signalling.
52. The method according to claim 48, wherein the antibody or antigen binding fragment is a humanised antibody or antigen binding fragment.
53. The method according to claim 48, wherein the antibody or antigen binding fragment is conjugated to a drug moiety or a detectable moiety.
Description
BRIEF DESCRIPTION OF THE FIGURES
[0277] Embodiments and experiments illustrating the principles of the invention will now be discussed with reference to the accompanying figures, in which:
[0278]
[0279]
[0280]
[0281]
[0282]
[0283]
[0284]
[0285]
[0286]
[0287]
[0288]
[0289]
[0290]
[0291]
[0292]
[0293]
[0294]
[0295]
[0296]
[0297]
[0298]
[0299]
[0300]
[0301]
[0302]
[0303]
[0304]
[0305]
[0306]
[0307]
[0308]
[0309]
[0310]
[0311]
[0312]
[0313]
[0314]
[0315]
[0316]
[0317]
EXAMPLES
[0318] In the following Examples, the inventors identify a role for IL-11/IL-11R signalling in fibrosis in a variety of tissues, and described the generation of anti-human IL-11R? antibodies, and in vitro and in vivo functional characterisation of the antibodies.
Example 1: A Role for IL-11/IL-11R Signalling in Fibrosis
1.1 IL-11 is Upregulated in Fibrosis
[0319] To understand the molecular processes underlying the transition of fibroblasts to activated myofibroblasts, atrial tissue was obtained from more than 200 patients that underwent cardiac bypass surgery at the National Heart Centre Singapore. Cells were cultured in vitro at low passage (passage <4), and either not stimulated or stimulated with TGF?1 for 24 h. We subsequently performed high-throughput RNA sequencing (RNA-seq) analysis of unstimulated fibroblasts and cells stimulated with the prototypic pro-fibrotic stimulus TGF?1 across 160 individuals; average read depth was ?70M reads per sample (paired-end 100 bp;
[0320] To ensure the purity of the atrial fibroblast cell cultures, we analysed expression of endothelial cell, cardiomyocyte and fibroblast cell type marker genes from the atrium (Hsu et al., 2012 Circulation Cardiovasc Genetics 5, 327-335) in the RNA-seq dataset.
[0321] The results are shown in
[0322] Gene expression was assessed by RNA-seq of the tissue of origin (human atrial tissues samples, n=8) and primary, unstimulated fibroblast cultures. No/very low expression of the endothelial cell marker PECAM1 (
[0323] Next, the RNA-seq data was analysed to identify genes whose expression was increased or decreased upon stimulation with TGF?1, and this information was integrated with the large RNA-seq dataset across 35+ human tissues provided by the GTEx project (The GTEx Consortium, 2015 Science 348, 648-660). This enabled the identification of gene expression signatures that were specific to the fibroblast-myofibroblast transition.
[0324] The results are shown in
[0325] Upregulation of IL-11 expression was confirmed by ELISA analysis of the cell culture supernatant of TGF?1 stimulated fibroblasts (
[0326] Next, fibroblasts were cultured in vitro and stimulated with several other known pro-fibrotic factors: ET-1, ANGII, PDGF, OSM and IL-13, and also with human recombinant IL-11. For analysing upregulation of IL-11 produced in response to stimulation with IL-11, it was confirmed that the ELISA was only able to detect native IL-11 secreted from cells and does not detect recombinant IL-11 used for the stimulations (
[0327] The results are shown in
[0328] Interestingly, this autocrine loop for IL-11 is similar to the autocrine production of IL-6. IL-6 is from the same cytokine family and also signals via the gp130 receptor (Garbers and Scheller, 2013 Biol Chem 394, 1145-1161), which is proposed to ensure the continued survival and growth of lung and breast cancer cells (Grivennikov and Karin, 2008 Cancer Cell 13, 7-9).
[0329] No increase in IL-11 RNA level was detected in response to stimulation with IL-11 (
1.2 IL-11 has a Profibrotic Role in Fibrosis of Heart Tissue
[0330] To explore whether the autocrine production of IL-11 is pro- or anti-fibrotic, fibroblasts were cultured in vitro with recombinant IL-11, and the fraction of myofibroblasts (?SMA-positive cells) and extracellular matrix production was analysed.
[0331] The expression of ?SMA, collagen and periostin was monitored with the Operetta High-Content Imaging System in an automated, high-throughput fashion. In parallel, secretion of fibrosis marker proteins such as MMP2, TIMP1 and IL-6 was analysed by ELISA assays, and the levels of collagen were confirmed by calorimetric Sirius Red analysis of the cell culture supernatant.
[0332] Briefly, atrial fibroblasts derived from 3 individuals were incubated in 2 wells each for 24 h without stimulation, with TGF?1 (5 ng/ml), or with IL-11 (5 ng/ml). Following incubation, cells were stained to analyse ?-SMA content to estimate the fraction of myofibroblasts, and for collagen and periostin to estimate ECM production. Fluorescence was measured in 7 fields per well. The supernatant of 2 wells per individual was also assessed for collagen content by Sirius Red staining. The signal was normalized to the control group without stimulation. Secretion of the fibrosis markers IL-6, TIMP1 and MMP2 was analysed via ELISA.
[0333] The results are shown in
[0334] The inventors hypothesized that the contradiction between the present finding that IL-11 is profibrotic in heart tissue and the antifibrotic role described in the literature might be related to the use of human IL-11 in rodents in those previous studies (Obana et al., 2010, 2012; Stangou et al., 2011; Trepicchio and Dorner, 1998).
[0335] To investigate this hypothesis, serial dilutions of both human and mouse IL-11 were performed, and the activation of human atrial fibroblasts was monitored (
1.3 IL-11/IL-11R Signalling has a Profibrotic Role in Fibrosis of a Variety of Tissues
[0336] To test whether the profibrotic action of IL-11/IL-11R signalling was specific to atrial fibroblasts, human fibroblasts derived from several different tissues (heart, lung, skin, kidney and liver) were cultured in vitro, stimulated with human IL-11, and fibroblast activation and ECM production was analysed as described above. Increased fibroblast activation and production of ECM was observed as compared to non-stimulated cultures in fibroblasts derived from each of the tissues analysed.
1.3.1 Liver Fibrosis
[0337] To test whether IL-11 signalling is important in liver fibrosis, human primary liver fibroblasts (Cell Biologics, Cat#: H-6019) were cultured at low passage in wells of 96-well plates and either not stimulated, stimulated with TGF?1 (5 ng/ml, 24 h), IL-11 (5 ng/ml, 24 h) or incubated with both TGF?1 (5 ng/ml) and a neutralising IL-11 antibody (2 ?g/ml), or TGF?1 (5 ng/ml) and an Isotype control antibody. Fibroblast activation (?SMA positive cells), cell proliferation (EdU positive cells) and ECM production (Periostin and Collagen) was analysed using the Operetta platform.
