Live recombinant booster vaccine against tuberculosis

10010595 ยท 2018-07-03

Assignee

Inventors

Cpc classification

International classification

Abstract

Embodiments of the invention comprise an improved vaccine for generating an immune response and preventing or treating mycobacterial diseases such as tuberculosis in humans and animals. Embodiments of the invention also comprise a method for using the vaccine against such mycobacterial diseases.

Claims

1. A method of generating an antibody to a Mycobacterium tuberculosis 30 kDa antigen 85B protein (SEQ ID NO: 4) comprising the steps of: immunizing a mammal with a composition consisting essentially of Mycobacterium bovis strain Bacille Calmette-Gurin (BCG) in a primary immunization, wherein said Mycobacterium bovis strain BCG is not a recombinant strain BCG; immunizing a mammal with a composition of matter comprising attenuated Listeria monocytogenes in a booster immunization, wherein the Listeria monocytogenes: does not express a functional ActA protein (SEQ ID NO: 1); expresses prfA protein having a G155S substitution mutation (SEQ ID NO: 3); and expresses Mycobacterium tuberculosis 30 kDa antigen 85B protein (SEQ ID NO: 4); such that an antibody to a Mycobacterium tuberculosis 30 kDa antigen 85B protein is generated.

2. The method of claim 1, wherein the Listeria monocytogenes expresses Mycobacterium tuberculosis 32 kDa 85A protein (SEQ ID NO: 11).

3. The method of claim 1, wherein the Listeria monocytogenes: does not express a functional InlB protein (SEQ ID NO: 2).

4. The method of claim 1, wherein the mammal is immunized intranasally, subcutaneously, intradermally, intramuscularly or orally.

5. The method of claim 1, wherein the mammal is a guinea pig or a mouse.

6. The method of claim 1, wherein the mammal is a human.

7. The method of claim 1, wherein the Listeria monocytogenes further expresses at least one protein from the following group: Mycobacterium tuberculosis 12 kDa fragment of 16 kDa membrane protein (SEQ ID NO:5); Mycobacterium tuberculosis 14 kDa MPT53 protein (SEQ ID NO: 6); Mycobacterium tuberculosis 16 kDa MPT63 protein (SEQ ID NO: 7); Mycobacterium tuberculosis 23 kDa SOD protein (SEQ ID NO: 8); Mycobacterium tuberculosis 23.5 kDa MPT64 protein (SEQ ID NO: 9); Mycobacterium tuberculosis 24 kDa MPT51 protein (SEQ ID NO: 10); Mycobacterium tuberculosis 32 kDa antigen 85A protein (SEQ ID NO: 11); Mycobacterium tuberculosis 32 kDa antigen 85C protein (SEQ ID NO: 12); Mycobacterium tuberculosis 45 kDa MPT32 protein (SEQ ID NO: 13); Mycobacterium tuberculosis 58 kDa glutamine synthetase protein (SEQ ID NO: 14); Mycobacterium tuberculosis 71 kDa HSP 70 protein (SEQ ID NO: 15); Mycobacterium tuberculosis 10.4 kDa EsxH protein (SEQ ID NO: 16); Mycobacterium tuberculosis 14 kDa alpha crystalline homolog protein (SEQ ID NO: 17); Mycobacterium tuberculosis 47 kDa isocytrate lysate protein (SEQ ID NO: 18); Mycobacterium tuberculosis 7.6 kDa hypothetical protein (SEQ ID NO: 19); Mycobacterium tuberculosis 80 kDa glcB protein (SEQ ID NO: 20); Mycobacterium tuberculosis 110 kDa can protein (SEQ ID NO: 21); or Mycobacterium tuberculosis 9.9 kDa ESAT-6 protein (SEQ ID NO: 22).

8. The method of claim 1, wherein the Listeria monocytogenes further expresses at least one protein from group A: Mycobacterium tuberculosis 12 kDa fragment of 16 kDa membrane protein (SEQ ID NO:5); Mycobacterium tuberculosis 14 kDa MPT53 protein (SEQ ID NO: 6); Mycobacterium tuberculosis 16 kDa MPT63 protein (SEQ ID NO: 7); Mycobacterium tuberculosis 23 kDa SOD protein (SEQ ID NO: 8); Mycobacterium tuberculosis 23.5 kDa MPT64 protein (SEQ ID NO: 9); Mycobacterium tuberculosis 24 kDa MPT51 protein (SEQ ID NO: 10); Mycobacterium tuberculosis 32 kDa antigen 85A protein (SEQ ID NO: 11); Mycobacterium tuberculosis 32 kDa antigen 85C protein (SEQ ID NO: 12); Mycobacterium tuberculosis 45 kDa MPT32 protein (SEQ ID NO: 13); Mycobacterium tuberculosis 58 kDa glutamine synthetase protein (SEQ ID NO: 14); Mycobacterium tuberculosis 71 kDa HSP 70 protein (SEQ ID NO: 15); Mycobacterium tuberculosis 10.4 kDa EsxH protein (SEQ ID NO: 16); Mycobacterium tuberculosis 80 kDa glcB protein (SEQ ID NO: 20); Mycobacterium tuberculosis 110 kDa can protein (SEQ ID NO: 21); or Mycobacterium tuberculosis 9.9 kDa ESAT-6 protein (SEQ ID NO: 22); at least one protein from group B: Mycobacterium tuberculosis 14 kDa alpha crystalline homolog protein (SEQ ID NO: 17); Mycobacterium tuberculosis 47 kDa isocytrate lysate protein (SEQ ID NO: 18); or Mycobacterium tuberculosis 7.6 kDa hypothetical protein (SEQ ID NO: 19).

9. The method of claim 1, wherein the Mycobacterium tuberculosis 30 kDa antigen 85B protein is coupled to a heterologous protein sequence comprising the N-terminal 100 amino acids of the ActA protein.

10. The method of claim 9, wherein the expression of the Mycobacterium tuberculosis 30 kDa antigen 85B protein is controlled by an ActA promoter.

11. A method of generating an immune response to a Mycobacterium tuberculosis 30 kDa antigen 85B protein (SEQ ID NO: 4) comprising the steps of: immunizing a mammal with a composition consisting essentially of Mycobacterium bovis strain Bacille Calmette-Gurin (BCG) in a primary immunization, wherein said Mycobacterium bovis strain BCG is not a recombinant strain BCG; immunizing a mammal with a composition of matter comprising attenuated Listeria monocytogenes in a booster immunization, wherein the Listeria monocytogenes: does not express a functional ActA protein (SEQ ID NO: 1); expresses prfA protein having a G155S substitution mutation (SEQ ID NO: 3); and expresses Mycobacterium tuberculosis 30 kDa antigen 85B protein (SEQ ID NO: 4); such that an immune response to a Mycobacterium tuberculosis 30 kDa antigen 85B protein is generated.

12. The method of claim 11, wherein the Listeria monocytogenes expresses Mycobacterium tuberculosis 10.4 kDa EsxH protein (SEQ ID NO: 16).

13. The method of claim 11, wherein the Listeria monocytogenes expresses Mycobacterium tuberculosis 32 kDa 85A protein (SEQ ID NO: 11).

14. The method of claim 11, wherein the Listeria monocytogenes expresses Mycobacterium tuberculosis 23.5 kDa MPT64 protein (SEQ ID NO: 9).

15. The method of claim 11, wherein the Listeria monocytogenes expresses Mycobacterium tuberculosis 9.9 kDa ESAT-6 protein (SEQ ID NO: 22).

16. The method of claim 11, wherein the Listeria monocytogenes expresses Mycobacterium tuberculosis 14 kDa alpha crystalline homolog protein (SEQ ID NO: 17).

17. The method of claim 11, wherein the Listeria monocytogenes expresses Mycobacterium tuberculosis 47 kDa isocitrate lysate protein (SEQ ID NO: 18).

18. The method of claim 11, wherein the Listeria monocytogenes expresses Mycobacterium tuberculosis 7.6 kDa hypothetical protein (SEQ ID NO: 19).

19. The method of claim 11, wherein the Mycobacterium tuberculosis 30 kDa antigen 85B protein is coupled to a heterologous protein sequence comprising the N-terminal 100 amino acids of the ActA protein.

20. The method of claim 19, wherein the expression of the Mycobacterium tuberculosis 30 kDa antigen 85B protein is controlled by an ActA promoter.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) Referring now to the drawings and figures in which like reference numbers represent corresponding parts throughout:

(2) FIG. 1 is a graph illustrating measured diameters of induration (mmSE) of guinea pigs after being injected intradermally with 10 g of purified recombinant M. tuberculosis 30 kDa major extracellular protein (Antigen 85B; r30). As described herein under Experiment 1, guinea pigs were first immunized with various vaccines and then tested for cutaneous delayed-type hypersensitivity (c-DTH) to purified recombinant M. tuberculosis 30 kDa major extracellular protein (r30).

(3) FIG. 2 is a graph illustrating splenic lymphocyte proliferation to r30, PPD, and media alone (RPMI). As described herein under Experiment 1, guinea pigs were first immunized with various vaccines and then assayed for splenic lymphocyte proliferation to purified recombinant M. tuberculosis 30 kDa major extracellular protein.

(4) FIG. 3 is a graph illustrating measured reciprocal antibody titer for r30. As described herein under Experiment 1, guinea pigs were first immunized with various vaccines and then assayed for antibody responses to purified recombinant M. tuberculosis 30 kDa major extracellular protein.

(5) FIG. 4 is a graph illustrating net weight gains or losses of guinea pigs after being challenged with an aerosol generated from a 7.5 ml single-cell suspension containing 6.310.sup.4 colony-forming units (CFU) of M. tuberculosis. As described herein under Experiment 2, the guinea pigs were first immunized with various vaccines and then subsequently challenged with the aerosol containing M. tuberculosis.

(6) FIG. 5 is a graph illustrating assay measurements (mean log CFUSE) of colony forming units (CFU) of M. tuberculosis in the lungs and spleens of guinea pigs. As described herein under Experiment 2, the guinea pigs were first immunized with various vaccinations and then subsequently challenged with an aerosol generated from a 7.5 ml single-cell suspension containing 6.310.sup.4 colony-forming units (CFU) of M. tuberculosis.

(7) FIG. 6 illustrates cellular and humoral immune responses induced by boosting BCG-immunized animals with rLm/Mtb30 vaccines. Mice in groups of 4 were immunized intradermally with PBS (Sham) or BCG at week 0 and groups of BCG-immunized animals were boosted intradermally with one of various rLm/Mtb30 vaccines, with the rAd30 vaccine, or with r30 in adjuvant at weeks 3 and 6. At week 7, mice were anesthetized, bled and euthanized. Splenocytes were assayed for lymphocyte proliferation (A) or intracellular cytokine (INFgamma) expression in response to r30 (C and D) stratified as to CD4+ or CD8+ cells. Serum was assayed for immunoglobulin-G level in response to the r30 protein (B). Values represent meanSE.

(8) FIG. 7 illustrates assay measurements of colony forming units (CFU) of M. tuberculosis in the lungs and spleens of mice. As described herein under Experiment 4, the mice were first immunized with various vaccinations and then subsequently challenged with an aerosol generated from a 7.5 ml single-cell suspension containing 6.310.sup.4 colony-forming units (CFU) of M. tuberculosis.

(9) FIG. 8 is a graph illustrating interferon- production in mice in response to M. tuberculosis antigens. As described herein under Experiment 5, mice were immunized with various vaccines and the splenocytes were stimulated with medium alone, the recombinant 30 kD protein (r30) or M. tuberculosis Purified Protein Derivative (PPD) for three days. The splenocyte supernatant fluid was collected and assayed for the level of IFN by ELISA.

(10) FIG. 9 illustrates the calculated the integrated MFI (iMFI) for cytokine-secreting CD4+ T-cells. As described herein under Experiment 5, mice were immunized with various vaccines and the splenocytes were stimulated with the mature recombinant 30 kD protein (r30) or a pool of three peptides of r30 (30p). The cells were then stained for the cytokines IFN, IL-2, and TNF, and analyzed by multi-parameter flow cytometry.

DETAILED DESCRIPTION OF THE INVENTION

(11) Unless otherwise defined, all terms of art, notations and other scientific terms or terminology used herein are intended to have the meanings commonly understood by those of skill in the art to which this invention pertains. In some cases, terms with commonly understood meanings are defined herein for clarity and/or for ready reference, and the inclusion of such definitions herein should not necessarily be construed to represent a substantial difference over what is generally understood in the art. As appropriate, procedures involving the use of commercially available kits and reagents are generally carried out in accordance with manufacturer defined protocols and/or parameters unless otherwise noted.

(12) In the following description of the typical embodiment, reference is made to the accompanying drawings which form a part hereof, and in which is shown by way of illustration a specific embodiment in which the invention may be practiced. It is to be understood that other embodiments may be utilized and structural changes may be made without departing from the scope of the present invention.

(13) In one aspect of the present disclosure, a novel vaccine vector comprising attenuated Listeria monocytogenes is described. In one embodiment, a vector comprising attenuated Listeria monocytogenes is used by itself as a primary vaccine or vaccinating agent. In another embodiment, a vector comprising attenuated Listeria monocytogenes is used for delivering M. tuberculosis proteins as a booster vaccine for another tuberculosis (TB) vaccine, such as BCG or recombinant BCG. In a further embodiment, a vector comprising attenuated Listeria monocytogenes is used for delivering mycobacteria proteins, such as proteins from Mycobacterium bovis and Mycobacterium leprae, as a primary or booster vaccine or vaccinating agent. Unexpectedly, utilizing a vector comprising attenuated Listeria monocytogenes for delivering mycobacteria proteins as a booster vaccine induces greater protective immunity than boosting with just the purified proteins in adjuvant or boosting with a recombinant adenovirus encoding the same proteins.

(14) Attenuated Listeria monocytogenes can be used as vectors to deliver M. tuberculosis major extracellular proteins, which include but are not limited to the 30 kDa major secretory protein (Antigen 85B), 32A major secretory protein (Antigen 85A), 32B major secretory protein (Antigen 85C), the 23.5 kDa major secretory protein (a.k.a. MPT64), the 16 kDa major secretory protein, the 23 kDa subunit mass superoxide dismutase, the 58 kDa subunit mass glutamine synthetase, the 71 kDa subunit mass heat shock protein, the 12 kDa subunit mass exported fragment of the 16 kDa alpha-crystallin protein, and the 14 kDa secreted protein, etc. Such extracellular proteins have been shown to be immunoprotective against M. tuberculosis (see, e.g. Horwitz, et al. (1995). Protective immunity against tuberculosis induced by vaccination with major extracellular proteins of Mycobacterium tuberculosis. Proc Natl Acad Sci USA 92(5): 1530-4).

(15) In one exemplary implementation of the present disclosure, BCG is utilized as a first vaccine with a booster vaccine being a recombinant attenuated Listeria monocytogenes expressing the M. tuberculosis 30 kDa major secretory protein, a.k.a. Antigen 85B or r30 (rLm/Mtb30). In the Examples described herein, boosting with rLm/Mtb30 has been compared with boosting with purified M. tuberculosis 30 kDa major secretory protein in adjuvant or boosting with a recombinant Adenovirus expressing the M. tuberculosis 30 kDa major secretory protein. Surprisingly, this method of immunization is found to induce significantly greater protective immunity than boosting with just the purified M. tuberculosis protein in adjuvant or boosting with a recombinant adenovirus encoding the same protein.

(16) In another aspect of the present disclosure, a composition of matter is described that is useful for preventing or reducing the possibility of infection caused by Mycobacterium tuberculosis, the agent of tuberculosis, or infection by other pathogenic strains of mycobacteria in humans and/or animals including Mycobacterium bovis and Mycobacterium leprae. Administration of the composition of matter comprising attenuated Listeria monocytogenes expressing a major extracellular protein induces a cell-mediated immune response to the recombinant major extracellular protein. This subsequently protects against infection by M. tuberculosis or other mycobacterial diseases. In yet another aspect of the present disclosure, a vaccination strategy is described wherein an attenuated Listeria monocytogenes expressing M. tuberculosis proteins is administered by itself. In one embodiment, rLm/Mtb30 is administered by itself.