[0338] The results of the experiments with primary human liver fibroblasts are shown in
1.3.2 Skin Fibrosis
[0339] To test whether IL-11 signalling is important in skin fibrosis, primary mouse skin fibroblasts were cultured at low passage in wells of 96-well plates and either not stimulated, stimulated with TGF?1 (5 ng/ml, 24 h) or incubated for 24 h with both TGF?1 (5 ng/ml) and a neutralising IL-11 antibody (2 ?g/ml). Fibroblast activation (?SMA positive cells) was then analysed using the Operetta platform.
[0340] The results are shown in
1.3.3 Fibrosis in Multiple Organs
[0341] Next, mouse recombinant IL-11 was injected (100 ?g/kg, 3 days/week, 28 days) into mice to test whether IL-11 can drive global tissue fibrosis in vivo.
[0342] The results are shown in
Example 2: Therapeutic Potential of IL-11/IL-11R Antagonism
2.1 Inhibition of the Fibrotic Response Using Neutralising Antagonists of IL-11/IL-11R
[0343] Next it was investigated whether the autocrine loop of IL-11 secretion was required for the pro-fibrotic effect of TGF?1 on fibroblasts.
[0344] IL-11/IL-11R signalling was inhibited using a commercially available neutralizing antibody (Monoclonal Mouse IgG2A; Clone #22626; Catalog No. MAB218; R&D Systems, MN, USA). Fibroblasts were treated with TGF?1 in the presence or absence of the antibody, and fibroblast activation, the proportion of proliferating cells and ECM production and markers of the fibrotic response were measured.
[0345] Briefly, atrial fibroblasts derived from 3 individuals were incubated for 24 h with TGF?1 (5 ng/ml) or TGF?1 in the presence of neutralising anti-IL-11 antibody or isotype control antibody. Following incubation, cells were stained for ?SMA to determine the fraction of myofibroblasts, the proportion of proliferating cells was determined by analysing the cells for EdU incorporation, and periostin was measured to determine ECM production. Fluorescence was measured with the Operetta platform for 14 fields across 2 wells for each individual. Secretion of the fibrosis markers IL-6, TIMP1 and MMP2 was also analysed by ELISA. Fluorescence was normalized to the control group without stimulation.
[0346] The results are shown in
[0347] Collagen production was also analysed. Cardiac fibroblasts derived from 3 individuals were incubated for 24 h with TGF?1 (5 ng/ml) or TGF?1 and a neutralizing anti-IL-11 antibody. Following incubation the cells were stained for collagen using the Operetta assay and florescence was quantified as described above. Secreted collagen levels in the cell culture supernatant were assessed by Sirius Red staining.
[0348] The results are shown in
[0349] Next, the ability of several other IL-11/IL-11R antagonists to inhibit fibrosis was analysed in vitro using the atrial fibroblast, TGF?1-induced myofibroblast transition assay described herein above.
[0350] Briefly, human atrial fibroblasts cells were cultured in vitro, stimulated for 24 h with TGF?1 (5 ng/ml) or left unstimulated, in the presence/absence of: (i) neutralising anti-IL-11 antibody, (ii) a IL-11RA-gp130 fusion protein (iii) neutralising anti-IL-11R? antibody, (iv) treatment with siRNA directed against IL-11 or (v) treatment with siRNA directed against IL-11RA. The proportion of activated fibroblasts (myofibroblasts) was analysed by evaluating ?SMA content as described above.
[0351] The results are shown in
Example 3: In Vivo Confirmation of a Profibrotic Role for IL-11/IL-11R Signalling
[0352] 3.1 In Vitro Studies Using Cells Derived from IL-11RA Gene Knock-Out Mice
[0353] All mice were bred and housed in the same room and provided food and water ad libitum. Mice lacking functional alleles for IL-11R? (IL-11RA1 KO mice) were on C57Bl/6 genetic background. Mice were of 9-11 weeks of age and the weight of animals did not differ significantly.
[0354] To further confirm the anti-fibrotic effect of inhibition of IL-11/IL-11R signalling, primary fibroblasts were generated from IL-11RA gene knock-out mice and incubated with primary fibroblast cells harvested from IL-11RA+/+ (i.e. wildtype), IL-11RA+/? (i.e. heterozygous knockout) and IL-11RA?/? (i.e. homozygous knockout) animals with TG?F1, IL-11 or AngII. Activation and proliferation of fibroblasts and ECM production was analysed.
[0355] Fibroblasts derived from IL-11RA+/+, IL-11RA+/? and IL-11RA?/? mice were incubated for 24 hours with TGF?1, IL-11 or AngII (5 ng/ml). Following incubation, cells were stained for ?SMA content to estimate the fraction of myofibroblasts, for EdU to identify the fraction of proliferating cells, and for collagen and periostin to estimate ECM production. Fluorescence was measured using the Operetta platform.
[0356] The results are shown in
[0357] Next, it was investigated whether this was also true for other pro-fibrotic cytokines.
[0358] Briefly, fibroblasts were cultured in vitro in the presence/absence of various different pro-fibrotic factors (ANG2, ET-1 or PDGF), and in the presence/absence of neutralising anti-IL-11 antibody or pan anti-TGF? antibody. After 24 hours, collagen production by the cells was determined by analysis using the Operetta system as described above, and myofibroblast generation was determined by analysis of ?SMA expression as described above.
[0359] The results are shown in
[0360] In a further experiment, the role of IL-11 signalling was investigated in lung fibrosis, using an in vitro scratch assay of migration of lung fibroblasts. In response to pro-fibrotic stimuli, fibroblasts are activated and migrate within the fibrotic niche in the body. The migration rate of cells is a measure of cell-cell and cell-matrix interactions and a model for wound healing in vivo (Liang et al., 2007; Nat Protoc. 2(2):329-33).
[0361] Fibroblasts derived from lung tissue from both wild type (WT) and also homozygous IL-11RA (?/?) knockout mice were grown at low passage on a plastic surface until they formed a uniform cell monolayer. A scratch was then created in the cell layer, and cell migration close to the scratch was monitored, either in the absence of stimulation, or in the presence of TGF?1 or IL-11. Images captured at images at the two time points of immediately after creating the scratch and at 24 h were used to determine the area covered by cells, and the rate of migration was compared between WT and KO fibroblasts. Cell migration (area in the scratch covered by cells after 24 h) was normalized to the migration rate of WT cells without stimulus.
[0362] The results are shown in
3.2 Heart Fibrosis
[0363] The efficacy of IL-11 inhibition to treat fibrotic disorders was investigated in vivo. A mouse model for cardiac fibrosis, in which fibrosis is induced by treatment with AngII, was used to investigate whether IL-11RA?/? mice were protected from cardiac fibrosis.
[0364] Briefly, a pump was implanted, and wildtype (WT) IL-11RA(+/+) and knockout (KO) IL-11RA(?/?) mice were treated with AngII (2 mg/kg/day) for 28 days. At the end of the experiment, collagen content was assessed in the atria of the mice using a calorimetric hydroxyproline-based assay kit, and the level of RNA expression of the markers or fibrosis Col1A2, ?SMA (ACTA2) and fibronectin (Fn1) were analysed by qPCR.