(17) In a further aspect of the present disclosure, a vaccination strategy is described wherein an attenuated Listeria monocytogenes expressing M. tuberculosis proteins is administered as a booster vaccine following immunization with another TB vaccine. In one embodiment, rLm/Mtb30 is administered as a heterologous booster vaccine following immunization with another TB vaccine, such as BCG or a recombinant BCG expressing the same protein. For example, BCG or recombinant BCG is administered first, and after a period of time, the rLm/Mtb30 vaccine is administered one or more times. The initial vaccination may be with BCG or any recombinant strain of BCG overexpressing and secreting one or more M. tuberculosis major extracellular proteins, including but not limited to the 30 kDa major secretory protein (Antigen 85B), 32A major secretory protein (Antigen 85A), 32B major secretory protein (Antigen 85C), the 23.5 kDa major secretory protein (a.k.a. MPT64), the 16 kDa major secretory protein, the 23 kDa subunit mass superoxide dismutase, the 58 kDa subunit mass glutamine synthetase, the 71 kDa subunit mass heat shock protein, the 12 kDa subunit mass exported fragment of the 16 kDa alpha-crystallin protein, the 14 kDa secreted protein, etc. The subsequent vaccination would be with recombinant attenuated Listeria monocytogenes expressing the same M. tuberculosis protein.

(18) The attenuated Listeria monocytogenes can be administered intradermally or by another route, e.g. intranasally, subcutaneously, percutaneously, intramuscularly, or even orally to a mammalian host. The vaccines or immunotherapeutic agents and methods for their use disclosed herein may be used to impart acquired immunity in a mammalian host against various intracellular pathogens, including but not limited to M. tuberculosis, M. bovis, M. kansasii, M. avium-intracellulare, M. fortuitum, M. chelonei, M. marinum, M. scrofulaceum, M. leprae, M. africanum, M. ulcerans, and M. microti.

(19) As illustrated above, the invention disclosed herein has a number of embodiments. A typical embodiment comprises a composition of matter that includes live attenuated Listeria monocytogenes that expresses a Mycobacterium tuberculosis polypeptide, for example the 30 kDa antigen 85B protein (SEQ ID NO: 4). In such compositions, the Listeria monocytogenes is attenuated by inactivation (e.g. via deletion) of one or more genes so that it does not express a functional protein such as a ActA protein (SEQ ID NO: 1) and/or a InlB protein (SEQ ID NO: 2). In certain embodiments of the invention, attenuated Listeria monocytogenes expresses prfA protein having a G155S substitution mutation (SEQ ID NO: 3).

(20) While the 30 kDa antigen 85B protein (also called herein the M. tuberculosis 30 kDa major secretory protein r30) is a commonly discussed embodiment of the invention, other proteins, either alone, or in combination can be expressed in the attenuated Listeria monocytogenes (e.g. an attenuated Listeria monocytogenes of strain 10403S). Such proteins include: Mycobacterium tuberculosis 12 kDa fragment of 16 kDa membrane protein (SEQ ID NO:5); Mycobacterium tuberculosis 14 kDa MPT53 protein (SEQ ID NO: 6); Mycobacterium tuberculosis 16 kDa MPT63 protein (SEQ ID NO: 7); Mycobacterium tuberculosis 23 kDa SOD protein (SEQ ID NO: 8); Mycobacterium tuberculosis 23.5 kDa MPT64 protein (SEQ ID NO: 9); Mycobacterium tuberculosis 24 kDa MPT51 protein (SEQ ID NO: 10); Mycobacterium tuberculosis 32 kDa antigen 85A protein (SEQ ID NO: 11); Mycobacterium tuberculosis 32 kDa antigen 85C protein (SEQ ID NO: 12); Mycobacterium tuberculosis 45 kDa MPT32 protein (SEQ ID NO: 13); Mycobacterium tuberculosis 58 kDa glutamine synthetase protein (SEQ ID NO: 14); Mycobacterium tuberculosis 71 kDa HSP 70 protein (SEQ ID NO: 15); Mycobacterium tuberculosis 10.4 kDa EsxH protein (SEQ ID NO: 16); Mycobacterium tuberculosis 14 kDa alpha crystalline homolog protein (SEQ ID NO: 17); Mycobacterium tuberculosis 47 kDa isocitrate lysate protein (SEQ ID NO: 18); Mycobacterium tuberculosis 7.6 kDa hypothetical protein (SEQ ID NO: 19); Mycobacterium tuberculosis 80 kDa glcB protein (SEQ ID NO: 20) Mycobacterium tuberculosis 110 kDa can protein (SEQ ID NO: 21); and Mycobacterium tuberculosis 9.9 kDa ESAT-6 protein (SEQ ID NO: 22). A wide variety of combinations of proteins can be expressed in various embodiments of the invention. For example, in certain embodiments of the invention, one or more latency associated proteins (e.g. SEQ NOS: 17-19) are expressed in combination with one or more of the other proteins disclosed herein (e.g. SEQ NOS: 4, 6-16 and 20-22).

(21) In some embodiments of the invention, the composition comprises one or more agents used in vaccines such as a pharmaceutically acceptable carrier. Methods for formulating compositions of the invention for pharmaceutical administration are known to those of skill in the art. See, for example, Remington: The Science and Practice of Pharmacy, 19th Edition, Gennaro (ed.) 1995, Mack Publishing Company, Easton, Pa. Typically the immunogenic agents used in the methods of the invention combined with at pharmaceutically acceptable carrier. The term pharmaceutically acceptable carrier is used according to its art accepted meaning and is intended to include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, compatible with pharmaceutical administration. The use of such media and agents for pharmaceutically active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, such media can be used in the compositions of the invention. Supplementary active compounds can also be incorporated into the compositions. A pharmaceutical composition of the invention is formulated to be compatible with its intended route of administration. Certain compositions of the invention can include an adjuvant. Immunologic adjuvants are commonly added to vaccines to stimulate the immune system's response to the target antigen, but do not in themselves confer immunity. Adjuvants can act in various ways in presenting an antigen to the immune system. A wide variety of adjuvants are known in the art, see e.g. Handbook of Pharmaceutical Additives: An International Guide to More Than 6000 Products by Trade Name, Chemical, Function, and Manufacturer by Michael Ash and Irene Ash (1996). In addition, certain embodiments of the invention further comprising a buffer system, for example phosphate buffered saline.

(22) In certain embodiments of the invention, a protein such as the Mycobacterium tuberculosis 30 kDa antigen 85B protein is fused in frame with a heterologous protein sequence. Optionally, for example, the Mycobacterium tuberculosis 30 kDa antigen 85B protein is coupled to a heterologous protein sequence comprising the N-terminal 100 amino acids of the ActA protein. The protein expression can further be controlled by constructing expression cassettes to include certain regulatory sequences. In one illustrative embodiment of the invention, the expression of the Mycobacterium tuberculosis 30 kDa antigen 85B protein is controlled by an ActA promoter.

(23) Another embodiment of the invention is a method of generating an antibody to a Mycobacterium tuberculosis polypeptide such as the 30 kDa antigen 85B protein (SEQ ID NO: 4) by immunizing a mammal with a composition of matter disclosed herein, for example one comprising attenuated Listeria monocytogenes constructed to express this protein so that an antibody to a Mycobacterium tuberculosis 30 kDa antigen 85B protein is generated. The term mammal as used herein refers to any organism classified as a mammal, including mice, rats, rabbits, dogs, cats, cows, horses and humans. In one embodiment of the invention, the mammal is a mouse. In another embodiment of the invention, the mammal is a human. In an illustrative embodiment of invention, the Listeria monocytogenes does not express a functional ActA protein (SEQ ID NO: 1); does not express a functional InlB polypeptide (SEQ ID NO: 2); expresses prfA protein having a G155S substitution mutation (SEQ ID NO: 3); and expresses Mycobacterium tuberculosis 30 kDa antigen 85B protein (SEQ ID NO: 4). While the 30 kDa antigen 85B protein (SEQ ID NO: 4) is a commonly discussed embodiment of the invention, other proteins, either alone, or in combination can be expressed in the attenuated Listeria monocytogenes to generate an immune response.

(24) Those of skill in this art understand that the immunization methods disclosed herein can be combined with other methodological steps. For example, certain embodiments of the invention include the step of further comprising immunizing the mammal with Mycobacterium bovis strain Bacille Calmette-Gurin (BCG). Typically in these embodiments, the BCG is used in a primary immunization and the attenuated Listeria monocytogenes is used in a booster immunization. In such embodiments of the invention, the mammal can be immunized intranasally, orally, subcutaneously, percutaneouly, intramuscularly, or by anther conventional route of vaccine delivery.

(25) Antibodies generated by methodological embodiments of the invention have a number of uses. In one exemplary use in vivo, antibodies to an antigen such as a Mycobacterium tuberculosis protein are useful to prevent and/or diminish the severity of a disease such as tuberculosis. In yet another exemplary use, antibodies to a Mycobacterium tuberculosis protein such as 30 kDa antigen 85B protein (SEQ ID NO: 4) can function as an essential element in a diagnostic assay. In particular, those of skill in this art understand that a wide variety of diagnostic assays use antigen specific antibodies to provide substantial beneficial information to medical personnel including ELISA assay, Western Assays, radioimmunoassays and the like. Such assays use antibodies specific for an antigen such as a protein expressed by a pathogenic organism to, for example, identify the presence of that organism in a sample. Examples of tuberculosis diagnosis using antibodies in ELISA systems are described in publications such as Radhakrishnan et al., J Infect Dis, 1991 163(3): 650-652 and Kashyap et al., Clin Diag Lab Immunol. 2005 12(6): 752-758, the contents of which are incorporated by reference herein. In addition, a number of commercially available kits are known in the art such as the Clearview TB ELISA system. As is known in the art, antibodies useful in such assays can be obtained, for example, from the supernatants of hybridomas generated by conventional methods and/or affinity purified from human sera (see, e.g., Groen et al., J Virol Methods. 1989 February; 23(2):195-203, the contents of which are incorporated by reference). In this context, antibodies generated by the methods of the invention can be readily adapted for use in such assays.

(26) Those skilled in the art will appreciate that the exemplary discussions of M. tuberculosis that are provided herein are in no way intended to limit the scope of the present invention to the treatment of M. tuberculosis. Similarly, the teachings herein are not limited in any way to the treatment of tubercular infections. On the contrary, this invention may be used to advantageously provide safe and effective vaccines and immunotherapeutic agents against the immunogenic determinants of any pathogenic agent expressing extracellular products and thereby inhibit the infectious transmission of those organisms.

EXAMPLES

(27) Materials and Methods

(28) A. BCG Strain (Wild-type M. bovis BCG Tice)

(29) This strain was maintained in 7H9 medium pH 6.7 (Difco) at 37 C. in a 5% CO.sub.2-95% air atmosphere as unshaken cultures. Cultures were sonicated once or twice weekly for 5 min in a sonicating water bath to reduce bacterial clumping, as described (see, e.g. Horwitz, et al. (2000). Recombinant bacillus calmette-guerin (BCG) vaccines expressing the Mycobacterium tuberculosis 30-kDa major secretory protein induce greater protective immunity against tuberculosis than conventional BCG vaccines in a highly susceptible animal model. Proc Natl Acad Sci USA 97(25): 13853-8).

(30) B. Recombinant Attenuated Listeria monocytogenes Vaccines

(31) 1. rLm/Mtb30(01)

(32) a. Construction of rLm/Mtb30(01)

(33) rLm/Mtb30(01), an attenuated recombinant Listeria monocytogenes expressing the M. tuberculosis 30 kDa major secretory protein (Mtb30), was constructed using the attenuated L. monocytogenes host strain, LmactA, an L. monocytogenes strain 10403S (serotype 1/2a) with a deletion of actA encoding one of virulence factors, ActA. The coding sequence for the mature peptide of the 30 kDa major secretory protein was PCR amplified from the genomic DNA of the M. tuberculosis 37HRv strain. The DNA fragments were cloned into pZErO (Invitrogen) vector. The identity of the inserted 30 kDa coding sequences was confirmed by nucleotide sequencing, and subcloned into the BamHI and PacI sites of the cloning vector pKB199, in such a way that the 30 kDa coding sequence was fused to the listeriolysin O signal sequence (LLO) downstream of the hemolysin (hly) promoter of L. monocytogenes. The expression cassette of the LLO-30 kDa fusion protein driven by the hly promoter was excised from the resultant vector and subsequently cloned into a site-specific integration vector pDP4189. The integration vector was transformed into SM10, the E. coli conjugation donor strain. Through conjugation, the plasmid was mobilized and transferred from its E. coli SM10 host into the recipient LmactA strain. The conjugation mixture was selected on plates containing streptomycin and chloramphenicol. The LmactA strain is insensitive to streptomycin since it is derived from the L. monocytogenes strain 10403S, a spontaneous mutant resistant to streptomycin. E. coli SM10 is sensitive to streptomycin, therefore was not able to grow on the selective plate. The plasmid pDP4189 carries the chloramphenicol resistance gene and is unable to replicate in Listeria. Under the selection pressure from chloramphenicol, the plasmid pDP4189/Mtb30 integrated in the 3 end of an arginine tRNA gene on the chromosome of LmactA strain. The resultant recombinant LmactA strain, rLm/Mtb30(01), carries a single copy of the 30 kDa expression cassette and is stable in the absence of antibiotic selection.

(34) b. Protein Expression of Mtb30 in Broth.

(35) The expression of 30 kDa major secretory protein by rLm/Mtb30 was tested in broth. A single colony of rLm/Mtb30(01) was inoculated into 3 ml Brain Heart Infusion (BHI) medium containing streptomycin and chloramphenicol and the bacteria were grown overnight at 37 C. with shaking. The overnight culture was inoculated into 40 ml fresh MOPS-buffered BHI medium containing streptomycin and chloramphenicol at an initial optical density (OD) of 0.05 at 540 nm. The culture was grown until late logarithmic phase at 37 C. with vigorous shaking before being harvested by centrifugation. The supernate was passed through a 0.2 m filter membrane, and proteins in the culture filtrate were precipitated by trichloroacetic acid. The expression of the 30 kDa major secretory protein was analyzed by Western blotting using rabbit polyclonal antibody against the 30 kDa major secretory protein. It was found that the antibody reacted specifically with a protein band of 30 kDa, which was absent from the LmactA parental strain. This confirmed that the recombinant rLm/Mtb30 expresses the 30 kDa protein.

(36) c. Protein Expression of Mtb 30 by rLm/Mtb30(01) in Human Macrophages

(37) THP-1 cells were differentiated into a monolayer on a 24-well plate (210.sup.5 cells/well) in the presence of 100 nM PMA (phorbol 12-myristate 13-acetate) and in the absence of antibiotics. The rLm/Mtb30(01) culture was grown to late logarithmic phase (OD of 1.0 at 540 nm) in BHI broth and used to infect the THP-1 cell monolayer at a multiplicity of infection (MOI) of 50:1. After infection for 1 h at 37 C., the monolayer was washed twice with RPMI to remove extracellular bacteria and then treated with 1 ml medium containing gentamicin at a final concentration of 10 g ml.sup.1 to kill any remaining extracellular bacteria. At 24 h post-infection, cells were harvested, washed once with PBS, and boiled for 7 min in Laemmli buffer before analysis by SDS-polyacrylamide gel electrophoresis (SDS-PAGE) and Western blotting. It shows that bands of 30 kDa in size were detected in samples of macrophages infected by two clones of rLm/Mtb30(01), but not by the parental rLmactA strain. These two clones (#8 and #10) were amplified in BHI broth and used for animal experiments.

(38) 2. rLm/Mtb30(02) (Codon Optimized)

(39) rLm/Mtb30(02), rLmactA expressing the 30 kDa protein codon-optimized for higher level of protein expression in L. monocytogenes (30 kDa(CO)), was constructed using a method similar to that described above for rLm/Mtb30(01). The DNA sequence for a codon-optimized version of the 30 kDa major secretory protein (30 kDa(CO)) was synthesized by DNA2.0 (Menlo Park, Calif.).

(40) 3. rLmactAinlB/Mtb30 (rLm/Mtb30(11))

(41) To further reduce the toxicity of the LmactA vector, a second generation of rLm/Mtb30 vaccines were constructed using a L. monocytogenes with deletions in actA and inlB (LmactAinlB) as a vector. Deletions in actA and inlB retain the potency and diminish the toxicity of the Lm vector in vivo (see, e.g. Brockstedt, et al. (2004). Listeria-based cancer vaccines that segregate immunogenicity from toxicity. Proc Natl Acad Sci USA 101(38): 13832-7). It was shown that the 30 kDa protein was readily detected by Coumassie blue staining in broth cultures of the vaccine and in extracts of macrophages infected with rLm/Mtb30(11).