[0365] The results are shown in
3.3 Kidney Fibrosis
[0366] A mouse model for kidney fibrosis was established in wildtype (WT) IL-11RA(+/+) and knockout (KO) IL-11RA(?/?) mice by intraperitoneal injection of folic acid (180 mg/kg) in vehicle (0.3M NaHCO.sub.3); control mice were administered vehicle alone.
[0367] Kidneys were removed 28 days post-injection, weighed and either fixed in 10% neutral-buffered formalin for Masson's trichrome and Sirius staining or snap-frozen for collagen assay, RNA, and protein studies.
[0368] Total RNA was extracted from the snap-frozen kidney using Trizol reagent (Invitrogen) and Qiagen TissueLyzer method followed by RNeasy column (Qiagen) purification. The cDNA was prepared using iScript? cDNA synthesis kit, in which each reaction contained 1 ?g of total RNA, as per the manufacturer's instructions. Quantitative RT-PCR gene expression analysis was performed on triplicate samples with either TaqMan (Applied Biosystems) or fast SYBR green (Qiagen) technology using StepOnePlus? (Applied Biosystem) over 40 cycles. Expression data were normalized to GAPDH mRNA expression level and we used the 2-??Ct method to calculate the fold-change. The snap-frozen kidneys were subjected to acid hydrolysis by heating in 6M HCl at a concentration of 50 mg/ml (95? C., 20 hours). The amount of total collagen in the hydrolysate was quantified based on the colorimetric detection of hydroxyproline using Quickzyme Total Collagen assay kit (Quickzyme Biosciences) as per the manufacturer's instructions.
[0369] The results of the analysis are shown in
3.4 Lung Fibrosis
[0370] IL-11 is confirmed as a key mediator of fibrosis in the lung, skin and eye in further in vivo models using the IL-11RA?/? knockout mice. Schematics of the experiments are shown in
[0371] To analyse pulmonary fibrosis, IL-11RA?/? mice and IL-11RA+/+ mice are treated by intratracheal administration of bleomycin on day 0 to establish a fibrotic response in the lung (pulmonary fibrosis). Fibrosis of the lung develops by 21 days, at which point animals are sacrificed and analysed for differences in fibrosis markers between animals with and without IL-11 signalling. IL-11RA?/? mice have a reduced fibrotic response in lung tissue as compared to IL-11RA+/+ mice, as evidenced by reduced expression of markers of fibrosis.
3.5 Skin Fibrosis
[0372] To analyse fibrosis of the skin, IL-11RA?/? mice and IL-11RA+/+ mice are treated by subcutaneous administration of bleomycin on day 0 to establish a fibrotic response in the skin. Fibrosis of the skin develops by 28 days, at which point animals are sacrificed and analysed for differences in fibrosis markers between animals with and without IL-11 signalling. IL-11RA?/? mice have a reduced fibrotic response in skin tissue as compared to IL-11RA+/+ mice, as evidenced by reduced expression of markers of fibrosis.
3.6 Eye Fibrosis
[0373] To analyse fibrosis in the eye, IL-11RA?/? mice and IL-11RA+/+ mice underwent trabeculectomy (filtration surgery) on day 0 to initiate a wound healing response in the eye. This mouse model of glaucoma filtration surgery has been shown to be an efficient model to evaluate the wound healing response in the eye (Khaw et al. 2001, Curr Opin Ophthalmol 12, 143-148; Seet et al. 2011, Mol. Med. 17, 557-567) and has successfully shown the beneficial effect of fibrotic modulators in vivo (Mead et al. 2003, Invest. Ophthalmol. Vis. Sci. 44, 3394-3401; Wong et al. 2003 Invest. Ophthalmol. Vis. Sci. 44, 1097-1103; Wong et al. 2005, Invest. Ophthalmol. Vis. Sci. 46, 2018-2022).
[0374] Briefly, the conjunctiva was dissected to expose the underlying sclera, after which an incision was made through the sclera into the anterior chamber of the eye using a 30-gauge needle. The created fistula allowed aqueous humor to exit into and underneath the conjunctiva. The dissected conjunctiva was then secured and closed at the limbus by a 10-0 (0.2 metric) Ethilon black monofilament nylon scleral suture. Fucithalmic ointment was instilled at the end of the procedure. The surgery was performed under anaesthesia by intraperitoneal injection of a 0.1 ml ketamine/xylazine mixture, as well as topical application of one drop per eye of 1% xylocaine. Fucithalmic ointment was instilled post-surgery to prevent infection. Surgery was performed with 70% propyl alcohol sterilized surgical scissors and forceps and sterile needles.
[0375] The accumulated fluid underneath the sutured conjunctiva was observed as a conjunctival bleb. Mice were euthanized on day 7 post-surgery for analyses. For qualitative immune-histological analyses, eyes from mice will be harvested by enucleation and then sectioned. Maturation of collagen fibres was evaluated with using the picro-sirius red/polarization light technique (Szendroi et al. 1984, Acta Morphol Hung 32, 47-55); orange-red indicated mature collagen, and yellow/green indicated newly formed immature collagen.
[0376] The results of the experiment are shown in
3.7 Other Tissues
[0377] The effect of IL-11RA knockout on fibrosis is also analysed in mouse models of fibrosis for other tissues, such as the liver, bowel, and is also analysed in a model relevant to multiorgan (i.e. systemic) fibrosis. The fibrotic response is measured and compared between the IL-11RA?/? mice and IL-11RA+/+ mice. IL-11RA?/? mice have a reduced fibrotic response as compared to IL-11RA+/+ mice, as evidenced by reduced expression of markers of fibrosis.
Example 4: Analysis of the Molecular Mechanisms Underlying IL-11-Mediated Induction of Fibrosis
[0378] The canonical mode of action of IL-11 is thought to be regulation of RNA expression via STAT3-mediated transcription (Zhu et al., 2015 PLoS ONE 10, e0126296), and also through activation of ERK.
[0379] STAT3 activation is observed following stimulation with IL-11. However, when fibroblasts are incubated with TGF?1, only activation of the canonical SMAD pathway and ERK pathways is seen, and activation of STAT3 is not observed, even in spite of the fact that IL-11 is secreted in response to TGF?1. Only ERK activation is common to both TGF?1 and IL-11 signal transduction.
[0380] Cross-talk between TGF?1 and IL-6 signalling has previously been described, wherein TGF?1 blocks the activation of STAT3 by IL-6 (Walia et al., 2003 FASEB J. 17, 2130-2132). Given the close relationship between IL-6 and IL-11, similar cross-talk may be observed for IL-11 mediated signalling.
[0381] The inventors investigated by RNA-seq analysis whether regulation of RNA abundance was the underlying mechanism for the increased expression of fibrosis marker proteins in response to IL-11, which would suggest STAT3 as the underlying signalling pathway for IL-11 mediated profibrotic processes. Fibroblasts were incubated for 24 hours either without stimulus, or in the presence of TGF?1, IL-11 or TGF?1 and IL-11.
[0382] The results are shown in
[0383] Gene ontology analysis suggests that a pro-fibrotic effect in fibroblasts is driven by IL-11-regulated RNA expression. Both TGF?1 and IL-11 regulate an almost completely different set of genes on the RNA level.
[0384] Whilst TGF?1 increases IL-11 secretion, the target genes of IL-11 are not regulated when both TGF?1 and IL-11 are present. This suggests that TGF?1 upregulates IL-11 and simultaneously blocks the canonical IL-11-driven regulation of RNA expression via STAT3, similar to what is known about the interaction of TGF?1 and IL-6 pathways (Walia et al., 2003 FASEB J. 17, 2130-2132).
[0385] We also analysed whether RNA expression differences induced by TGF?1 are dependent on IL-11 signalling, by analysing changes in RNA expression in fibroblasts obtained from IL-11RA?/? mice as compared to IL-11RA+/+ mice. RNA expression regulated by TGF?1 is still observed when IL-11RA knockout cells were stimulated with TGF?1, and RNA levels of ?SMA, collagen etc. were still upregulated in the absence of IL-11 signalling (in IL-11RA?/? fibroblasts). When the pro-fibrotic effect of IL-11 and the anti-fibrotic effect of IL-11 inhibition was investigated in vitro, reduced expression of markers of fibrosis was only observed at the protein level, not at the transcriptional level as determined by qPCR.
[0386] The activation of non-canonical pathways (e.g. ERK signal transduction) is known to be crucial for the pro-fibrotic action of TGF?1 (Guo and Wang, 2008 Cell Res 19, 71-88). It is likely that non-canonical pathways are likely to be important for signalling for all known pro-fibrotic cytokines, and that IL-11 is a post-transcriptional regulator which is essential for fibrosis.
Example 5: Anti-Human IL-11R? Antibodies
[0387] Mouse monoclonal antibodies directed against human IL-11R? protein were generated as follows.
[0388] cDNA encoding the amino acid for human IL-11R? was cloned into expression plasmids (Aldevron GmbH, Freiburg, Germany).
[0389] Mice were immunised by intradermal application of DNA-coated gold-particles using a hand-held device for particle-bombardment (gene gun). Serum samples were collected from mice after a series of immunisations, and tested in flow cytometry on HEK cells which had been transiently transfected with human IL-11R? expression plasmids (cell surface expression of human IL-11R? by transiently transfected HEK cells was confirmed with anti-tag antibodies recognising a tag added to the N-terminus of the IL-11R? protein).
[0390] Antibody-producing cells were isolated from the mice and fused with mouse myeloma cells (Ag8) according to standard procedures.
[0391] Hybridomas producing antibodies specific for IL-11R? were identified by screening for ability to bind to IL-11R? expressing HEK cells by flow cytometry.
[0392] Cell pellets of positive hybridomas cells were prepared using an RNA protection agent (RNAlater, cat. #AM7020 by ThermoFisher Scientific) and further processed for sequencing of the variable domains of the antibodies.
[0393] Sequencing was performed using BigDye? Terminator v3.1 Cycle Sequencing kit (Life Technologies?) according to the manufacturer's instructions. All data was collected using a 3730xl DNA Analyzer system and Unified Data Collection software (Life Technologies?). Sequence assembly was performed using CodonCode Aligner (CodonCode Corporation). Mixed base calls were resolved by automatically assigning the most prevalent base call to the mixed base calls. Prevalence was determined by both frequency of a base call and the individual quality of the base calls.
[0394] In total, 17 mouse monoclonal anti-human IL-11R? antibody clones were generated (
[0395] The VL and VH domain sequences were determined for antibody clones BSO-1E3, BSO-2E5, BSO-4G3, BSO-5E5, BSO-7G9, BSO-9A7, BSO-10D11, and BSO-13B10 are shown in
[0396] Two VH and VL sequences were obtained for BSO-1E3 (BSO-1E3_1 and BSO-1E3_2).
Example 6: Functional Characterisation of Anti-Human IL-11R? Antibodies
6.1 Ability to Inhibit Human IL-11/IL-11R Mediated Signalling
[0397] To investigate the ability of the anti-IL-11R? antibodies to neutralise human IL-11/IL-11R mediated signalling, cardiac atrial human fibroblasts were cultured in wells of 96-well plates in the presence of TGF?1 (5 ng/ml) for 24 hours, in the presence or absence of the anti-IL-11R? antibodies. This profibrotic stimulus promotes the expression of IL-11, which in turn drives the transistion of quiescent fibroblasts to activated, ?SMA-positive fibroblasts. It has previously been shown that neutralising IL-11 prevents TGF?1-induced transition to activated, ?SMA-positive fibroblasts.
[0398] Anti-IL-11R? antibodies (2 ?g/ml) were added to fibroblast cultures that were stimulated with TGF?1, and at the end of the 24 hour culture period, the percentage of ?SMA-positive fibroblasts was determined. The percentages were normalised based on the percentage of ?SMA-positive fibroblasts observed in cultures of fibroblasts which had not been stimulated with TGF?1.
[0399] Expression of ?SMA was analysed with the Operetta High-Content Imaging System in an automated high-throughput fashion.
[0400] The results are shown in
[0401] A commercial monoclonal mouse anti-IL-11 antibody (Monoclonal Mouse IgG2A; Clone #22626; Catalog No. MAB218; R&D Systems, MN, USA) was included as a control. This antibody was found to be able to reduce the percentage of activated fibroblasts to 0.89 fold of the percentage of activated fibroblasts in unstimulated cultures (i.e. in the absence of stimulation with TGF?1).
[0402] The anti-IL-11R? antibodies were found to be able to inhibit IL-11/IL-11R signalling in human fibroblasts, and several were able to inhibit IL-11/IL-11R signalling to a greater extent than the monoclonal mouse anti-IL-11 antibody: BSO-1E3, BSO-5E5 and BSO-13B10.
6.2 Ability to Inhibit Mouse IL-11 Mediated Signalling
[0403] The ability of the anti-IL-11R? antibodies to inhibit mouse IL-11-mediated signalling was also investigated, following the same procedure as described in section 6.1 above, but using mouse atrial fibroblasts instead of human atrial fibroblasts.
[0404] The results are shown in
[0405] The commercial monoclonal mouse anti-IL-11 antibody (Monoclonal Mouse IgG2A; Clone #22626; Catalog No. MAB218; R&D Systems, MN, USA) was included as a control. This antibody was found to be able to reduce the percentage of activated fibroblasts to 1.44 fold of the percentage of activated fibroblasts in unstimulated cultures (i.e. in the absence of stimulation with TGF?1).
[0406] The anti-IL-11R? antibodies were found to be able to inhibit IL-11/IL-11R signalling in mouse fibroblasts, and several were able to inhibit IL-11/IL-11R signalling to a greater extent than the monoclonal mouse anti-IL-11 antibody: BSO-1E3,
BSO-2C1, BSO-5E5, BSO-9A7 and BSO-13B10.