(42) 4. rLmactAinlB/ActAN100-Mtb30 (rLm/Mtb30(03)(04))

(43) It has been reported that the actA promoter has a higher activity than hly promoter in vivo and proteins fused with 100 amino acids of the N-terminus of ActA are highly immunogenic. Therefore to enhance the in vivo expression of 30 kDa protein by the rLm/Mtb30 vaccines, the 30 kDa major secretory protein was fused with the N-terminal 100 amino acids of ActA (ActAN100) under the control of the actA promoter and introduced the fusion protein expression cassette into the second generation of the rLmactAinlB vector. The following 2 additional second generation of rLm/Mtb30 vaccines have been constructed:

(44) a. rLmactAinlB/ActAN100-Mtb30 (03)

(45) b. rLmactAinlB/ActAN100-Mtb30-SL8 (04)

(46) It has been shown that these second generation rLm/Mtb30 vaccines express the 30 kDa major secretory protein in broth culture and in human macrophages at levels similar to that of the first generation rLm/Mtb30 vaccines. The safety of these vaccines in animals are further being tested.

(47) 5. rLmactAinlBuvrABprfA*/Mtb30 (12)(07)(08)

(48) To further enhance the immunogenicity of the rLm/Mtb30 vaccines, the following third generation rLm/Mtb30 vaccines expressing high amounts of the 30 kDa protein have been constructed and characterized.

(49) a. rLmactAinlBuvrABprfA*/Mtb30 (12)

(50) b. rLmactAinlBuvrABprfA*/ActAN100-Mtb30 (07)

(51) c. LmactAinlBuvrABprfA*/ActAN100-Mtb30-SL8 (08)

(52) The third generation rLm/Mtb30 vaccines were constructed using as a vector an LmactAinlB with an additional deletion in uvrAB and a single mutation (G155S) in pfrA (LmactAinlBuvrABprfA*, or Lm/prfA*) provided by Aduro BioTech. The deletion in uvrAB was designed to facilitate inactivation of the rLm/prfA* vaccines by UV light (Brockstedt et al. 2005) and the prfA* mutation resulted in constitutive expression of the downstream genes, including actA and hly (see, e.g. Lauer, et al. (2008). Constitutive Activation of the PrfA regulon enhances the potency of vaccines based on live-attenuated and killed but metabolically active Listeria monocytogenes strains. Infect Immun 76(8): 3742-53; Yan, et al. (2008). Selected prfA* mutations in recombinant attenuated Listeria monocytogenes strains augment expression of foreign immunogens and enhance vaccine-elicited humoral and cellular immune responses. Infect Immun 76(8): 3439-50). It was shown that all three rLm/pfrA*/Mtb30 vaccines expressed the 30 kDa fusion proteins at significantly higher levels in broth than the corresponding vaccines derived from the first and second generation Lm vectors (rLmactA and rLmactAinlB)

(53) C. Purified M. tuberculosis 30 kDa Major Secretory Protein

(54) This protein was purified from recombinant M. smegmatis as described in Horwitz et al. 1995 (see, e.g. Horwitz, et al. (1995). Protective immunity against tuberculosis induced by vaccination with major extracellular proteins of Mycobacterium tuberculosis. Proc Natl Acad Sci USA 92(5): 1530-4) and Harth et al. 1997 (see, e.g. Harth, et al. (1997). High-level heterologous expression and secretion in rapidly growing nonpathogenic mycobacteria of four major Mycobacterium tuberculosis extracellular proteins considered to be leading vaccine candidates and drug targets. Infect Immun 65(6): 2321-8).

(55) D. Replication-Deficient Adenovirus Expressing the 30 kDa Major Secretory Protein: Generation of Strains and Recombinant Protein Expression

(56) The replication-deficient recombinant adenovirus strain that expresses the 30 kDa major secretory protein of M. tuberculosis (Mtb30) was constructed using an AdenoVator system (Q Biogen). The Mtb30 coding sequence was first cloned into a transfer vector of pAdenoVator-CMV5 downstream of a modified immediate-early promoter of cytomegalovirus (CMV5), which allows for the production of high levels of heterologous proteins in mammalian cells. The transfer vector contains a kanamycin-resistance gene that allows for selection of recombinant adenoviral DNAs. The transfer vector containing the Mtb30 coding sequence was then co-transformed into E. coli together with an adenoviral plasmid DNA with deletions in viral early genes E1 and E3, pAdenoVatorE1/E3. The E1 but not the E3 gene is essential for adenovirus growth in mammalian cells. Thus the recombinant adenoviruses with E1 and E3 deletions are replication-deficient and can grow only on cells that express the E1 gene. Through homologous recombination between the transfer vector and the adenoviral plasmid DNA in E. coli, the Mtb30 gene driven by the CMV5 promoter was introduced into the deleted E1 region of the adenoviral plasmid DNA. Recombinant adenoviral DNAs were selected with kanamycin and confirmed by restriction enzyme analysis. A positive recombinant adenoviral DNA that was confirmed to contain the appropriate insert, pAdvE1E3/Mtb30, was linearized with restriction enzyme (PacI) and transfected into mammalian cells (293A) that express the E1 protein. The resultant replication-deficient recombinant adenoviruses were plaque purified and amplified in 293A cells for up to 4 passages. The expression of Mtb30 by the recombinant adenovirus, AdvE1E3/Mtb30, was confirmed by Western blotting using a rabbit polyclonal antibody to Mtb30. The replication-deficient recombinant adenovirus stock was prepared from 610.sup.8 293A cells and purified by two rounds of ultracentrifugation on CsCl gradients. The amount of virus particles in the virus stock was measured by assessing the DNA content of lysed virus in solution and utilizing the extinction coefficient of 1.110.sup.12 virus particles per OD.sub.260 unit. The amount of infectious virus in the virus stock was measured by determining the tissue culture infectious dose 50 (TCID.sub.50) in 293A cells. The purified viral particles were stored at 80 C. in 20 mM Tris, pH 8.0, 25 mM NaCl, 2.5% glycerol.

(57) E. Animal Models

(58) The studies of the efficacy of the vaccines utilized guinea pigs because the guinea pig model is especially relevant to human tuberculosis clinically, immunologically, and pathologically. In contrast to the mouse and rat, but like the human, the guinea pig a) is susceptible to low doses of aerosolized M. tuberculosis; b) exhibits strong cutaneous delayed-type hypersensitivity (DTH) to tuberculin; and c) displays Langhans giant cells and caseation in pulmonary lesions. However, whereas only about 10% of immunocompetent humans who are infected with M. tuberculosis develop active disease over their lifetime (half early after exposure and half after a period of latency), infected guinea pigs always develop early active disease. While guinea pigs differ from humans in this respect, the consistency with which they develop active disease after infection with M. tuberculosis is an advantage in trials of vaccine efficacy.

(59) Additional immunology studies including studies requiring special immunology reagents were conducted in C57BL/6 mice.

(60) F. Preparation of Primary Vaccination

(61) Aliquots were removed from logarithmically growing wild-type or recombinant BCG cultures, and the bacteria were pelleted by centrifugation at 3,500g for 15 min. The bacteria were then washed with 1 phosphate buffered saline (1PBS, 50 mM sodium phosphate pH 7, 150 mM sodium chloride) and resuspended at a final concentration of 110.sup.4 colony forming units per ml in 1PBS. The immunization inoculum contained 1,000 viable wild-type or recombinant BCG bacteria in a total volume of 100 l.

(62) G. Preparation of Booster Vaccination

(63) 1. rLm/Mtb30.

(64) The various rLm/Mtb30 vaccines were grown in broth. Aliquots were removed from late logarithmically growing rLm/Mtb30 cultures and the bacteria were pelleted by centrifugation at 3,500g for 15 min. The bacteria were then washed once with 1 phosphate buffered saline (1PBS, 50 mM sodium phosphate pH 7, 150 mM sodium chloride) and re-suspended at a final concentration of 210.sup.9 colony forming units per ml in 1 sterile PBS. The stock was stored at 80 C., and the titer was checked periodically by plating serial dilutions of the stock on BHI plates. No significant titer loss was found over the period of storage. Before each use in animals, one vial of rLm/Mtb30 was thawed immediately at 37 C., diluted in sterile saline to a final concentration of 210.sup.7 colony forming units per ml in 1 sterile PBS and kept on ice until use. The rLm/Mtb30 was administered intradermally at a dose of 110.sup.6 bacteria in a total of 50 L per animal.

(65) 2. r30 in Adjuvant

(66) 100 g of the r30 protein was mixed with Syntex Adjuvant Formulation (SAF) as described in Horwitz et al. 1995 (see, e.g. Horwitz, et al. (1995). Protective immunity against tuberculosis induced by vaccination with major extracellular proteins of Mycobacterium tuberculosis. Proc Natl Acad Sci USA 92(5): 1530-4).

(67) 3. rAd/Mtb30

(68) The rAd/Mtb30 stock was thawed on ice, diluted in sterile PBS to a final concentration of 110.sup.11 viral particles per mL and administered intradermally at a dose of 110.sup.11 viral particles in a total 50 L per animal.

(69) Experiments

(70) Experiment 1: Immunogenicity of rLm/Mtb30 in Prime-Boost Vaccination Regimen

(71) Specific-pathogen free 250-300 g outbred male Hartley strain guinea pigs from Charles River Breeding Laboratories, in groups of 6, were immunized intradermally as follows: Group A: Sham Group B: BCG Tice Parental Control (10.sup.3 CFU) at Week 0 Group C: BCG Tice Parental Control (10.sup.3 CFU) at Week 0 and 100 g of r30 in SAF adjuvant at Week 4 Group D: BCG Tice Parental Control (10.sup.3 CFU) at Week 0 and rAd/Mtb30 at Week 4 Group E: BCG Tice Parental Control (10.sup.3 CFU) at Week 0 and Lm Empty Vector at Week 4 Group F: BCG Tice Parental Control (10.sup.3 CFU) at Week 0 and rLm/Mtb30 at Week 4 Group G: BCG Tice Parental Control (10.sup.3 CFU) at Week 0 and rLm/Mtb30 CO at Week 4

(72) At week 8, animals were tested for cutaneous delayed-type hypersensitivity (c-DTH) to r30, and after the skin test was assessed, the animals were euthanized for assay of splenic lymphocyte proliferation and antibody responses to r30.

(73) A. Cutaneous Delayed-Type Hypersensitivity (DTH) to Purified Recombinant M. tuberculosis 30 kDa Major Extracellular Protein (r30)

(74) Guinea pigs were shaved over the back and injected intradermally with 10 g of purified recombinant M. tuberculosis 30 kDa major extracellular protein (r30) in 100 l phosphate buffered saline. After 24 h, the diameter of erythema and induration was measured. Induration is most reflective of a c-DTH response. The results are summarized in Table 1 and FIG. 1.

(75) TABLE-US-00001 TABLE 1 Cutaneous DTH - Experiment 1 Test Erythema Induration Group Vaccination Antigen (mm SE) (mm SE) A Sham r30 0 0 0 0 B BCG r30 0 0 0 0 C BCG + r30 r30 19.6 1.9 19.6 1.9 D BCG + rAd/Mtb30 r30 19.7 1.4 19.7 1.4 E BCG + Lm Vector r30 1.2 0.7 0 0 F BCG + rLm/Mtb30 r30 13.3 1.1 13.3 1.1 G BCG + rLm/Mtb30 C-O r30 12.3 1.0 6.7 3.1

(76) These results showed that the animals immunized with the parental BCG Tice strain (Group F) and the sham-immunized animals (Group J) had no erythema and induration upon testing with the M. tuberculosis 30 kDa major secretory protein r30. In contrast, animals immunized with BCG and boosted with purified r30 in adjuvant or with recombinant vaccines expressing r30, including both recombinant adenovirus and recombinant L. monocytogenes all developed significantly increased levels of both erythema and, more importantly, induration in response to skin-testing with r30. Boosting with the empty L. monocytogenes vector did not induce a significant c-DTH response (0 induration). Both rLm/Mtb30 and rLm/Mtb30CO induced a significant c-DTH response.

(77) B. Splenic Lymphocyte Proliferation to Purified Recombinant M. tuberculosis 30 kDa Major Extracellular Protein (r30)

(78) Immediately after skin-testing, the animals were euthanized, their spleens removed, and splenic lymphocyte proliferation to r30 (100 g/well) and PPD (10 g/well) assayed. The results are shown in Table 2 and FIG. 2.

(79) As expected, all but the sham-immunized animals reacted to the positive control antigen PPD. The sham and BCG-immunized animals had low lymphocyte proliferative activity. Animals immunized with BCG and boosted with either rAd/Mtb30 or the Lm vector had modest lymphocyte proliferative activity. Boosting BCG-immunized animals with r30 markedly increased lymphocyte proliferative activity approximately 4-fold vs. BCG-immunized animals. Boosting BCG-immunized animals with rLm/Mtb30 or rLm/Mtb 30 CO also markedly increased splenic lymphocyte proliferative activity by 7-fold and 4-fold, respectively vs. BCG immunized animals.

(80) Thus, boosting with recombinant L. monocytogenes expressing the M. tuberculosis 30 kDa major secretory protein markedly increased splenic lymphocyte proliferation to r30 in guinea pigs.

(81) TABLE-US-00002 TABLE 2 Splenic Lymphocyte Proliferation - Experiment 1 Test r30 (Mean PPD (Mean Group Vaccination Antigen CPM SE) CPM SE) A Sham r30 328 102 259 111 B BCG r30 194 52 3032 682 C BCG + r30 r30 774 188 5483 1164 D BCG + rAd/Mtb30 r30 527 137 3620 609 E BCG + Lm Vector r30 544 94 2582 454 F BCG + rLm/Mtb30 r30 1331 249 2800 505 G BCG + rLm/Mtb30 r30 851 155 1732 251 C-O
C. Antibody Responses to Purified Recombinant M. tuberculosis 30 kDa Major Extracellular Protein (r30)

(82) Immediately after skin-testing, the animals were euthanized and their serum obtained. The serum was tested for antibody to r30 using an ELISA assay. The results are shown in Table 3 and FIG. 3.

(83) TABLE-US-00003 TABLE 3 Antibody Titers - Experiment 1 Reciprocal Titer Group Vaccination Test Antigen (Geometric mean) A Sham r30 157 B BCG r30 125 C BCG + r30 r30 35,919 D BCG + rAd/Mtb30 r30 14,254 E BCG + Lm Vector r30 140 F BCG + rLm/Mtb30 r30 223 G BCG + rLm/Mtb30C-O r30 125

(84) The results showed that sham-immunized animals and animals immunized only with BCG had negligible antibody titers. In contrast, animals immunized first with BCG and later boosted with r30 in adjuvant or rAd/Mtb30 had high antibody titers. Animals immunized first with BCG and later boosted with rLm/Mtb30 or rLm/Mtb30CO had low antibody titers, perhaps reflecting the fact that the rLm produces r30 in the cytoplasm of host cells where it is likely processed such that the protein is not available for presentation to B cells.

(85) Experiment 2: Protective Efficacy of rLm/Mtb30 in a Prime-Boost Vaccination Regimen in Guinea Pigs

(86) Specific-pathogen free 250-300 g outbred male Hartley strain guinea pigs from Charles River Breeding Laboratories, in groups of 15 (except for the sham group, which had 9 animals), were immunized intradermally as follows: Group A: Sham Group B: BCG Tice Parental Control (10.sup.5 CFU) at Week 0 Group C: BCG Tice Parental Control (10.sup.5 CFU) at Week 0 and 100 g of r30 in SAF adjuvant at Week 4 Group D: BCG Tice Parental Control (10.sup.5 CFU) at Week 0 and 100 g of r30 in SAF adjuvant at Weeks 4 and 8 Group E: BCG Tice Parental Control (10.sup.5 CFU) at Week 0 and rAd/Mtb30 at Week 4 Group F: BCG Tice Parental Control (10.sup.5 CFU) at Week 0 and rAd/Mtb30 at Weeks 4 and 8 Group G: BCG Tice Parental Control (10.sup.5 CFU) at Week 0 and rLm/Mtb30 at Week 4 Group H: BCG Tice Parental Control (10.sup.5 CFU) at Week 0 and rLm/Mtb30 at Weeks 4 and 8

(87) Twenty weeks after immunization, all animals were challenged with an aerosol generated from a 7.5 ml single-cell suspension containing 6.310.sup.4 colony-forming units (CFU) of M. tuberculosis. (Prior to challenge, the challenge strain, M. tuberculosis Erdman strain (ATCC 35801), had been passaged through outbred guinea pigs to maintain virulence, cultured on 7H11 agar, subjected to gentle sonication to obtain a single cell suspension, and frozen at 70 C.). This relatively high dose aerosol dose delivered 75 live bacilli to the lungs of each animal. The airborne route of infection was used because this is the natural route of infection for pulmonary tuberculosis. A large dose was used so as to induce measurable clinical illness in 100% of control animals within a relatively short time frame (10 weeks). Afterwards, guinea pigs were individually housed in stainless steel cages contained within a laminar flow biohazard safety enclosure and allowed free access to standard laboratory chow and water. The animals were observed for illness and weighed weekly for 10 weeks and then euthanized. The right lung and spleen of each animal was removed and cultured for CFU of M. tuberculosis on Middlebrook 7H11 agar for two weeks at 37 C., 5% CO.sub.2-95% air atmosphere. The results were as follows:

(88) A. Deaths

(89) Four of the 9 sham-immunized animals died before the end of the experiment between weeks four and nine after challenge. Two of 15 animals in the group immunized first with BCG and then twice boosted with protein in adjuvant died in the last week of the experiment. All of the animals in the remaining groups survived until the end of the experiment.