[0407] 6.3 Ability to Inhibit IL-11 Trans Signalling, by IL-11 in Complex with IL-11R?
[0408] Trans signalling is recognised as a major aspect of IL-6 signalling, where a complex of IL-6 and soluble IL-6R? can activate cells that express gp130, but lack the IL-6 receptor (Hunter and Jones, 2015 Nature Immunology 16, 448-457).
[0409] It has recently been suggested that trans signalling by a complex of IL-11 and soluble IL-11RA is also important for IL-11 biology (Lokau et al., Cell Reports (2016) 14, 1761-1773). Using a recombinant fusion protein of IL-11 and IL-11R? (as described in Pflanz et al., Febs Lett (1999) 450: 117-122), anti-IL-11 antibodies were screened for the ability to inhibit trans signalling mediated by IL-11:IL-11R? complex.
[0410] Importantly, antibodies which are capable of inhibiting both classical IL-11 mediated signalling and IL-11 trans signalling by IL-11:IL-11R? complex are able to inhibit all known modes of IL-11/IL-11R signalling.
[0411] The IL-11:IL-11R? fusion protein (hereafter referred to as hyper IL-11) consists of the extracellular domain of the IL-11 receptor alpha (IL-11R?) linked to IL-11.
[0412] Hyper IL-11 was found to be a more potent activator of human fibroblasts than recombinant IL-11 protein. Briefly, in two separate experiments human fibroblasts were cultured without stimulation (Baseline), in the presence of different amounts of hyper IL-11 (0.008 ng/ml, 0.04 ng/ml, 0.2 ng/ml, 1 ng/ml and 5 ng/ml), or 5 ng/ml recombinant human IL-11 obtained from a commercial source, and fibroblast activation was analysed by determining the percentage of ?SMA-positive cells as described herein. The results are shown in (
[0413] The IL-11:IL-11R? fusion protein was prepared as follows: [0414] DNA encoding IL-11:IL-11R? fusion protein (i.e. SEQ ID NO:98) was cloned into pTT5 vector, and transfected into 293-6E cells in culture in serum-free FreeStyle? 293 Expression Medium (Thermo Fisher Scientific). [0415] Cells were maintained in Erlenmeyer Flasks (Corning Inc.) at 37? C. with 5% CO.sub.2 on an orbital shaker (VWR Scientific). [0416] Cell culture supernatants were collected on day 6 were used for purification. [0417] Cell culture supernatant was loaded onto an affinity purification column. [0418] After washing and elution with appropriate buffer, the eluted fractions were pooled and buffer exchanged to final formulation buffer. [0419] The purified IL-11:IL-11R? fusion protein was analyzed by SDS-PAGE, Western blot to confirm molecular weight and purity.
TABLE-US-00004 DNAencodingIL-11:IL-11R? fusionprotein (SEQIDNO:98): GAATTCCCGCCGCCACCATGGGCTGGTCCTGCATCATCCTGTTTCTGGTG GCCACAGCCACCGGCGTGCACTCTCCACAGGCTTGGGGACCTCCAGGCGT GCAGTATGGCCAGCCTGGCAGATCCGTGAAGCTGTGCTGTCCTGGCGTGA CAGCTGGCGACCCTGTGTCCTGGTTCAGAGATGGCGAGCCCAAGCTGCTG CAGGGCCCAGATTCTGGACTGGGCCACGAACTGGTGCTGGCCCAGGCCGA TTCTACCGACGAGGGCACCTACATCTGCCAGACCCTGGATGGCGCCCTGG GCGGAACAGTGACACTGCAGCTGGGCTACCCTCCCGCCAGACCTGTGGTG TCTTGTCAGGCCGCCGACTACGAGAACTTCAGCTGCACATGGTCCCCCAG CCAGATCAGCGGCCTGCCCACCAGATACCTGACCAGCTACCGGAAGAAAA CCGTGCTGGGCGCCGACAGCCAGAGAAGAAGCCCTTCTACAGGCCCCTGG CCCTGCCCTCAGGATCCTCTGGGAGCTGCCAGATGTGTGGTGCACGGCGC CGAGTTCTGGTCCCAGTACCGGATCAACGTGACCGAAGTGAACCCCCTGG GCGCCTCCACAAGACTGCTGGATGTGTCCCTGCAGAGCATCCTGCGGCCC GATCCTCCACAGGGCCTGAGAGTGGAAAGCGTGCCCGGCTACCCCAGAAG GCTGAGAGCCAGCTGGACATACCCCGCCTCTTGGCCTTGCCAGCCCCACT TCCTGCTGAAGTTTCGGCTGCAGTACCGGCCAGCCCAGCACCCTGCTTGG AGCACAGTGGAACCTGCCGGCCTGGAAGAAGTGATCACAGACGCCGTGGC CGGACTGCCTCATGCTGTGCGGGTGTCCGCCAGAGACTTTCTGGATGCCG GCACCTGGTCTACCTGGTCCCCAGAAGCCTGGGGCACACCTTCTACTGGC GGACCTGCTGGACAGTCTGGCGGAGGCGGAGGAAGTGGCGGAGGATCAGG GGGAGGATCTGTGCCTGGACCTCCTCCAGGACCCCCTAGAGTGTCCCCAG ATCCTAGGGCCGAGCTGGACTCTACCGTGCTGCTGACCAGATCCCTGCTG GCCGACACAAGGCAGCTGGCTGCCCAGCTGAGAGACAAGTTCCCCGCCGA CGGCGACCACAACCTGGATAGCCTGCCTACCCTGGCCATGTCTGCTGGCG CACTGGGGGCTCTGCAGCTGCCTGGGGTGCTGACTAGACTGAGAGCCGAC CTGCTGAGCTACCTGCGGCATGTGCAGTGGCTGAGAAGGGCTGGCGGCAG CAGCCTGAAAACCCTGGAACCTGAGCTGGGCACACTGCAGGCCAGACTGG ACAGACTGCTGCGCAGACTGCAGCTGCTGATGAGCAGACTGGCTCTGCCC CAGCCTCCTCCTGACCCTCCTGCTCCTCCACTGGCTCCTCCAAGCTCTGC TTGGGGCGGAATTAGAGCCGCCCACGCCATTCTGGGAGGCCTGCACCTGA CACTGGATTGGGCAGTGCGGGGCCTGCTGCTGCTGAAAACCAGACTGCAC CACCACCATCACCACTGATAAGCTT AminoacidsequenceofIL-11:IL-11R? fusion protein(SEQIDNO:99): MGWSCIILFLVATATGVHSPQAWGPPGVQYGQPGRSVKLCCPGVTAGDPV SWFRDGEPKLLQGPDSGLGHELVLAQADSTDEGTYICQTLDGALGGTVTL QLGYPPARPVVSCQAADYENFSCTWSPSQISGLPTRYLTSYRKKTVLGAD SQRRSPSTGPWPCPQDPLGAARCVVHGAEFWSQYRINVTEVNPLGASTRL LDVSLQSILRPDPPQGLRVESVPGYPRRLRASWTYPASWPCQPHFLLKFR LQYRPAQHPAWSTVEPAGLEEVITDAVAGLPHAVRVSARDFLDAGTWSTW SPEAWGTPSTGGPAGQSGGGGGSGGGSGGGSVPGPPPGPPRVSPDPRAEL DSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQ LPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRR LQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAV RGLLLLKTRLHHHHHH
[0420] Fibroblasts cultured in vitro and stimulated with hyper IL-11 were shown to upregulate IL-11 protein expression, as determined by ELISA (
[0421] The ability of the mouse anti-IL-11R? antibodies to inhibit signalling mediated by hyper IL-11 was investigated.
[0422] Human atrial fibroblasts were incubated for 24 h with hyper IL-11 (0.2 ng/ml) in the presence anti-IL-11R? antibodies (2 ?g/ml) or isotype control antibody. Following incubation, cell culture supernatant was analysed for MMP2. Stimulation with hyper IL-11 results in an increase in the secretion of MMP2 as compared to non-stimulated cultures.
[0423] The results of the experiments are shown in
[0424] Clones BSO-1E3 (RA1), BSO-5E5 (RA5), BSO-9A7 (RA7), BSO-13B10 (RA9) were identified as promising candidates for further development (highlighted in
6.4 Screening for Ability to Bind IL-11R?
[0425] The mouse hybridomas producing anti-human IL-11R? antibodies were sub-cloned, and cell culture supernatant from the subcloned hybridomas was analysed by mix-and-measure iQue assay for (i) ability to bind to human IL-11R?, and (ii) cross reactivity for antigen other than IL-11R?.
[0426] Briefly, labelled control cells (not expressing IL-11R? at the cell surface) and unlabelled target cells expressing human IL-11R? at their surface (following transient transfection with a plasmid encoding a FLAG-tagged human IL-11R?) were mixed together with the cell culture supernatant (containing mouse-anti-IL-11R? antibodies) and secondary detection antibodies (fluorescently-labelled anti-mouse IgG antibody).
[0427] The cells were then analysed using the HTFC Screening System (iQue) for the two labels (i.e. the cell label and the label on the secondary antibody). Detection of the secondary antibody on the unlabelled, IL-11R? expressing cells indicated ability of the mouse-anti-IL-11R? antibodies to bind to IL-11R?. Detection of the secondary antibody on the labelled, control cells indicated cross-reactivity of the mouse-anti-IL-11R? antibodies for target other than IL-11R?.
[0428] As a positive control condition, labelled and unlabelled cells were incubated with a mouse anti-FLAG tag antibody as the primary antibody.
[0429] The results are shown in
[0430] Antibodies BSO-2C1 and BSO-9A7 displayed stronger signal for binding to IL-11R? than signal for the positive control anti-tag antibody for the tag, indicating that these antibodies bind to IL-11R? with very high affinity.
6.5 Analysis of Antibody Affinity for Human IL-11R?
[0431] The anti-human IL-11R? antibodies are analysed for their affinity of binding to human IL-11R? by ELISA assay.
[0432] Recombinant human IL-11R? is obtained from Genscript and Horseradish peroxidase (HRP)-conjugated anti-human IgG (Fc-specific) antibody is obtained from Sigma. Corning 96-well ELISA plates are obtained from Sigma. Pierce 3,3,5,5-tetramethylbenzidine (TMB) ELISA substrate kit is obtained from Life Technologies (0.4 g/mL TMB solution, 0.02% hydrogen peroxide in citric acid buffer). Bovine serum albumin and sulphuric acid is obtained from Sigma. Wash buffer comprises 0.05% Tween-20 in phosphate buffered saline (PBS-T). Purified IgG controls are purchased from Life Technologies. Tecan Infinite 200 PRO NanoQuant is used to measure absorbance.
[0433] Criss-cross serial dilution analysis was performed as described by Hornbeck et al., (2015) Curr Protoc Immunol 110, 2.1.1-23) to determine the optimal concentration of coating antigen, primary and secondary antibodies.
[0434] An indirect ELISA is performed to assess the binding affinity of the mouse anti-IL-11R? antibodies at 50% of effective concentration (EC.sub.50) as previously described (Unverdorben et al., (2016) MAbs 8, 120-128.). ELISA plates are coated with 1 ?g/mL of recombinant human IL-11R? overnight at 4? C., and remaining binding sites are blocked with 2% BSA in PBS. The antibodies are diluted in 1% BSA in PBS, titrated to obtain working concentrations of 800, 200, 50, 12.5, 3.125, 0.78, 0.195, and 0.049 ng/mL, and incubated in duplicates for 2 hours at room temperature. Detection of antigen-antibody binding is performed with 15.625 ng/mL of HRP-conjugated anti-mouse IgG antibody. Following 2 hours of incubation with the detection antibody, 100 ?l of TMB substrate is added for 15 mins and chromogenic reaction stopped with 100 ?l of 2 M H.sub.2SO.sub.4. Absorbance reading is measured at 450 nm with reference wavelength correction at 570 nm. Data are fitted with GraphPad Prism software with log transformation of antibody concentrations followed by non-linear regression analysis with the asymmetrical (five-parameter) logistic dose-response curve to determine individual EC50 values.
6.6 Ability to Inhibit Human IL-11/IL-11R Signalling in a Variety of Tissues
[0435] Ability of the antibodies to neutralise IL-11/IL-11R signalling and trans signalling in fibroblasts obtained from a variety of different tissues is investigated, essentially as described in sections 6.1 and 6.3 except that instead of cardiac atrial human fibroblasts, human fibroblasts derived from liver, lung, kidney, eye, skin, pancreas, spleen, bowel, brain, and bone marrow are used for the experiments.
[0436] Anti-IL-11R? antibodies are demonstrated to be capable of neutralising IL-11/IL-11R signalling in fibroblasts derived from the various different tissues, as determined by observation of a relative decrease in the proportion of ?SMA-positive fibroblasts at the end of the 24 h culture period in the presence of the anti-IL-11R? antibodies as compared to culture in the absence of the antibodies.
Example 7: Chimeric and Humanised Versions of the Mouse Anti-Human IL-11 Antibodies
[0437] Mouse/human chimeric and humanised versions of the mouse monoclonal anti-human IL-11R? antibodies of Example 5 are prepared according to standard methods.
7.1 Mouse/Human Chimeric Antibodies
[0438] Mouse/human chimeric antibodies are prepared from the mouse monoclonal anti-human IL-11R? antibodies as described in Human Monoclonal Antibodies: Methods and Protocols, Michael Steinitz (Editor), Methods in Molecular Biology 1060, Springer Protocols, Humana Press (2014), in Chapter 8 thereof.