(90) B. Net Weight Gain (Loss) After Challenge

(91) Animals in the sham-immunized group lost weight over the course of the experiment, with a mean net weight loss by the end of the experiment of 173 grams for the surviving animals (FIG. 4). Animals in the remaining groups maintained their weights but did not gain an appreciable amount of weight.

(92) C. Organ Burden

(93) The results of the assay for CFU in the lungs and spleens are shown in Table 4 and FIG. 5.

(94) TABLE-US-00004 TABLE 4 CFU in Lungs and Spleens - Experiment 2 High Dose Challenge; 20 week immunization-Challenge Interval Lung Spleen (Mean Log (Mean Log Group Strain CFU SE) CFU SE) A Sham 7.28 .22 5.59 0.41 B BCG 6.13 .20 4.13 0.31 C BCG + r30 x1 6.09 .22 4.39 0.37 D BCG + r30 x2 6.31 .13 4.52 0.36 E BCG + rAd/Mtb30 x 1 5.93 .22 4.34 0.28 F BCG + rAd/Mtb30 x 2 6.18 .20 4.13 0.32 G BCG + rLm/Mtb30 x 1 5.86 .18 3.98 0.24 H BCG + rLm/Mtb30 x 2 5.97 .21 3.73 0.41

(95) These results showed that animals immunized with BCG had much lower CFU in the lungs and spleens than the sham immunized animals. Animals immunized first with BCG and then boosted with r30 in adjuvant or rAd/Mtb30 once or twice had similar CFU to BCG immunized animals in this high dose challenge experiment with a 20-week immunizationchallenge interval. Animals immunized first with BCG and then boosted with rLm/Mtb30 once or twice had fewer CFU in the lung and spleen than BCG immunized animals in all cases. Animals immunized with BCG and boosted once with rLm/Mtb30 had 0.3 log fewer CFU in the lungs and 0.15 log fewer CFU in the spleen than animals immunized with only BCG. Animals immunized with BCG and boosted twice with rLm/Mtb30 had 0.2 log fewer CFU in the lungs and 0.4 log fewer CFU in the spleen than animals immunized with only BCG.

(96) Thus, in an experiment in which animals were challenged with a relatively high dose of aerosolized M. tuberculosis, such that nearly half of the sham-immunized animals died before the conclusion of the experiment, boosting BCG-immunized animals with rLm/Mtb30 improved protection against M. tuberculosis aerosol challenge.

(97) Experiment 3: Immunogenicity of rLm/Mtb30 in the Mouse Model

(98) Specific-pathogen free 6-8 week male C57BL/6 mice from Charles River Breeding Laboratories, in groups of 4, were immunized intradermally as follows: Group A: Sham Group B: BCG Tice Parental Control (10.sup.6 CFU) at Week 0 Group C: BCG Tice Parental Control (10.sup.6 CFU) at Week 0 and 100 g of r30 in SAF adjuvant at Weeks 3 and 6 Group D: BCG Tice Parental Control (10.sup.6 CFU) at Week 0 and rLm/30(01) (rLmactA/LLO-Mtb30) at Weeks 3 and 6 Group E: BCG Tice Parental Control (10.sup.5 CFU) at Week 0 and rLm/30(03) (rLmactAinlB/ActA-Mtb30) at Weeks 3 and 6 Group F: BCG Tice Parental Control (10.sup.5 CFU) at Week 0 and rLm/30(04) (rLmactAinlB/ActA-Mtb30-SL8) at Weeks 3 and 6 Group G: BCG Tice Parental Control (10.sup.5 CFU) at Week 0 and rLm/30(07) (rLmactAinlBuvrABprfA*/ActA-Mtb30) at Weeks 3 and 6 Group H: BCG Tice Parental Control (10.sup.5 CFU) at Week 0 and rLm/Mtb30(08) (rLmactAinlBuvrABprfA*/ActA-Mtb30-SL8) at Weeks 3 and 6 Group I: BCG Tice Parental Control (10.sup.5 CFU) at Week 0 and rLm/Mtb30(11) (rLmactAinlB/Mtb30) at Weeks 3 and 6 Group J: BCG Tice Parental Control (10.sup.5 CFU) at Week 0 and rLm/Mtb30(12) (rLmactAinlB uvrABprfA*/Mtb30) at Weeks 3 and 6 Group K: BCG Tice Parental Control (105 CFU) at Week 0 and rAd/Mtb30 at Weeks 3 and 6

(99) One week after the last immunization (Week 7), animals were anesthetized with Ketamine/Xylazine, bled and euthanized. Serum was isolated and used to assay for levels of antibodies specific to r30 (see below). In addition, a single cell suspension of splenocytes was prepared for assay of lymphocyte proliferation and intracellular interferon-gamma in response to r30. Red cells were lysed with 1 PharmLyse (BD Biosciences).

(100) Antibody Assay

(101) Serum was analyzed for IgG level by enzyme-linked immunosorbent assay (ELISA). Briefly, 96-well high-binding capacity plates (Corning, N.Y.) were coated or not coated with 0.1 ml of the r30 protein diluted in carbonate/bi-carbonate buffer (50 mM NaHCO.sub.3, 50 mM Na.sub.2CO.sub.3) to a final concentration of 10 g/ml. Excess antigen was removed by washing three times with PBS. Sera at a starting dilution of 1:12.5 were diluted further through a two-fold series with PBS. The diluted sera were incubated with r30 coated on 96-well plates at ambient temperature for 3 h. The plates were subsequently incubated for 90 min at ambient temperature with alkaline phosphatase-conjugated goat anti-mouse IgA (Sigma, St. Louis, Mo.) at a dilution of 1:1000. The plates then were washed three times with PBS and 0.05% Tween-20. One hundred l of p-nitrophenylphosphate substrate in diethanolamine buffer (Phosphatase Substrate kit, BioRad, Hercules, Calif.) was added to each well. The yellow color that developed was read at 414 nm for absorbance using a multiscan microplate reader (TiterTek, Huntsville, Ala.). The endpoint antibody titer was calculated as the reciprocal of the highest serum dilution that was 2 fold or above optical density units in r30 coated wells versus non-coated control wells.

(102) Splenic Lymphocyte Proliferation and Intracellular Cytokine Staining

(103) Splenocytes were incubated with or without r30 antigen and tested for lymphocyte proliferation and intracellular interferon gamma (IFN) expression. For the lymphocyte proliferation assay, splenocytes were allowed to proliferate for 48 hours. The amount of lymphocyte proliferation was detected by adding radioactive .sup.3H (tritiated) thymidine for 2 hours, which was incorporated into the newly synthesized DNA of the dividing cells. The amount of radioactivity incorporated into DNA was measured in a scintillation counter and is proportional to the number of proliferating cells, which in turn is a function of the number of lymphocytes that were stimulated by a given antigen to proliferate.

(104) To assay intracellular expression of IFN, splenocytes were incubated with or without r30 antigen in the presence of interleukin 2 (IL-2) for 24 hours. Intracellular cytokine staining was performed at day 6 after the last vaccination as described previously (see, e.g. Lee, et al. (2006). Identification, recombinant expression, immunolocalization in macrophages, and T-cell responsiveness of the major extracellular proteins of Francisella tularensis. Infect Immun 74(7): 4002-13; Jia, et al. (2009). Recombinant attenuated Listeria monocytogenes vaccine expressing Francisella tularensis IglC induces protection in mice against aerosolized Type A F. tularensis. Vaccine 27(8): 1216-29), using antibodies purchased from BD Biosciences Pharmingen. Briefly, after a 24 h incubation, Golgi-Plug (BD Pharmingen) was added and cells were incubated for an additional 11 h at 37 C. in a 5% CO.sub.2 atmosphere. Cells were pelleted at 250g for 5 min and resuspended in staining buffer (BD Pharmingen) containing Fc-Block (BD Pharmingen). After incubation for 15 min, cells were stained with fluorescein isothiocyanate (FITC)-labeled anti-CD4 or PE-Cy5-labeled anti-CD8 antibody at a 1:100 dilution for 30 min, washed twice in staining buffer, fixed with Cytofix solution for 20 min, and washed twice with Perm/Wash solution. Cells were then stained for intracellular interferon gamma (IFN) with PE-labeled rat anti-mouse IFN or a PE-labeled isotypic control immunoglobulin G at a dilution of 1:100. All the incubations were performed on ice in the dark. Stained cells were washed, resuspended in staining buffer, and analyzed on a FACSCalibur flow cytometer using CellQuest software.

(105) Results of Experiment 3 (Mouse Expt. TB01)

(106) A. Lymphocyte Proliferation

(107) As shown in FIG. 6A, mice primed with BCG and boosted with rLm/Mtb30 induced higher lymphocyte proliferative response to stimulation by r30 than sham-immunized mice and mice immunized with BCG alone. Among seven rLm/Mtb30 vaccines tested, vaccines derived from the rLmactAinlBuvrABprfA* vector (rLm/Mtb30(12), rLm/Mtb30(07) and rLm/Mtb30(08)) induced stronger immune responses than the corresponding vaccines derived from the rLmactAinlB vector (rLm/Mtb30(11), rLm/Mtb30(03) and rLm/Mtb30(04)). Mice primed with BCG and boosted with r30 or rAd30 also induced strong lymphocyte proliferation to r30.

(108) B. Serum Antibody Level

(109) As shown in FIG. 6 B, mice primed with BCG and boosted with r30+SAF had significantly higher antibody levels than sham-immunized mice and mice primed with BCG and boosted with rLm/Mtb30.

(110) C. Intracellular Expression of IFN

(111) Consistent with the lymphocyte proliferation assay results, mice primed with BCG and boosted with rLm/Mtb30 vaccines derived from rLmactAinlBuvrABprfA* vector (rLm/Mtb30(12), rLm/Mtb30(07) and rLm/Mtb30(08)) had stronger CD4+ mediated immune responses than the corresponding vaccines derived from the rLmactAinlB vector (rLm/Mtb30(11), rLm/Mtb30(03) and rLm/Mtb30(04)), although the difference did not reach statistical significance (FIG. 6C). There was no significant difference in CD8+ mediated immune responses among mice immunized with BCG alone or primed with BCG and boosted with either rLm/Mtb30 or rAd30 vaccines (FIG. 6D).

(112) Experiment 4: Protective Efficacy of Recombinant Listeria monocytogenes Vaccines Secreting the M. tuberculosis 30 kDa Major Secretory Protein (Antigen 85B) in the Mouse Model of Pulmonary tuberculosis

(113) Specific-pathogen free 6-8 week male C57BL/6 mice from Charles River Breeding Laboratories, in groups of 8, were immunized intradermally as follows: Group A: Sham Group B: BCG Tice Parental Control (10.sup.6 CFU) at Week 0 Group C: BCG Tice Parental Control (10.sup.6 CFU) at Week 0 and 100 g of r30 in SAF adjuvant at Weeks 3 and 6 Group D: BCG Tice Parental Control (10.sup.6 CFU) at Week 0 and LmactA (Vector control) at Weeks 3 and 6 Group E: BCG Tice Parental Control (10.sup.6 CFU) at Week 0 and rLm/30(01) (rLmactA/LLO-Mtb30) at Weeks 3 and 6 Group F: BCG Tice Parental Control (10.sup.5 CFU) at Week 0 and rLm/Mtb30(12) (rLmactAinlB uvrABprfA*/Mtb30) at Weeks 3 and 6 Group G: BCG Tice Parental Control (10.sup.5 CFU) at Week 0 and rLm/30(07) (rLmactAinlBuvrABprfA*/ActA-Mtb30) at Weeks 3 and 6 Group H: BCG Tice Parental Control (10.sup.5 CFU) at Week 0 and rAd/Mtb30 at Weeks 3 and 6

(114) At Week 12, all animals were challenged with an aerosol generated from a 7.5 ml single-cell suspension containing 6.310.sup.4 colony-forming units (CFU) of M. tuberculosis. (Prior to challenge, the challenge strain, M. tuberculosis Erdman strain (ATCC 35801), had been passaged through outbred guinea pigs to maintain virulence, cultured on 7H11 agar, subjected to gentle sonication to obtain a single cell suspension, and frozen at 70 C.). This aerosol dose delivered 100 live bacilli to the lungs of each animal. The airborne route of infection was used because this is the natural route of infection for pulmonary tuberculosis.

(115) At 6, 10, and 15 weeks after challenge, animals were euthanized. The lung and spleen of each animal was removed and cultured for CFU of M. tuberculosis on Middlebrook 7H11 agar for two weeks at 37 C., 5% CO.sub.2-95% air atmosphere. The results are shown in FIG. 7.

(116) These results show that animals immunized with BCG had lower CFU in the spleen and somewhat lower CFU in the lungs than the sham immunized animals. Animals immunized first with BCG and then boosted twice with r30 in adjuvant had slightly lower CFU in the spleen than BCG and significantly lower CFU in the lungs than BCG at all time points. Animals immunized first with BCG and then boosted twice with rAd/Mtb30 had lower CFU than BCG in the spleen only at the 6 week time point; at 10 and 15 weeks, these animals had similar CFU in the spleen. In the lung, these mice had lower CFU than BCG at all time points. Animals immunized first with BCG and then boosted twice with the Listeria vector control had CFU counts similar to BCG in the spleen at the 6 and 10 week timepoints and slightly greater but not significantly greater CFU counts in the spleen at 15 weeks. In the lungs, CFU counts were lower than BCG at 6 and 10 weeks, but similar to BCG at 15 weeks.

(117) Results for the listeria vectored vaccines varied somewhat between early and late timepoints. At 6 weeks after challenge, rLm30(01) had significantly fewer CFU counts than BCG in both the spleen and lung. rLm30(12) and rLm30(07) did not have fewer CFU counts than BCG in the spleen but did have fewer CFU counts in the lung. At 10 weeks, all Listeria vectored vaccines were better than BCG in both the lungs and spleen. rLm30(12) was comparable to rLm30(01) in the spleen but had lower CFU counts in the lungs. rLm30(07) gave the lowest counts of all vaccines in the spleen and CFU counts comparable to rLm30(12) in the lungs. At 15 weeks after challenge, all Listeria vectored vaccines had lower CFU counts than the vector control in the lung and spleen; they also had slightly lower CFU counts than BCG in the spleen and moderately lower CFU counts than BCG in the lungs.

(118) Experiment 5: Mouse Immunogenicity of Recombinant Listeria Vaccines

(119) Mice (4 per group) were sham-immunized, immunized with BCG at Week 0, or primed with BCG at Week 0 and then boosted twice at Week 3 and 6 with a) the recombinant 30 kD protein in adjuvant; b) the Lm actA vector, or c) one of five different rLm vaccines expressing the 30 kD proteinrLm30(01), rLm30(03), rLm30(07), rLm30(11), rLm30(12). At Week 10, the mice were euthanized, the spleen removed, a single cell suspension of lymphocytes prepared and used for studies as follows.

(120) A. Interferon- Production in Response to M. tuberculosis Antigens

(121) The splenocytes were stimulated with medium alone, the recombinant 30 kD protein (r30) or M. tuberculosis Purified Protein Derivative (PPD) for three days. The splenocyte supernatant fluid was collected and assayed for the level of IFN by ELISA. The results are shown in FIG. 8. Data are the meanS.E.

(122) In the absence of antigen, essentially no IFN was secreted by the splenocytes. In the presence of the purified 30 kDa protein or PPD, splenocytes from sham-immunized mice, mice immunized with only BCG, and mice immunized with BCG and boosted with the Listeria vector control secreted little or no IFN. In contrast, splenocytes from mice primed with BCG and boosted with the M. tuberculosis 30 kDA protein or the recombinant Listeria vaccines expressing the M. tuberculosis 30 kDa protein generally produced large amounts of IFN.

(123) B. Intracellular Cytokine Secretion

(124) The splenocytes were stimulated with the mature recombinant 30 kD protein (r30) or a pool of three peptides of r30 (30p) for a total of 6 hours (the last 4 hours in the presence of Golgi-Plug), and stained first for CD4 and CD8 and subsequently for the cytokines IFN, IL-2, and TNF, and analyzed by multi-parameter flow cytometry. The total frequency and mean fluorescence intensity (MFI) of each cytokine-secreting CD4+ T-cell was determined and the integrated MFI (iMFI) was calculated. The results are shown in FIG. 9. Data are the meanS.E. after background subtraction of the identically gated population of cells from the same sample stimulated without antigen.

(125) In the presence of the purified 30 kDa protein (r30) or the 30 kDa protein peptide pool (30p), splenocytes from sham-immunized mice, mice immunized only with BCG, and mice immunized with BCG and boosted with the Listeria vector control displayed low or negligible iMFI. In contrast, splenocytes from mice primed with BCG and boosted with the M. tuberculosis 30 kDA protein or the recombinant Listeria vaccines expressing the M. tuberculosis 30 kDa protein generally displayed moderate to large iMFI. Splenocytes from mice immunized with BCG and boosted with rLm30 (01), rLm30 (03), rLm30 (07), and rLm30 (12) had particularly large iMFI for each of the cytokines

(126) This concludes the description of embodiments of the present invention. The foregoing description of one or more embodiments of the invention has been presented for the purposes of illustration and description. It is not intended to be exhaustive or to limit the invention to the precise form disclosed. Many modifications and variations are possible in light of the above teaching. It is intended that the scope of the invention be limited not by this detailed description, but rather by the claims appended hereto.

(127) Those of skill in this art understand that aspects of this technology can be adapted to form a wide variety of embodiments of the invention. All literature and other references are incorporated herein by reference (e.g. WO 01/46473 and WO 02/094848). Literature describing methods and materials that relate to embodiments of the invention includes Brockstedt et al., (2004) Proc Natl Acad Sci USA 101(38): 13832-7. PMID 15365184; Brockstedt et al., (2005) Nat Med 11(8): 853-60. PMID 16041382; Colditz et al., (1994). JAMA 271(9): 698-702. PMID 8309034; Fine, P. E. (1989) Rev Infect Dis 11 Suppl 2: 5353-9. PMID 2652252; Harth et al., (1997) Infect Immun 65(6): 2321-8. PMID 9169770; Horwitz et al., (1995) Proc Natl Acad Sci USA 92(5): 1530-4. PMID 7878014; Horwitz et al., (2000) Proc Natl Acad Sci USA 97(25): 13853-8. PMID 11095745; Horwitz et al., (2005) Infect Immun 73(8): 4676-83. PMID 16040980; Jia et al., (2009) Vaccine 27(8): 1216-29. PMID 19126421; Lauer et al., (2008) Infect Immun 76(8): 3742-53. PMID 18541651; Lee et al., (2006) Infect Immun 74(7): 4002-13. PMID 16790773; McShane et al., (2004) Nat Med 10(11): 1240-4. PMID 15502839; Santosuosso et al., (2006) Infect Immun 74(8): 4634-43. PMID 16861651; Vordermeier et al., (2009) Infect Immun 77(8): 3364-73. PMID 19487476; Williams et al., (2005) Infect Immun 73(6): 3814-6. PMID 15908420; Xing et al., (2009) PLoS One 4(6): e5856. PMID 19516906; and Yan et al., (2008) Infect Immun 76(8): 3439-50. PMID 18474644

(128) It is intended that the scope of the invention be limited not by this detailed description, but rather by the claims appended hereto. The above specification, examples and data provide a complete description of the manufacture and use of the apparatus and method of the invention. Since many embodiments of the invention can be made without departing from the scope of the invention, the invention resides in the claims hereinafter appended and the equivalents thereto.

M. tuberculosis Polypeptide and Polynucleotide Sequences

(129) TABLE-US-00005 TABLE 5 Sequences of M. tuberculosis Extracellular Protein Genes Rv numbers/ Protein (kDa), Initial Illustrative # (Alternate Names) sequences Lab/Author References 1 12 (fragment of 16 Rv2031c B.-Y. Lee et al. Infect. Immun. kDa Membrane FDTRL . . . (Sequenced the 60: 2066, 1992 Protein, alpha 16 kDa Membrane J. Bact. 174: 1352, crystallian family) Protein) 1992 MMP Verbon et al. (Sequenced the 16 kDa Membrane Protein gene) 2 14 (MPT53) Rv2878c Horwitz Lab (Tuberculist: 18 kDa) ADERL . . . Gen Bank 3 16 (MPT63/Mpb63) Rv1926c Horwitz Lab Infect. Immun. Harth et al. 65: 2321, 1997 Manca et al. Infect. Immun. 65: 16, 1997 4 23 (SOD/SodA) Rv3846 Zhang et al. Molec. Harth & Micro. 5: 381, 1991 Horwitz J. Biol. Chem. 274: 4281, 1999 5 23.5 (MPT64) Rv1980c Horwitz Lab Infect. Immun. Oettinger & 62: 2058, 1994 Anderson Infect. Immun. Harth et al. 65: 2321, 1997 6 24 (MPT51) Rv3803c Horwitz Lab Scand. J. Immunol. APYEN . . . (O'Hara et 41: 433, 1995 al. published identical homolog in M. bovis) 7 30 (Antigen Rv1886c Horwitz Lab J. DNA Seq. & 85B/FbpB) DeWit et al. Map. 4: 267, 1994 Harth et al. Infect. Immun. 65: 2321, 1997 8 32A (Antigen Rv3804c Horwitz Lab Infect. Immun. 85A/FbpA) Borremans 57: 3123, 1989 Harth et al. Infect. Immun. 65: 2321, 1997 Rv numbers/ Protein (kDa), Initial # (Alternate Names) sequences Lab/Author Reference 9 32B (Antigen Rv0983 Content et al. Infect. Immun. 85C/pepD) 59: 3205, 1991 10 45 (MPT32/apa Rv1860 Laqueyerie et Infect. Immun. gene, modD) DPEPA . . . al. 63: 4003, 1995 11 58 (Glutamine Rv2220 Horwitz Lab J. Biol. Chem. Synthetase/GSI/ Harth & 272: 22728, 1997 glnA) Horwitz 12 71 (hsp/DnaK/ Rv0350 R. Young & D. Hsp70) ARAVG . . . Young Horwitz Lab 13 10.4 (EsxH/ Rv0288 ESAT-6 homolog) 14 14 (alpha Rv2031c crystalline homolog/heat shock protein HSPX) (Tuberculist: 16.2 kDa) 15 47 (isocitrate Rv0467 Mckinney J. D., et lyase/ICL/aceA) al, Nature, 406: 735, 2000 16 7.6 (Hypothetical Rv2660c Aaggard C, et al, protein) Nature Medicine, 17: 189, 2011 17 80 (glcB) Rv1837c Horwitz Lab TDRVSVGN . . . 18 110 (can) Rv1475c Horwitz Lab (Tuberculist: 102 kDa) NSKSVNSFGA . . . 19 9.9 (ESAT-6/esxA) Rv3875 Note 1: Proteins 14, 15, and 16 are latency-associated proteins Note 2: All sequences now available on-line as a result of the M. tuberculosis genome project. See: Cole et al. Nature. Nature 393: 537-544, 1998. Note 3: See also U.S. Pat. Nos. 7,622,107; 7,300,660; 7,002,002; 6,924,118; 6,818,223; 6,761,894; 6,752,993; 6,599,510; 6,471,967; 6,054,133; 6,013,660; and 5,108,745; and U.S. patent application Nos. 20110129492; 20100284963; 20100183547; and 20100092518, the contents of which are incorporated by reference.
M. tuberculosis Protein and coding sequences noted in Table 5 above are provided below. Note: All sequences are from http://genolist.pasteur.fr/TubercuList/. 1. 12 kDa (fragment of 16 kDa membrane protein, alpha crystalline homolog, heat shock protein HSPX, and number 14 in the protein list), 110 aa

(130) TABLE-US-00006 (SEQIDNO:5) FDTRLMRLEDEMKEGRYEVRAELPGVDPDKDVDIMVRDGQLTIKAERTEQ KDFDGRSEFAYGSFVRTVSLPVGADEDDIKATYDKGILTVSVAVSEGKPT EKHIQIRSTN 12 kDa fragment of 16 kDa membrane protein, MMP: 333 bp

(131) TABLE-US-00007 (SEQIDNO:23) ttcgacacccggttgatgcggctggaagacgagatgaaagaggggcgcta cgaggtacgcgcggagcttcccggggtcgaccccgacaaggacgtcgaca ttatggtccgcgatggtcagctgaccatcaaggccgagcgcaccgagcag aaggacttcgacggtcgctcggaattcgcgtacggttccttcgttcgcac ggtgtcgctgccggtaggtgctgacgaggacgacattaaggccacctacg acaagggcattcttactgtgtcggtggcggtttcggaagggaagccaacc gaaaagcacattcagatccggtccaccaactga 2. M. tuberculosis H37Rv|Rv2878c|Mpt53: 173 aaSOLUBLE SECRETED ANTIGEN MPT53 PRECURSOR. First identified protein sequence starts from ADERL . . . :

(132) TABLE-US-00008 (SEQIDNO:6) MSLRLVSPIKAFADGIVAVAIAVVLMFGLANTPRAVAADERLQFTATTLS GAPFDGASLQGKPAVLWFWTPWCPFCNAEAPSLSQVAAANPAVTFVGIAT RADVGAMQSFVSKYNLNFTNLNDADGVIWARYNVPWQPAFVFYRADGTST FVNNPTAAMSQDELSGRVAALTS M. tuberculosis H37Rv|Rv2878c|mpt53: 522 bpSOLUBLE SECRETED ANTIGEN MPT53 PRECURSOR

(133) TABLE-US-00009 (SEQIDNO:24) atgagtcttcgcctggtgtccccgatcaaggcgtttgcggacggcattgt ggccgttgctatcgcggttgtcctgatgttcggtctggccaatacaccgc gagcggtggcagccgatgaacgtctgcagttcaccgcaaccacgctcagc ggtgctcccttcgatggcgcaagcctgcaaggcaagccggcggtgttgtg gttctggacgccgtggtgcccgttctgcaacgcagaagcccccagcctca gccaggtagcggccgctaatccggcggtcaccttcgtcggaatcgccacc cgcgccgacgtcggggcgatgcagagctttgtctcgaagtacaacctgaa tttcaccaacctcaatgacgccgatggtgtgatctgggcccgctacaacg tgccttggcaaccggcatttgtgttctatcgcgcggacggcacatcgacg ttcgtcaacaaccccaccgcggccatgtctcaggacgagctgtccggccg ggtggctgcgctgacgtcctgacccggtgaacgaggcgctgatcggtttg gcgttcgccgccgggttggtggctgcgctgaacccatgcgggtttgccat gttgccggcctacctgctgttggtggtgtatgggcaggattcggcgggcc ggacggggccgcttagcgcagtgggccgagcggcagccgccacggtcggg atggcgctgggcttcttgacgg 3. M. tuberculosis H37Rv|Rv1926c|Mpt63: 159 aaIMMUNOGENIC PROTEIN MPT63 (ANTIGEN MPT63/MPB63) (16 kDa IMMUNOPROTECTIVE EXTRACELLULAR PROTEIN)

(134) TABLE-US-00010 (SEQIDNO:7) MKLTTMIKTAVAVVAMAAIATFAAPVALAAYPITGKLGSELTMTDTVGQV VLGWKVSDLKSSTAVIPGYPVAGQVWEATATVNAIRGSVTPAVSQFNART ADGINYRVLWQAAGPDTISGATIPQGEQSTGKIYFDVTGPSPTIVAMNNG MEDLLIWEP M. tuberculosis H37Rv|Rv1926c|mpt63: 480 bp-IMMUNOGENIC PROTEIN MPT63 (ANTIGEN MPT63/MPB63) (16 kDa IMMUNOPROTECTIVE EXTRACELLULAR PROTEIN)

(135) TABLE-US-00011 (SEQIDNO:25) atgaagctcaccacaatgatcaagacggcagtagcggtcgtggccatggc ggccatcgcgacctttgcggcaccggtcgcgttggctgcctatcccatca ccggaaaacttggcagtgagctaacgatgaccgacaccgttggccaagtc gtgctcggctggaaggtcagtgatctcaaatccagcacggcagtcatccc cggctatccggtggccggccaggtctgggaggccactgccacggtcaatg cgattcgcggcagcgtcacgcccgcggtctcgcagttcaatgcccgcacc gccgacggcatcaactaccgggtgctgtggcaagccgcgggccccgacac cattagcggagccactatcccccaaggcgaacaatcgaccggcaaaatct acttcgatgtcaccggcccatcgccaaccatcgtcgcgatgaacaacggc atggaggatctgctgatttgggagccgtag 4. M. tuberculosis H37Rv|Rv3846|SodA: 207 aaSUPEROXIDE DISMUTASE (FE) SODA

(136) TABLE-US-00012 (SEQIDNO:8) VAEYTLPDLDWDYGALEPHISGQINELHHSKHHATYVKGANDAVAKLEEA RAKEDHSAILLNEKNLAFNLAGHVNHTIWWKNLSPNGGDKPTGELAAAIA DAFGSFDKFRAQFHAAATTVQGSGWAALGWDTLGNKLLIFQVYDHQTNFP LGIVPLLLLDMWEHAFYLQYKNVKVDFAKAFWNVVNWADVQSRYAAATSQ TKGLIFG

(137) M. tuberculosis H37Rv|Rv3846|sodA: 624 bpSUPEROXIDE DISMUTASE (FE) SODA

(138) TABLE-US-00013 (SEQIDNO:26) gtggccgaatacaccttgccagacctggactgggactacggagcactgga accgcacatctcgggtcagatcaacgagcttcaccacagcaagcaccacg ccacctacgtaaagggcgccaatgacgccgtcgccaaactcgaagaggcg cgcgccaaggaagatcactcagcgatcttgctgaacgaaaagaatctagc tttcaacctcgccggccacgtcaatcacaccatctggtggaagaacctgt cgcctaacggtggtgacaagcccaccggcgaactcgccgcagccatcgcc gacgcgttcggttcgttcgacaagttccgtgcgcagttccacgcggccgc taccaccgtgcaggggtcgggctgggcggcactgggctgggacacactcg gcaacaagctgctgatattccaggtttacgaccaccagacgaacttcccg ctaggcattgttccgctgctgctgctcgacatgtgggaacacgccttcta cctgcagtacaagaacgtcaaagtcgactttgccaaggcgttttggaacg tcgtgaactgggccgatgtgcagtcacggtatgcggccgcgacctcgcag accaaggggttgatattcggctga 5. M. tuberculosis H37Rv|Rv1980c|Mpt64: 228 aaIMMUNOGENIC PROTEIN MPT64 (ANTIGEN MPT64/MPB64)

(139) TABLE-US-00014 (SEQIDNO:9) VRIKIFMLVTAVVLLCCSGVATAAPKTYCEELKGTDTGQACQIQMSDPAY NINISLPSYYPDQKSLENYIAQTRDKFLSAATSSTPREAPYELNITSATY QSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQA DTDPLPVVFPIVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFF FNPGELLPEAAGPTQVLVPRSAIDSMLA M. tuberculosis H37Rv|Rv1980c|mpt64: 687 bpIMMUNOGENIC PROTEIN MPT64 (ANTIGEN MPT64/MPB64)

(140) TABLE-US-00015 (SEQIDNO:27) gtgcgcatcaagatcttcatgctggtcacggctgtcgttttgctctgttg ttcgggtgtggccacggccgcgcccaagacctactgcgaggagttgaaag gcaccgataccggccaggcgtgccagattcaaatgtccgacccggcctac aacatcaacatcagcctgcccagttactaccccgaccagaagtcgctgga aaattacatcgcccagacgcgcgacaagttcctcagcgcggccacatcgt ccactccacgcgaagccccctacgaattgaatatcacctcggccacatac cagtccgcgataccgccgcgtggtacgcaggccgtggtgctcaaggtcta ccagaacgccggcggcacgcacccaacgaccacgtacaaggccttcgatt gggaccaggcctatcgcaagccaatcacctatgacacgctgtggcaggct gacaccgatccgctgccagtcgtcttccccattgtgcaaggtgaactgag caagcagaccggacaacaggtatcgatagcgccgaatgccggcttggacc cggtgaattatcagaacttcgcagtcacgaacgacggggtgattttcttc ttcaacccgggggagttgctgcccgaagcagccggcccaacccaggtatt ggtcccacgttccgcgatcgactcgatgctggcctag 6. M. tuberculosis H37Rv|Rv3803c|FbpD: 299 aaSECRETED MPT51/MPB51 ANTIGEN PROTEIN FBPD (MPT51/MPB51 ANTIGEN 85 COMPLEX C) (AG58C) (MYCOLYL TRANSFERASE 85C) (FIBRONECTIN-BINDING PROTEIN C) (85C)