[0439] Briefly, the DNA sequences encoding the VH and VL of hybridomas producing the mouse anti-human IL-11R? antibodies are determined, and combined with DNA sequence encoding human immunoglobulin constant regions to produce a mouse/human chimeric antibody sequence, from which a chimeric mouse/human antibody is expressed in mammalian cells.
7.2 Humanised Antibodies
[0440] Humanised antibodies are prepared from the mouse monoclonal anti-human IL-11R? antibodies as described in Human Monoclonal Antibodies: Methods and Protocols, Michael Steinitz (Editor), Methods in Molecular Biology 1060, Springer Protocols, Humana Press (2014), in Chapter 7 thereof, in particular at section 3.1 of Chapter 7 entitled Antibody Humanization.
[0441] Briefly, the DNA sequences encoding the VH and VL of hybridomas producing the mouse anti-human IL-11R? antibodies are determined, and inserted into DNA sequence encoding human antibody variable region framework regions and immunoglobulin constant regions, to produce a humanised antibody sequence, from which a humanised antibody is expressed in mammalian cells.
Example 8: Further Biochemical Analysis of Anti-IL-11R? Antibodies
[0442] The antibodies described above are subjected to further biochemical analysis.
[0443] The antibodies are analysed by BIAcore, Biolayer interferometry (BLI) and MicroScale Thermophoresis (MST) analysis to determine the affinity of binding to human IL-11R?.
[0444] BIAcore determination of antibody affinity by surface plasmon resonance (SPR) analysis is performed as described in Rich et al., Anal Biochem. 2008 Feb. 1; 373(1):112-20.
[0445] Biolayer interferometry analysis of antibody affinity is performed as described in Concepcion et al., Comb Chem High Throughput Screen. 2009 September; 12(8):791-800.
[0446] MicroScale Thermophoresis analysis of antibody affinity is performed as described in Jerabek-Willemsen et al., Assay Drug Dev Technol. 2011 August; 9(4): 342-353.
[0447] Aggregation of the antibodies is analysed by size exclusion chromatography (SEC), as described in Iacob et al., J Pharm Sci. 2013 December; 102(12): 4315-4329.
[0448] Hydophobicity of the antibodies is analysed by Hydrophobic interaction chromatography (HIC) as described in Haverick et al., MAbs. 2014 July-August; 6(4):852-8.
[0449] The melting temperature of the antibodies is analysed by Differential scanning fluorimetry (DSF) as described in Menzen and Friess, J Pharm Sci. 2013 February; 102(2):415-28.
Example 9: Inhibition of Fibrosis In Vivo Using Anti-IL-11R? Antibodies
[0450] The therapeutic utility of the anti-human IL-11R? antibodies is demonstrated in vivo in mouse models of fibrosis for various different tissues. The mice used in the experiments are wildtype (i.e. IL-11RA+/+) mice.
9.1 Heart Fibrosis
[0451] A pump is implanted, and mice are treated with AngII (2 mg/kg/day) for 28 days.
[0452] Neutralising anti-IL-11R? antibodies, or control antibodies, are administered to different groups of mice by intravenous injection. At the end of the experiment, collagen content is assessed in the atria of the mice using a calorimetric hydroxyproline-based assay kit, and the level of RNA expression of the markers or fibrosis Col1A2, ?SMA (ACTA2) and fibronectin (Fn1) were analysed by qPCR.
[0453] Mice treated with neutralising anti-IL-11R? antibodies have a reduced fibrotic response in heart tissue as compared to mice treated with control antibodies, as evidenced by reduced expression of markers of fibrosis.
9.2 Kidney Fibrosis
[0454] A mouse model for kidney fibrosis is established, in which fibrosis is induced by intraperitoneal injection of folic acid (180 mg/kg) in vehicle (0.3M NaHCO.sub.3); control mice were administered vehicle alone.
[0455] Neutralising anti-IL-11R? antibodies, or control antibodies, are administered to different groups of mice by intravenous injection. Kidneys are removed at day 28, weighed and either fixed in 10% neutral-buffered formalin for Masson's trichrome and Sirius staining or snap-frozen for collagen assay, RNA, and protein studies.
[0456] Total RNA is extracted from the snap-frozen kidney using Trizol reagent (Invitrogen) and Qiagen TissueLyzer method followed by RNeasy column (Qiagen) purification. The cDNA is prepared using iScript? cDNA synthesis kit, in which each reaction contained 1 ?g of total RNA, as per the manufacturer's instructions. Quantitative RT-PCR gene expression analysis is performed on triplicate samples with either TaqMan (Applied Biosystems) or fast SYBR green (Qiagen) technology using StepOnePlus? (Applied Biosystem) over 40 cycles. Expression data are normalized to GAPDH mRNA expression level and the 2-??Ct method is used to calculate the fold-change. The snap-frozen kidneys are subjected to acid hydrolysis by heating in 6M HCl at a concentration of 50 mg/ml (95? C., 20 hours). The amount of total collagen in the hydrolysate is quantified based on the colorimetric detection of hydroxyproline using Quickzyme Total Collagen assay kit (Quickzyme Biosciences) as per the manufacturer's instructions.
[0457] Mice treated with neutralising anti-IL-11R? antibodies have a reduced fibrotic response in kidney tissue as compared to mice treated with control antibodies, as evidenced by reduced expression of markers of fibrosis.
9.3 Lung Fibrosis
[0458] Mice are treated by intratracheal administration of bleomycin on day 0 to establish a fibrotic response in the lung (pulmonary fibrosis).
[0459] Neutralising anti-IL-11R? antibodies, or control antibodies, are administered to different groups of mice by intravenous injection. Mice are sacrificed at day 21, and analysed for differences in fibrosis markers.
[0460] Mice treated with neutralising anti-IL-11R? antibodies have a reduced fibrotic response in lung tissue as compared to mice treated with control antibodies, as evidenced by reduced expression of markers of fibrosis.
9.4 Skin Fibrosis
[0461] Mice are treated by subcutaneous administration of bleomycin on day 0 to establish a fibrotic response in the skin.
[0462] Neutralising anti-IL-11R? antibodies, or control antibodies, are administered to different groups of mice by intravenous injection. Mice are sacrificed at day 21, and analysed for differences in fibrosis markers.
[0463] Mice treated with neutralising anti-IL-11R? antibodies have a reduced fibrotic response in skin tissue as compared to mice treated with control antibodies, as evidenced by reduced expression of markers of fibrosis.
9.5 Eye Fibrosis
[0464] Mice undergo trabeculectomy procedure as described in Example 3.6 above to initiate a wound healing response in the eye.
[0465] Neutralising anti-IL-11R? antibodies, or control antibodies, are administered to different groups of mice by intravenous injection, and fibrosis is monitored in the eye tissue.
[0466] Mice treated with neutralising anti-IL-11R? antibodies have a reduced fibrotic response in eye tissue as compared to mice treated with control antibodies, as evidenced by reduced expression of markers of fibrosis.
9.6 Other Tissues
[0467] The effect of treatment with neutralising anti-IL-11R? antibodies on fibrosis is also analysed in mouse models of fibrosis for other tissues, such as the liver, kidney, bowel, and is also analysed in a model relevant to multiorgan (i.e. systemic) fibrosis.