(141) TABLE-US-00016 (SEQIDNO:10) MKGRSALLRALWIAALSFGLGGVAVAAEPTAKAAPYENLMVPSPSMGRDI PVAFLAGGPHAVYLLDAFNAGPDVSNWVTAGNAMNTLAGKGISVVAPAGG AYSMYTNWEQDGSKQWDTFLSAELPDWLAANRGLAPGGHAAVGAAQGGYG AMALAAFHPDRFGFAGSMSGFLYPSNTTTNGAIAAGMQQFGGVDTNGMWG APQLGRWKWHDPWVHASLLAQNNTRVWVWSPTNPGASDPAAMIGQAAEAM GNSRMFYNQYRSVGGHNGHFDFPASGDNGWGSWAPQLGAMSGDIVGAIR

(142) TABLE-US-00017 (SEQIDNO:28) atgaagggtcggtcggcgctgctgcgggcgctctggattgccgcactgtc attcgggttgggcggtgtcgcggtagccgcggaacccaccgccaaggccg ccccatacgagaacctgatggtgccgtcgccctcgatgggccgggacatc ccggtggccttcctagccggtgggccgcacgcggtgtatctgctggacgc cttcaacgccggcccggatgtcagtaactgggtcaccgcgggtaacgcga tgaacacgttggcgggcaaggggatttcggtggtggcaccggccggtggt gcgtacagcatgtacaccaactgggagcaggatggcagcaagcagtggga caccttcttgtccgctgagctgcccgactggctggccgctaaccggggct tggcccccggtggccatgcggccgttggcgccgctcagggcggttacggg gcgatggcgctggcggccttccaccccgaccgcttcggcttcgctggctc gatgtcgggctttttgtacccgtcgaacaccaccaccaacggtgcgatcg cggcgggcatgcagcaattcggcggtgtggacaccaacggaatgtgggga gcaccacagctgggtcggtggaagtggcacgacccgtgggtgcatgccag cctgctggcgcaaaacaacacccgggtgtgggtgtggagcccgaccaacc cgggagccagcgatcccgccgccatgatcggccaagccgccgaggcgatg ggtaacagccgcatgttctacaaccagtatcgcagcgtcggcgggcacaa cggacacttcgacttcccagccagcggtgacaacggctggggctcgtggg cgccccagctgggcgctatgtcgggcgatatcgtcggtgcgatccgctaa 7. M. tuberculosis H37Rv|Rv1886c|FbpB: 325 aaSECRETED ANTIGEN 85-B FBPB (85B) (ANTIGEN 85 COMPLEX B) (MYCOLYL TRANSFERASE 85B) (FIBRONECTIN-BINDING PROTEIN B) (EXTRACELLULAR ALPHA-ANTIGEN)

(143) TABLE-US-00018 (SEQIDNO:4) MTDVSRKIRAWGRRLMIGTAAAVVLPGLVGLAGGAATAGAFSRPGLPVEY LQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEW YYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLS ANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMG PSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVY CGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNG THSWEYWGAQLNAMKGDLQSSLGAG

(144) TABLE-US-00019 (SEQIDNO:29) atgacagacgtgagccgaaagattcgagcttggggacgccgattgatgat cggcacggcagcggctgtagtccttccgggcctggtggggcttgccggcg gagcggcaaccgcgggcgcgttctcccggccggggctgccggtcgagtac ctgcaggtgccgtcgccgtcgatgggccgcgacatcaaggttcagttcca gagcggtgggaacaactcacctgcggtttatctgctcgacggcctgcgcg cccaagacgactacaacggctgggatatcaacaccccggcgttcgagtgg tactaccagtcgggactgtcgatagtcatgccggtcggcgggcagtccag cttctacagcgactggtacagcccggcctgcggtaaggctggctgccaga cttacaagtgggaaaccttcctgaccagcgagctgccgcaatggttgtcc gccaacagggccgtgaagcccaccggcagcgctgcaatcggcttgtcgat ggccggctcgtcggcaatgatcttggccgcctaccacccccagcagttca tctacgccggctcgctgtcggccctgctggacccctctcaggggatgggg cctagcctgatcggcctcgcgatgggtgacgccggcggttacaaggccgc agacatgtggggtccctcgagtgacccggcatgggagcgcaacgacccta cgcagcagatccccaagctggtcgcaaacaacacccggctatgggtttat tgcgggaacggcaccccgaacgagttgggcggtgccaacatacccgccga gttcttggagaacttcgttcgtagcagcaacctgaagttccaggatgcgt acaacgccgcgggcgggcacaacgccgtgttcaacttcccgcccaacggc acgcacagctgggagtactggggcgctcagctcaacgccatgaagggtga cctgcagagttcgttaggcgccggctga 8. M. tuberculosis H37Rv|Rv3804c|FbpA: 338 aaSECRETED ANTIGEN 85-A FBPA (MYCOLYL TRANSFERASE 85A) (FIBRONECTIN-BINDING PROTEIN A) (ANTIGEN 85 COMPLEX A)

(145) TABLE-US-00020 (SEQIDNO:11) MQLVDRVRGAVTGMSRRLVVGAVGAALVSGLVGAVGGTATAGAFSRPGLP VEYLQVPSPSMGRDIKVQFQSGGANSPALYLLDGLRAQDDFSGWDINTPA FEWYDQSGLSVVMPVGGQSSFYSDWYQPACGKAGCQTYKWETFLTSELPG WLQANRHVKPTGSAVVGLSMAASSALTLAIYHPQQFVYAGAMSGLLDPSQ AMGPTLIGLAMGDAGGYKASDMWGPKEDPAWQRNDPLLNVGKLIANNTRV WVYCGNGKPSDLGGNNLPAKFLEGFVRTSNIKFQDAYNAGGGHNGVFDFP DSGTHSWEYWGAQLNAMKPDLQRALGATPNTGPAPQGA

(146) TABLE-US-00021 (SEQIDNO:30) atgcagcttgttgacagggttcgtggcgccgtcacgggtatgtcgcgtcg actcgtggtcggggccgtcggcgcggccctagtgtcgggtctggtcggcg ccgtcggtggcacggcgaccgcgggggcattttcccggccgggcttgccg gtggagtacctgcaggtgccgtcgccgtcgatgggccgtgacatcaaggt ccaattccaaagtggtggtgccaactcgcccgccctgtacctgctcgacg gcctgcgcgcgcaggacgacttcagcggctgggacatcaacaccccggcg ttcgagtggtacgaccagtcgggcctgtcggtggtcatgccggtgggtgg ccagtcaagcttctactccgactggtaccagcccgcctgcggcaaggccg gttgccagacttacaagtgggagaccttcctgaccagcgagctgccgggg tggctgcaggccaacaggcacgtcaagcccaccggaagcgccgtcgtcgg tctttcgatggctgcttcttcggcgctgacgctggcgatctatcaccccc agcagttcgtctacgcgggagcgatgtcgggcctgttggacccctcccag gcgatgggtcccaccctgatcggcctggcgatgggtgacgctggcggcta caaggcctccgacatgtggggcccgaaggaggacccggcgtggcagcgca acgacccgctgttgaacgtcgggaagctgatcgccaacaacacccgcgtc tgggtgtactgcggcaacggcaagccgtcggatctgggtggcaacaacct gccggccaagttcctcgagggcttcgtgcggaccagcaacatcaagttcc aagacgcctacaacgccggtggcggccacaacggcgtgttcgacttcccg gacagcggtacgcacagctgggagtactggggcgcgcagctcaacgctat gaagcccgacctgcaacgggcactgggtgccacgcccaacaccgggcccg cgccccagggcgcctag 9. M. tuberculosis H37Rv|Rv0983|PepD: 464 aaPROBABLE SERINE PROTEASE PEPD (SERINE PROTEINASE) (MTB32B)

(147) TABLE-US-00022 (SEQIDNO:12) MAKLARVVGLVQEEQPSDMTNHPRYSPPPQQPGTPGYAQGQQQTYSQQFD WRYPPSPPPQPTQYRQPYEALGGTRPGLIPGVIPTMTPPPGMVRQRPRAG MLAIGAVTIAVVSAGIGGAAASLVGFNRAPAGPSGGPVAASAAPSIPAAN MPPGSVEQVAAKVVPSVVMLETDLGRQSEEGSGIILSAEGLILTNNHVIA AAAKPPLGSPPPKTTVTFSDGRTAPFTVVGADPTSDIAVVRVQGVSGLTP ISLGSSSDLRVGQPVLAIGSPLGLEGTVTTGIVSALNRPVSTTGEAGNQN TVLDAIQTDAAINPGNSGGALVNMNAQLVGVNSAIATLGADSADAQSGSI GLGFAIPVDQAKRIADELISTGKASHASLGVQVTNDKDTLGAKIVEVVAG GAAANAGVPKGVVVTKVDDRPINSADALVAAVRSKAPGATVALTFQDPSG GSRTVQVTLGKAEQ M. tuberculosis H37Rv|Rv0983|pepD: 1395 bpPROBABLE SERINE PROTEASE PEPD (SERINE PROTEINASE) (MTB32B)

(148) TABLE-US-00023 (SEQIDNO:31) atggccaagttggcccgagtagtgggcctagtacaggaagagcaacctag cgacatgacgaatcacccacggtattcgccaccgccgcagcagccgggaa ccccaggttatgctcaggggcagcagcaaacgtacagccagcagttcgac tggcgttacccaccgtccccgcccccgcagccaacccagtaccgtcaacc ctacgaggcgttgggtggtacccggccgggtctgatacctggcgtgattc cgaccatgacgccccctcctgggatggttcgccaacgccctcgtgcaggc atgttggccatcggcgcggtgacgatagcggtggtgtccgccggcatcgg cggcgcggccgcatccctggtcgggttcaaccgggcacccgccggcccca gcggcggcccagtggctgccagcgcggcgccaagcatccccgcagcaaac atgccgccggggtcggtcgaacaggtggcggccaaggtggtgcccagtgt cgtcatgttggaaaccgatctgggccgccagtcggaggagggctccggca tcattctgtctgccgaggggctgatcttgaccaacaaccacgtgatcgcg gcggccgccaagcctcccctgggcagtccgccgccgaaaacgacggtaac cttctctgacgggcggaccgcacccttcacggtggtgggggctgacccca ccagtgatatcgccgtcgtccgtgttcagggcgtctcc 10. M. tuberculosis H37Rv|Rv1860|Apa: 325 aaALANINE AND PROLINE RICH SECRETED PROTEIN APA (FIBRONECTIN ATTACHMENT PROTEIN) (Immunogenic protein MPT32) (Antigen MPT-32) (45-kDa glycoprotein) (45/47 kDa antigen)

(149) TABLE-US-00024 (SEQIDNO:13) MHQVDPNLTRRKGRLAALAIAAMASASLVTVAVPATANADPEPAPPVPTT AASPPSTAAAPPAPATPVAPPPPAAANTPNAQPGDPNAAPPPADPNAPPP PVIAPNAPQPVRIDNPVGGFSFALPAGWVESDAAHFDYGSALLSKTTGDP PFPGQPPPVANDTRIVLGRLDQKLYASAEATDSKAAARLGSDMGEFYMPY PGTRINQETVSLDANGVSGSASYYEVKFSDPSKPNGQIWTGVIGSPAANA PDAGPPQRWFVVWLGTANNPVDKGAAKALAESIRPLVAPPPAPAPAPAEP APAPAPAGEVAPTPTTPTPQRTLPA M. tuberculosis H37Rv|Rv1860|apa: 978 bpALANINE AND PROLINE RICH SECRETED PROTEIN APA (PIBRONECTIN ATTACHMENT PROTEIN) (Immunogenic protein MPT32) (Antigen MPT-32) (45-kDa glycoprotein) (45/47 kDa antigen)

(150) TABLE-US-00025 (SEQIDNO:32) atgcatcaggtggaccccaacttgacacgtcgcaagggacgattggcggc actggctatcccggcgatggccagcgccagcctggtgaccgttgcggtgc ccgcgaccgccaacgccgatccggagccagcgcccccggtacccacaacg gccgcctcgccgccgtcgaccgctgcagcgccacccgcaccggcgacacc tgttgcccccccaccaccggccgccgccaacacgccgaatgcccagccgg gcgatcccaacgcagcacctccgccggccgacccgaacgcaccgccgcca cctgtcattgccccaaacgcaccccaacctgtccggatcgacaacccggt tggaggattcagcttcgcgctgcctgctggctgggtggagtctgacgccg cccacttcgactacggttcagcactcctcaccaaaaccaccggggacccg ccatttcccggacagccgccgccggtggccaatgacacccgtatcgtgct cggccggctagaccaaaagctttacgccagcgccgaagccaccgactcca aggccgcggcccggttgggctcggacatcggtgagttctatatgccctac ccgggcacccggatcaaccaggaaaccgtctcgctcgacgccaacggggt gtctggaagcgcgtcgtattacgaagtcaagttcagcgatccgagtaagc cgaacggccagatctggacgggcgtaatcggctcgcccgcggcgaacgca ccggacgccgggccccctcagcgctggtttgtggtatggctcgggaccgc caacaacccggtggacaagggcgcggccaaggcgctggccgaatcgatcc ggcctttggtcgccccgccgccggcgccggcaccggctcctgcagagccc gctccggcgccggcgccggccggggaagtcgctcctaccccgacgacacc gacaccgcagcggaccttaccggcctga 11. M. tuberculosis H37Rv|Rv2220|GlnA1: 478 aaGLUTAMINE SYNTHETASE GLNA1 (GLUTAMINE SYNTHASE) (GS-I)

(151) TABLE-US-00026 (SEQIDNO:14) VTEKTPDDVFKLAKDEKVEYVDVRFCDLPGIMQHFTIPASAFDKSVFDDG LAFDGSSIRGFQSIHESDMLLLPDPETARIDPFRAAKTLNINFFVHDPFT LEPYSRDPRNIARKAENYLISTGIADTAYFGAEAEFYIFDSVSFDSRANG SFYEVDAISGWWNTGAATEADGSPNRGYKVRHKGGYFPVAPNDQYVDLRD KMLTNLINSGFILEKGHHEVGSGGQAEINYQFNSLLHAADDMQLYKYIIK NTAWQNGKTVTFMPKPLFGDNGSGMHCHQSLWKDGAPLMYDETGYAGLSD TARHYIGGLLHHAPSLLAFTNPTVNSYKRLVPGYEAPINLVYSQRNRSAC VRIPITGSNPKAKRLEFRSPDSSGNPYLAFSAMLMAGLDGIKNKIEPQAP VDKDLYELPPEEAASIPQTPTQLSDVIDRLEADHEYLTEGGVFTNDLIET WISFKRENEIEPVNIRPHPYEFALYYDV M. tuberculosis H37Rv|Rv2220|glnA1: 1437 bpGLUTAMINE SYNTHETASE GLNA1 (GLUTAMINE SYNTHASE) (GS-I)