[0468] The fibrotic response is measured and compared between mice treated with neutralising anti-IL-11R? antibodies and mice treated with control antibodies. Mice treated with neutralising anti-IL-11R? antibodies have a reduced fibrotic response as compared to mice treated with control antibodies, as evidenced by reduced expression of markers of fibrosis.
Example 10: Treatment of Cancer In Vivo Using Anti-IL-11R? Antibodies
[0469] The effect of treatment with neutralising anti-IL-11R? antibodies on cancer is analysed in mouse models of cancer.
[0470] Models of breast, lung, and gastrointestinal cancers are established in mice, the mice are treated by administration of neutralising anti-IL-11R? antibodies, or control antibodies, and the development/progression of cancer is monitored.
[0471] An anti-cancer effect is observed for the neutralising anti-IL-11R? antibodies, as evidenced by reduced symptoms of cancer and/or increased survival as compared to mice treated with control antibodies.
Example 11: Treatment of AMD Using Anti-IL-11R? Antibodies
[0472] The effect of treatment with neutralising anti-IL-11R? antibodies is investigated in wet age-related macular degeneration (AMD).
[0473] Neutralising anti-IL-11R? antibody is administered to subjects having wet AMD. In some treatment conditions, subjects are administered with VEGF antagonist therapy (e.g. ranibizumab, bevacizumab, pegaptanib, brolucizumab or aflibercept), PDGF antagonist therapy (e.g. pegpleranib), or are treated by laser coagulation therapy in addition to treatment with anti-IL-11R? antibody.
[0474] A reduction in wet AMD pathology and/or improvement in the symptoms of wet AMD is observed in subjects treated with anti-IL-11R? antibody as compared to subjects not treated with anti-IL-11R? antibody.
Example 12: Inhibition of Kidney Fibrosis Using Anti-IL-11Ra Antibodies
[0475] 10-12 week old littermate mice of similar weight had kidney fibrosis induced by intraperitoneal (i.p.) injection of folic acid (180 mg kg.sup.?1) in vehicle (0.3 M NaHCO3); control mice were administered vehicle alone.
[0476] Anti-IL11Ra antibody clone BSO-9A7 was administered one day after folic acid treatment and then 3 times per week at a dose of 20 mg/kg. Mice were euthanized 28 days post-injection.
[0477] The mouse plasma levels of urea and creatinine were quantified using urea assay kit (ab83362, Abcam) and creatinine assay kit (ab65340, Abcam), respectively according to the manufacturer's instructions. The amount of total collagen in the kidney was quantified on the basis of colourimetric detection of hydroxyproline using a Quickzyme Total Collagen assay kit (Quickzyme Biosciences). All colourimetric assays were performed according to the manufacturer's instructions.
[0478] Tissues were paraffin-embedded, and kidneys were sectioned at 3 ?m. For paraffin sections, tissues were fixed for 24 h, at room temperature in 10% neutral-buffered formalin (Sigma-Aldrich), dehydrated and embedded in paraffin. For cryosections, freshly dissected organs were embedded with Tissue-Tek Optimal Cutting Temperature compound (VWR International). Cryomoulds were then frozen in a metal beaker with isopentane cooled in liquid nitrogen and sections were stored in ?80? C. Total collagen was stained with Masson's trichrome stain kit (HT15, Sigma-Aldrich) according to the manufacturer's instructions. Images of the sections were captured and blue-stained fibrotic areas were semi-quantitatively determined with ImageJ software (version 1.49). For immunohistochemistry, the tissue sections were incubated with anti-ACTA2 antibody (ab5694, Abcam). Primary antibody staining was visualized using an ImmPRESS HRP Anti-Rabbit IgG Polymer Detection kit (Vector Laboratories) with ImmPACT DAB Peroxidase Substrate (Vector Laboratories) as the chromogen. The sections were then counterstained with Mayer's haematoxylin (Merck).
[0479]
[0480]
[0481] In another experiment a mouse model of acute renal injury was induced by unilateral ureteric obstruction (UUO). Briefly, mice were treated by sham operation or ureteric obstruction of one ureter. Mice received IgG, anti-IL-11Ra antibody clone BSO-9A7 (20 mg/kg; on surgical days ?1, 1, 3, 5) and injured kidneys (UUO) or contralateral uninjured kidneys (Con) were harvested on day 7 post surgery.
[0482] Semi-quantitative assessment of tubular injury was performed by histological analysis of casts, tubular atrophy or tubular expansion blinded to experimental conditions (Tubular injury score: 0, none; 1, minimal; 2, mild; 3, moderate; 4, severe).
[0483]
Example 13: IL-11 and Liver Fibrosis
[0484] Protein expression of IL-11 in healthy and diseased livers was confirmed by western blots in matched samples of human livers. Matched frozen liver samples were prepared for western blotting and levels of IL11 determined using Human IL-11 Antibody Monoclonal Mouse IgG2A Clone #22626, catalog number MAB218 from R&D Systems. Film images were generated.
[0485] The results are shown in
[0486] To determine whether IL-11 expression changed with disease, an ELISA was performed on media from Precision Cut Liver Slices (PCLS) was performed using Human IL-11 DuoSet 15 plate kit, catalog number DY218 from R&D Systems.
[0487] Human PCLS were cut and incubated with media treatments after a 24 h rest period for acclimatisation to media plates. Samples were treated with media only (control), media with LPS, a combination of profibrogenic stimuli inducing TGF?1, or a combination of profibrogenic stimuli inducing TGF?1 and the TGF?1 inhibitor ALK5.
[0488] The results are shown in
Example 14: Inhibition of Heart Fibrosis Using Anti-IL-11Ra Antibodies
[0489] The anti-fibrotic effect of anti-IL-11Ra antibody treatment was analysed in a mouse model of cardiac fibrosis.
[0490] Briefly, transverse aortic constriction (TAC) was performed in male mice as described previously (Tarnavski, O. et al. Mouse cardiac surgery: comprehensive techniques for the generation of mouse models of human diseases and their application for genomic studies. Physiol. Genomics 16, 349-360 (2004)). Age-matched mice underwent a sham operative procedure without TAC. Trans-thoracic two-dimensional Doppler echocardiography was used to confirm increased pressure gradients (>40 mm Hg), indicative of successful TAC.
[0491] Mice were euthanized at 2 weeks post-TAC for histological and molecular assessment. Anti-IL-11Ra antibody clone BSO-9A7 or control IgG antibody were administered intraperitoneally 3 times per week at a dose of 20 mg/kg. After two weeks hearts were harvested and assessed for fibrosis extent using Masson's Trichrome stain kit (HT15, Sigma-Aldrich), in accordance with the manufacturer's instructions. The amount of total collagen in the heart was quantified on the basis of colourimetric detection of hydroxyproline using a Quickzyme Total Collagen assay kit (Quickzyme Biosciences).
[0492] The results of the analysis is shown in