(152) TABLE-US-00027 (SEQIDNO:33) gtgacggaaaagacgcccgacgacgtcttcaaacttgccaaggacgagaa ggtcgaatatgtcgacgtccggttctgtgacctgcctggcatcatgcagc acttcacgattccggcttcggcctttgacaagagcgtgtttgacgacggc ttggcctttgacggctcgtcgattcgcgggttccagtcgatccacgaatc cgacatgttgcttcttcccgatcccgagacggcgcgcatcgacccgttcc gcgcggccaagacgctgaatatcaacttctttgtgcacgacccgttcacc ctggagccgtactcccgcgacccgcgcaacatcgcccgcaaggccgagaa ctacctgatcagcactggcatcgccgacaccgcatacttcggcgccgagg ccgagttctacattttcgattcggtgagcttcgactcgcgcgccaacggc tccttctacgaggtggacgccatctcggggtggtggaacaccggcgcggc gaccgaggccgacggcagtcccaaccggggctacaaggtccgccacaagg gcgggtatttcccagtggcccccaacgaccaatacgtcgacctgcgcgac aagatgctgaccaacctgatcaactccggcttcatcctggagaagggcca ccacgaggtgggcagcggcggacaggccgagatcaactaccagttcaatt cgctgctgcacgccgccgacgacatgcagttgtacaagtacatcatcaag aacaccgcctggcagaacggcaaaacggtcacgttcatgcccaagccgct gttcggcgacaacgggtccggcatgcactgtcatcagtcgctgtggaagg acggggccccgctgatgtacgacgagacgggttatgccggtctgtcggac acggcccgtcattacatcggcggcctgttacaccacgcgccgtcgctgct ggccttcaccaacccgacggtgaactcctacaagcggctggttcccggtt acgaggccccgatcaacctggtctatagccagcgcaaccggtcggcatgc gtgcgcatcccgatcaccggcagcaacccgaaggccaagcggctggagtt ccgaagccccgactcgtcgggcaacccgtatctggcgttctcggccatgc tgatggcaggcctggacggtatcaagaacaagatcgagccgcaggcgccc gtcgacaaggatctctacgagctgccgccggaagaggccgcgagtatccc gcagactccgacccagctgtcagatgtgatcgaccgtctcgaggccgacc acgaatacctcaccgaaggaggggtgttcacaaacgacctgatcgagacg tggatcagtttcaagcgcgaaaacgagatcgagccggtcaacatccggcc gcatccctacgaattcgcgctgtactacgacgtttaa 12. M. tuberculosis H37Rv|Rv0350|DnaK: 625 aaPROBABLE CHAPERONE PROTEIN DNAK (HEAT SHOCK PROTEIN 70) (HEAT SHOCK 70 KDA PROTEIN) (HSP70)

(153) TABLE-US-00028 (SEQIDNO:15) MARAVGIDLGTTNSVVSVLEGGDPVVVANSEGSRTTPSIVAFARNGEVLV GQPAKNQAVTNVDRTVRSVKRHMGSDWSIEIDGKKYTAPEISARILMKLK RDAEAYLGEDITDAVITTPAYFNDAQRQATKDAGQIAGLNVLRIVNEPTA AALAYGLDKGEKEQRILVFDLGGGTFDVSLLEIGEGVVEVRATSGDNHLG GDDWDQRVVDWLVDKFKGTSGIDLTKDKMAMQRLREAAEKAKIELSSSQS TSINLPYITVDADKNPLFLDEQLTRAEFQRITQDLLDRTRKPFQSVIADT GISVSEIDHVVLVGGSTRMPAVTDLVKELTGGKEPNKGVNPDEVVAVGAA LQAGVLKGEVKDVLLLDVTPLSLGIETKGGVMTRLIERNTTIPTKRSETF TTADDNQPSVQIQVYQGEREIAAHNKLLGSFELTGIPPAPRGIPQIEVTF DIDANGIVHVTAKDKGTGKENTIRIQEGSGLSKEDIDRMIKDAEAHAEED RKRREEADVRNQAETLVYQTEKFVKEQREAEGGSKVPEDTLNKVDAAVAE AKAALGGSDISAIKSAMEKLGQESQALGQAIYEAAQAASQATGAAHPGGE PGGAHPGSADDVVDAEVVDDGREAK M. tuberculosis H37Rv|Rv0350|dnaK: 1878 bpPROBABLE CHAPERONE PROTEIN DNAK (HEAT SHOCK PROTEIN 70) (HEAT SHOCK 70 KDA PROTEIN) (HSP70)

(154) TABLE-US-00029 (SEQIDNO:34) atggctcgtgcggtcgggatcgacctcgggaccaccaactccgtcgtctc ggttctggaaggtggcgacccggtcgtcgtcgccaactccgagggctcca ggaccaccccgtcaattgtcgcgttcgcccgcaacggtgaggtgctggtc ggccagcccgccaagaaccaggcagtgaccaacgtcgatcgcaccgtgcg ctcggtcaagcgacacatgggcagcgactggtccatagagattgacggca agaaatacaccgcgccggagatcagcgcccgcattctgatgaagctgaag cgcgacgccgaggcctacctcggtgaggacattaccgacgcggttatcac gacgcccgcctacttcaatgacgcccagcgtcaggccaccaaggacgccg gccagatcgccggcctcaacgtgctgcggatcgtcaacgagccgaccgcg gccgcgctggcctacggcctcgacaagggcgagaaggagcagcgaatcct ggtcttcgacttgggtggtggcactttcgacgtttccctgctggagatcg gcgagggtgtggttgaggtccgtgccacttcgggtgacaaccacctcggc ggcgacgactgggaccagcgggtcgtcgattggctggtggacaagttcaa gggcaccagcggcatcgatctgaccaaggacaagatggcgatgcagcggc tgcgggaagccgccgagaaggcaaagatcgagctgagttcgagtcagtcc acctcgatcaacctgccctacatcaccgtcgacgccgacaagaacccgtt gttcttagacgagcagctgacccgcgcggagttccaacggatcactcagg acctgctggaccgcactcgcaagccgttccagtcggtgatcgctgacacc ggcatttcggtgtcggagatcgatcacgttgtgctcgtgggtggttcgac ccggatgcccgcggtgaccgatctggtcaaggaactcaccggcggcaagg aacccaacaagggcgtcaaccccgatgaggttgtcgcggtgggagccgct ctgcaggccggcgtcctcaagggcgaggtgaaagacgttctgctgcttga tgttaccccgctgagcctgggtatcgagaccaagggcggggtgatgacca ggctcatcgagcgcaacaccacgatccccaccaagcggtcggagactttc accaccgccgacgacaaccaaccgtcggtgcagatccaggtctatcaggg ggagcgtgagatcgccgcgcacaacaagttgctcgggtccttcgagctga ccggcatcccgccggcgccgcgggggattccgcagatcgaggtcactttc gacatcgacgccaacggcattgtgcacgtcaccgccaaggacaagggcac cggcaaggagaacacgatccgaatccaggaaggctcgggcctgtccaagg aagacattgaccgcatgatcaaggacgccgaagcgcacgccgaggaggat cgcaagcgtcgcgaggaggccgatgttcgtaatcaagccgagacattggt ctaccagacggagaagttcgtcaaagaacagcgtgaggccgagggtggtt cgaaggtacctgaagacacgctgaacaaggttgatgccgcggtggcggaa gcgaaggcggcacttggcggatcggatatttcggccatcaagtcggcgat ggagaagctgggccaggagtcgcaggctctggggcaagcgatctacgaag cagctcaggctgcgtcacaggccactggcgctgcccaccccggcggcgag ccgggcggtgcccaccccggctcggctgatgacgttgtggacgcggaggt ggtcgacgacggccgggaggccaagtga 13. M. tuberculosis H37Rv|Rv0288|EsxH: 96 aaLOW MOLECULAR WEIGHT PROTEIN ANTIGEN 7 ESXH (10 kDa ANTIGEN) (CFP-7) (PROTEIN TB10.4)

(155) TABLE-US-00030 (SEQIDNO:16) MSQIMYNYPAMLGHAGDMAGYAGTLQSLGAEIAVEQAALQSAWQGDTGIT YQAWQAQWNQAMEDLVRAYHAMSSTHEANTMAMMARDTAEAAKWGG M. tuberculosis H37Rv|Rv0288|esxH: 291 bpLOW MOLECULAR WEIGHT PROTEIN ANTIGEN 7 ESXH (10 kDa ANTIGEN) (CFP-7) (PROTEIN TB10.4)

(156) TABLE-US-00031 (SEQIDNO:35) atgtcgcaaatcatgtacaactaccccgcgatgttgggtcacgccgggga tatggccggatatgccggcacgctgcagagcttgggtgccgagatcgccg tggagcaggccgcgttgcagagtgcgtggcagggcgataccgggatcacg tatcaggcgtggcaggcacagtggaaccaggccatggaagatttggtgcg ggcctatcatgcgatgtccagcacccatgaagccaacaccatggcgatga tggcccgcgacacggccgaagccgccaaatggggcggctag 14. M. tuberculosis H37Rv|Rv2031c|HspX: 144 aaHEAT SHOCK PROTEIN HSPX (ALPHA-CRYSTALLIN HOMOLOG) (14 kDa ANTIGEN) (HSP16.3)

(157) TABLE-US-00032 (SEQIDNO:17) MATTLPVQRHPRSLFPEFSELFAAFPSFAGLRPTFDTRLMRLEDEMKEGR YEVRAELPGVDPDKDVDIMVRDGQLTIKAERTEQKDFDGRSEFAYGSFVR TVSLPVGADEDDIKATYDKGILTVSVAVSEGKPTEKHIQIRSTN M. tuberculosis H37Rv|Rv2031c|hspX: 435 bpHEAT SHOCK PROTEIN HSPX (ALPHA-CRYSTALLIN HOMOLOG) (14 kDa ANTIGEN) (HSP16.3)

(158) TABLE-US-00033 (SEQIDNO:36) atggccaccacccttcccgttcagcgccacccgcggtccctcttccccga gttttctgagctgttcgcggccttcccgtcattcgccggactccggccca ccttcgacacccggttgatgcggctggaagacgagatgaaagaggggcgc tacgaggtacgcgcggagcttcccggggtcgaccccgacaaggacgtcga cattatggtccgcgatggtcagctgaccatcaaggccgagcgcaccgagc agaaggacttcgacggtcgctcggaattcgcgtacggttccttcgttcgc acggtgtcgctgccggtaggtgctgacgaggacgacattaaggccaccta cgacaagggcattcttactgtgtcggtggcggtttcggaagggaagccaa ccgaaaagcacattcagatccggtccaccaactga 15. M. tuberculosis H37Rv|Rv0467|Ic1: 428 aaISOCITRATE LYASE ICL (ISOCITRASE) (ISOCITRATASE)

(159) TABLE-US-00034 (SEQIDNO:18) MSVVGTPKSAEQIQQEWDTNPRWKDVTRTYSAEDVVALQGSVVEEHTLAR RGAEVLWEQLHDLEWVNALGALTGNMAVQQVRAGLKAIYLSGWQVAGDAN LSGHTYPDQSLYPANSVPQVVRRINNALQRADQIAKIEGDTSVENWLAPI VADGEAGFGGALNVYELQKALIAAGVAGSHWEDQLASEKKCGHLGGKVLI PTQQHIRTLTSARLAADVADVPTVVIARTDAEAATLITSDVDERDQPFIT GERTREGFYRTKNGIEPCIARAKAYAPFADLIWMETGTPDLEAARQFSEA VKAEYPDQMLAYNCSPSFNWKKHLDDATIAKFQKELAAMGFKFQFITLAG FHALNYSMFDLAYGYAQNQMSAYVELQEREFAAEERGYTATKHQREVGAG YFDRIATTVDPNSSTTALTGSTEEGQFH M. tuberculosis H37Rv|Rv0467|icl: 1287 bpISOCITRATE LYASE ICL (ISOCITRASE) (ISOCITRATASE)

(160) TABLE-US-00035 (SEQIDNO:37) atgtctgtcgtcggcaccccgaagagcgcggagcagatccagcaggaatg ggacacgaacccgcgctggaaggacgtcacccgcacctactccgccgagg acgtcgtcgccctccagggcagcgtggtcgaggagcacacgctggcccgc cgcggtgcggaggtgctgtgggagcagctgcacgacctcgagtgggtcaa cgcgctgggcgcgctgaccggcaacatggccgtccagcaggtgcgcgccg gcctgaaggccatctacctgtcgggctggcaggtcgccggcgatgccaac ctgtccgggcacacctaccccgaccagagcctgtatcccgccaactcggt gccgcaggtggtccgccggatcaacaacgcactgcagcgcgccgaccaga tcgccaagatcgagggcgatacttcggtggagaactggctggcgccgatt gtcgccgacggcgaggccggctttggcggcgcgctcaacgtctacgagct gcagaaagccctgatcgccgcgggcgttgcgggttcgcactgggaggacc agttggcctctgagaagaagtgcggccacctgggcggcaaggtgttgatc ccgacccagcagcacatccgcactttgacgtctgctcggctcgcggccga tgtggctgatgttcccacggtggtgatcgcccgtaccgacgccgaggcgg ccacgctgatcacctccgacgtcgacgagcgcgaccagccgttcatcacc ggcgagcgcacccgggaaggcttctaccgcaccaagaacggcatcgagcc ttgcatcgctcgggcgaaggcctacgccccgttcgccgacttgatctgga tggagaccggtaccccggacctcgaggccgcccggcagttctccgaggcg gtcaaggcggagtacccggaccagatgctggcctacaactgctcgccatc gttcaactggaaaaagcacctcgacgacgccaccatcgccaagttccaga aggagctggcagccatgggcttcaagttccagttcatcacgctggccggc ttccatgcgctgaactactcgatgttcgatctggcctacggctacgccca gaaccagatgagcgcgtatgtcgaactgcaggaacgcgagttcgccgccg aagaacggggctacaccgcgaccaagcaccagcgcgaggtcggcgccggc tacttcgaccggattgccaccaccgtggacccgaattcgtcgaccaccgc gttgaccggttccaccgaagagggccagttccactag 16. M. tuberculosis H37Rv|Rv2660c|Rv2660c: 75 aaHYPOTHETICAL PROTEIN

(161) TABLE-US-00036 (SEQIDNO:19) VIAGVDQALAATGQASQRAAGASGGVTVGVGVGTEQRNLSVVAPSQFTFS SRSPDFVDETAGQSWCAILGLNQFH M. tuberculosis H37Rv|Rv2660c|Rv2660c: 228 bpHYPOTHETICAL PROTEIN

(162) TABLE-US-00037 (SEQIDNO:38) gtgatagcgggcgtcgaccaggcgcttgcagcaacaggccaggctagcca gcgggcggcaggcgcatctggtggggtcaccgtcggtgtcggcgtgggca cggaacagaggaacctttcggtggttgcaccgagtcagttcacatttagt tcacgcagcccagattttgtggatgaaaccgcaggtcaatcgtggtgcgc gatactgggattgaaccagtttcactag 17. M. tuberculosis H37Rv|Rv1837c|GlcB: 741 aaPROBABLE MALATE SYNTHASE G GLCB

(163) TABLE-US-00038 (SEQIDNO:20) MTDRVSVGNLRIARVLYDFVNNEALPGTDIDPDSFWAGVDKVVADLTPQN QALLNARDELQAQIDKWHRRRVIEPIDMDAYRQFLTEIGYLLPEPDDFTI TTSGVDAEITTTAGPQLVVPVLNARFALNAANARWGSLYDALYGTDVIPE TDGAEKGPTYNKVRGDKVIAYARKFLDDSVPLSSGSFGDATGFTVQDGQL VVALPDKSTGLANPGQFAGYTGAAESPTSVLLINHGLHIEILIDPESQVG TTDRAGVKDVILESAITTIMDFEDSVAAVDAADKVLGYRNWLGLNKGDLA AAVDKDGTAFLRVLNRDRNYTAPGGGQFTLPGRSLMFVRNVGHLMTNDAI VDTDGSEVFEGIMDALFTGLIAIHGLKASDVNGPLINSRTGSIYIVKPKM HGPAEVAFTCELFSRVEDVLGLPQNTMKIGIMDEERRTTVNLKACIKAAA DRVVFINTGFLDRTGDEIHTSMEAGPMVRKGTMKSQPWILAYEDHNVDAG LAAGFSGRAQVGKGMWTMTELMADMVETKIAQPRAGASTAWVPSPTAATL HALHYHQVDVAAVQQGLAGKRRATIEQLLTIPLAKELAWAPDEIREEVDN NCQSILGYVVRWVDQGVGCSKVPDIHDVALMEDRATLRISSQLLANWLRH GVITSADVRASLERMAPLVDRQNAGDVAYRPMAPNFDDSIAFLAAQELIL SGAQQPNGYTEPILHRRRREFKARAAEKPAPSDRAGDDAAR M. tuberculosis H37Rv|Rv1837c|glcB: 2226 bpPROBABLE MALATE SYNTHASE G GLCB

(164) TABLE-US-00039 (SEQIDNO:39) atgacagatcgcgtgtcggtgggcaacttgcgcatcgctcgggtgctcta cgacttcgtgaacaatgaagccctgcctggcaccgatatcgacccggaca gcttctgggcgggcgtcgacaaggtcgtcgccgacctgaccccgcagaac caagctctgttgaacgcccgcgacgagctgcaggcgcagatcgacaagtg gcaccggcgtcgggtgatcgagcccatcgacatggatgcctaccgccagt tcctcaccgagatcggctacctgcttcccgaacctgatgacttcaccatc accacgtccggtgtcgacgctgagatcaccacgaccgccggcccccagct ggtggtgccggtgctcaacgcgcggtttgctctgaacgcggccaacgctc gctggggctccctctacgacgccttgtatggcaccgatgtcatccccgag accgacggcgccgaaaaaggccccacgtacaacaaggttcgtggcgacaa ggtgatcgcgtatgcccgcaagttcctcgacgacagtgttccgctgtcgt cgggttcctttggcgacgccaccggtttcacagtgcaggatggccagctc gtggttgccttgccggataagtccaccggcctggccaaccccggccagtt cgccggctacaccggcgcagccgagtcgccgacatcggtgctgctaatca atcacggtttgcacatcgagatcctgatcgatccggagtcgcaggtcggc accaccgaccgggccggcgtcaaggacgtgatcctggaatccgcgatcac cacgatcatggacttcgaggactcggtggccgccgtggacgccgccgaca aggtgctgggttatcggaactggctcggcctgaacaagggcgacctggca gcagcggtagacaaggacggcaccgctttcctgcgggtgctcaataggga ccggaactacaccgcacccggcggtggccagttcacgctgcctggacgca gcctcatgttcgtccgcaacgtcggtcaccttgagacgaatgacgccatc gtcgacactgacggcagcgaggtgttcgaaggcatcatggatgccctatt caccggcctgatcgccatccacgggctaaaggccagcgacgtcaacgggc cgctgatcaacagccgcaccggctccatctacatcgtcaagccgaagatg cacggtccggccgaggtggcgtttacctgcgaactgttcagccgggttga agatgtgctggggttgccgcaaaacaccatgaagatcggcatcatggacg aggaacgccggaccacggtcaacctcaaggcgtgcatcaaagctgccgcg gaccgcgtggtgttcatcaacaccgggttcctggaccgcaccggcgatga aatccacacctcgatggaggccggcccgatggtgcgcaagggcaccatga agagccagccgtggatcttggcctacgaggaccacaacgtcgatgccggc ctggccgccgggttcagcggccgagcccaggtcggcaagggcatgtggac aatgaccgagctgatggccgacatggtcgagacaaaaatcgcccagccgc gcgccggggccagcaccgcctgggttccctctcccactgcggccaccctg catgcgctgcactaccaccaggtcgacgtcgccgcggtgcaacaaggact ggcggggaagcgtcgcgccaccatcgaacaattgctgaccattccgctgg ccaaggaattggcctgggctcccgacgagatccgcgaagaggtcgacaac aactgtcaatccatcctcggctacgtggttcgctgggttgatcaaggtgt cggctgctcgaaggtgcccgacatccacgacgtcgcgctcatggaggacc gggccacgctgcgaatctccagccaattgttggccaactggctgcgccac ggtgtgatcaccagcgcggatgtgcgggccagcttggagcggatggcgcc gttggtcgatcgacaaaacgcgggcgacgtggcataccgaccgatggcac ccaacttcgacgacagtatcgccttcctggccgcgcaggagctgatcttg tccggggcccagcagcccaacggctacaccgagccgatcctgcaccgacg tcgtcgggagtttaaggcccgggccgctgagaagccggccccatcggaca gggccggtgacgatgcggcccgctag 18. M. tuberculosis H37Rv|Rv1475c|Acn: 943 aaPROBABLE IRON-REGULATED ACONITATE HYDRATASE ACN (Citrate hydro-lyase) (Aconitase)

(165) TABLE-US-00040 (SEQIDNO:21) VTSKSVNSFGAHDTLKVGEKSYQIYRLDAVPNTAKLPYSLKVLAENLLRN EDGSNITKDHIEAIANWDPKAEPSIEIQYTPARVVMQDFTGVPCIVDLAT MREAIADLGGNPDKVNPLAPADLVIDHSVIADLFGRADAFERNVEIEYQR NGERYQFLRWGQGAFDDFKVVPPGTGIVHQVNIEYLASVVMTRDGVAYPD TCVGTDSHTTMVNGLGVLGWGVGGIEAEAAMLGQPVSMLIPRVVGFRLTG EIQPGVTATDVVLTVTEMLRQHGVVGKFVEFYGEGVAEVPLANRATLGNM SPEFGSTAAIFPIDEETIKYLRFTGRTPEQVALVEAYAKAQGMWHDPKHE PEFSEYLELNLSDVVPSIAGPKRPQDRIALAQAKSTFREQIYHYVGNGSP DSPHDPHSKLDEVVEETFPASDPGQLTFANDDVATDETVHSAAAHADGRV SNPVRVKSDELGEFVLDHGAVVIAAITSCTNTSNPEVMLGAALLARNAVE KGLTSKPWVKTTIAPGSQVVNDYYDRSGLWPYLEKLGFYLVGYGCTTCIG NSGPLPEEISKAVNDNDLSVTAVLSGNRNFEGRINPDVKHNYLASPPLVI AYALAGTMDFDFQTQPLGQDKDGKNVFLRDIWPSQQDVSDTIAAAINQEM FTRNYADVFKGDDRWRNLPTPSGNTFEWDPNSTYVRKPPYFEGMTAKPEP VGNISGARVLALLGDSVTTDHISPAGAIKPGTPAARYLDEHGVDRKDYNS FGSRRGNHEVMIRGTFANIRLRNQLLDDVSGGYTRDFTQPGGPQAFIYDA AQNYAAQHIPLVVFGGKEYGSGSSRDWAAKGTLLLGVRAVIAESFERIHR SNLIGMGVIPLQFPEGKSASSLGLDGTEVFDITGIDVLNDGKTPKTVCVQ ATKGDGATIEFDAVVRIDTPGEADYYRNGGILQYVLRNILKSG M. tuberculosis H37Rv|Rv1475c|acn: 2832 bpPROBABLE IRON-REGULATED ACONITATE HYDRATASE ACN (Citrate hydro-lyase) (Aconitase)

(166) TABLE-US-00041 (SEQIDNO:40) gtgactagcaaatctgtgaactcattcggagcccacgacaccctgaaggtcggcgaaaag agttaccagatctatcgtctcgacgccgtccccaataccgcgaaactcccctacagcctc aaagtgctcgccgagaacctgttgcgcaacgaggacggcagcaacatcaccaaggaccac atcgaggccatcgccaactgggaccctaaggccgagcccagcatcgagatccagtacacg cccgcccgggtggtgatgcaggacttcaccggcgtaccgtgcatcgtcgacttggccacc atgcgcgaggcgatcgccgatctgggcggcaacccggacaaggtcaacccgctggcgccc gcagacttggtgatcgaccactcggtgatcgccgatttgttcggccgcgccgacgcattc gagcgcaacgtcgaaatcgaataccagcgcaacggtgagcgttaccaattcctgcgctgg ggccaaggcgctttcgacgacttcaaagtggtgccgccgggcaccggcatcgtgcaccag gtcaatatcgagtacctggccagcgtggtgatgactcgcgacggagtggcctaccccgac acctgcgtgggcaccgactcacacaccaccatggtcaacggcctgggtgtgctcgggtgg ggtgtcggcggcatcgaggcggaggccgcgatgctgggtcagccggtatcgatgctgatc ccgcgggtcgtgggtttcaggttgaccggcgagatccagccgggagtcaccgccaccgac gtggtgttgaccgtcaccgagatgctgcgccagcacggcgtcgtcggcaaattcgtcgag ttctacggcgagggcgtggccgaggtgccgctggccaaccgcgccaccctgggcaacatg agtcccgaattcggttccaccgcagcgattttcccgatcgacgaagaaaccatcaagtat ctgcggtttaccggtcgcacgccggagcaggtcgcactggtcgaggcctacgccaaggcg cagggcatgtggcacgatcccaagcacgagccggagttctcggaatacctcgaactcaac ctatccgacgtggtgccgtcagtcgccggaccaaagcgtccacaggaccgaatcgcgttg gcgcaagccaaatcaacattccgcgagcagatttaccactatgtcggcaatggttccccg gattccccccacgacccgcactcgaagctggacgaggtagtcgaggagacattcccggcc agcgacccggggcagctgacgttcgccaacgacgacgtcgccactgacgaaaccgtgcac tcggctgccgcgcatgccgatggccgggtgagcaacccagtgcgggtgaagtcggacgga ctcggcgaattcgtgctcgaccacggcgcggtggtgattgccgcgatcacgtcctgcacc aacacctccaaccccgaagtaatgctgggcgcggcgctgctggcccgcaacgccgtcgaa aagggactgacctcgaagccgtgggtgaagaccacgattgccccgggctcgcaagtggtc aacgactactacgacagatccggcctgtggccgtatctggagaagctcggcttctatctg gtcggctacggctgcaccacctgcatcggcaactccgggccgctgcccgaggaaatctca aaagcggttaacgacaacgacctttcggtgaccgcggtactgtccggcaaccggaacttc gagggccgtatcaacccagacgtgaagatgaactacctggcatcgccgccgctggtcatc gcctacgcgctggccgggaccatggacttcgacttccaaacccagccgctcggtcaagac aaagacggtaagaacgtttttctccgcgatatctggccatcgcagcaggatgtctccgac accatcgccgcggcgatcaaccaggagatgttcacccgcaactacgccgacgtgttcaag ggcgacgaccgctggcgcaacctgccaaccccgagcggcaacacctttgagtgggacccg aattcgacctacgtgcgcaagccgccgtatttcgaggggatgacagccaaacccgaaccg gtcggcaacatcagcggtgcccgggtgctggcgctgctcggtgattcggtgaccaccgac cacatctcccccgccggcgccatcaagcccggaactcccgcggcgcgctacctcgacgaa cacggtgtcgaccgcaaggactacaactccttcggttctcgccgcggcaaccacgaggtg atgattcgtggcaccttcgccaacatccggctgcgtaaccaactgctagacgacgtgtcc ggcggttatacccgcgacttcacccagccgggcggtccgcaggcgttcatctacgacgcc gcgcagaactatgcggcgcaacacattccgctggttgtgttcggcggcaaagagtacggg tcgggttcgtcacgggactgggcggccaaaggcacattgctactgggcgtgcgggcggtg atcgccgagtcattcgagcggatccaccggtccaacctgatcggcatgggcgtgatcccg ctgcagttccccgaaggaaagtcagcgtcgtcgttgggactcgacggtaccgaggtcttc gacatcaccggtatcgacgtgcttaacgacggcaagacacccaagacggtgtgcgtccag gccaccaagggcgacggcgccacgatcgagttcgacgccgtggtgcgcatcgacaccccc ggtgaggcggactactaccgcaacggcggcatcctgcagtacgtgctgcgcaacatactg aagtcaggctga 19. M. tuberculosis H37Rv|Rv3875|EsxA: 95 aa6 KDA EARLY SECRETORY ANTIGENIC TARGET ESXA (ESAT-6)

(167) TABLE-US-00042 (SEQIDNO:22) MTEQQWNFAGIEAAASAIQGNVTSIHSLLDEGKQSLTKLAAAWGGSGSEA YQGVQQKWDATATELNNALQNLARTISEAGQAMASTEGNVTGMFA M. tuberculosis H37Rv|Rv3875|esxA: 288 bp6 KDA EARLY SECRETORY ANTIGENIC TARGET ESXA (ESAT-6)

(168) TABLE-US-00043 (SEQIDNO:41) atgacagagcagcagtggaatttcgcgggtatcgaggccgcggcaagcgc aatccagggaaatgtcacgtccattcattccctccttgacgaggggaagc agtccctgaccaagctcgcagcggcctggggcggtagcggttcggaggcg taccagggtgtccagcaaaaatgggacgccacggctaccgagctgaacaa cgcgctgcagaacctggcgcggacgatcagcgaagccggtcaggcaatgg cttcgaccgaaggcaacgtcactgggatgttcgcatag

Polynucleotide and Polypeptide Sequences from: Listeria monocytogenes (EGD Strain)

(169) ActA

(170) TABLE-US-00044 actin-assemblyinducingproteinprecursor (ListeriamonocytogenesEGD-e) (SEQIDNO:1) MGLNRFMRAMMVVFITANCITINPDIIFAATDSEDSSLNTDEWEEEKTEE QPSEVNTGPRYETAREVSSRDIKELEKSNKVRNTNKADLIAMLKEKAEKG PNINNNNSEQTENAAINEEASGADRPAIQVERRHPGLPSDSAAEIKKRRK AIASSDSELESLTYPDKPTKVNKKKVAKESVADASESDLDSSMQSADESS PQPLKANQQPFFPKVFKKIKDAGKWVRDKIDENPEVKKAIVDKSAGLIDQ LLTKKKSEEVNASDFPPPPTDEELRLALPETPMLLGFNAPATSEPSSFEF PPPPTDEELRLALPETPMLLGFNAPATSEPSSFEFPPPPTEDELEIIRET ASSLDSSFTRGDLASLRNAINRHSQNFSDFPPIPTEEELNGRGGRPTSEE FSSLNSGDFTDDENSETTEEEIDRLADLRDRGTGKHSRNAGFLPLNPFAS SPVPSLSPKVSKISAPALISDITKKTPFKNPSQPLNVFNKKTTTKTVTKK PTPVKTAPKLAELPATKPQETVLRENKTPFIEKQAETNKQSINMPSLPVI QKEATESDKEEMKPQTEEKMVEESESANNANGKNRSAGIEEGKLIAKSAE DEKAKEEPGNHTTLILAMLAIGVFSLGAFIKIIQLRKNN gene= actA (ListeriamonocytogenesEGD-e) (SEQIDNO:42) GTGGGATTAAACAGATTTATGCGTGCGATGATGGTGGTTTTCATTACTGC CAATTGCATTACGATTAACCCCGACATAATATTTGCAGCGACAGATAGCG AAGATTCTAGTCTAAACACAGATGAATGGGAAGAAGAAAAAACAGAAGAG CAACCAAGCGAGGTAAATACGGGACCAAGATACGAAACTGCACGTGAAGT AAGTTCACGTGATATTAAAGAACTAGAAAAATCGAATAAAGTGAGAAATA CGAACAAAGCAGACCTAATAGCAATGTTGAAAGAAAAAGCAGAAAAAGGT CCAAATATCAATAATAACAACAGTGAACAAACTGAGAATGCGGCTATAAA TGAAGAGGCTTCAGGAGCCGACCGACCAGCTATACAAGTGGAGCGTCGTC ATCCAGGATTGCCATCGGATAGCGCAGCGGAAATTAAAAAAAGAAGGAAA GCCATAGCATCATCGGATAGTGAGCTTGAAAGCCTTACTTATCCGGATAA ACCAACAAAAGTAAATAAGAAAAAAGTGGCGAAAGAGTCAGTTGCGGATG CTTCTGAAAGTGACTTAGATTCTAGCATGCAGTCAGCAGATGAGTCTTCA CCACAACCTTTAAAAGCAAACCAACAACCATTTTTCCCTAAAGTATTTAA AAAAATAAAAGATGCGGGGAAATGGGTACGTGATAAAATCGACGAAAATC CTGAAGTAAAGAAAGCGATTGTTGATAAAAGTGCAGGGTTAATTGACCAA TTATTAACCAAAAAGAAAAGTGAAGAGGTAAATGCTTCGGACTTCCCGCC ACCACCTACGGATGAAGAGTTAAGACTTGCTTTGCCAGAGACACCAATGC TTCTTGGTTTTAATGCTCCTGCTACATCAGAACCGAGCTCATTCGAATTT CCACCACCACCTACGGATGAAGAGTTAAGACTTGCTTTGCCAGAGACGCC AATGCTTCTTGGTTTTAATGCTCCTGCTACATCGGAACCGAGCTCGTTCG AATTTCCACCGCCTCCAACAGAAGATGAACTAGAAATCATCCGGGAAACA GCATCCTCGCTAGATTCTAGTTTTACAAGAGGGGATTTAGCTAGTTTGAG AAATGCTATTAATCGCCATAGTCAAAATTTCTCTGATTTCCCACCAATCC CAACAGAAGAAGAGTTGAACGGGAGAGGCGGTAGACCAACATCTGAAGAA TTTAGTTCGCTGAATAGTGGTGATTTTACAGATGACGAAAACAGCGAGAC AACAGAAGAAGAAATTGATCGCCTAGCTGATTTAAGAGATAGAGGAACAG GAAAACACTCAAGAAATGCGGGTTTTTTACCATTAAATCCGTTTGCTAGC AGCCCGGTTCCTTCGTTAAGTCCAAAGGTATCGAAAATAAGCGCACCGGC TCTGATAAGTGACATAACTAAAAAAACGCCATTTAAGAATCCATCACAGC CATTAAATGTGTTTAATAAAAAAACTACAACGAAAACAGTGACTAAAAAA CCAACCCCTGTAAAGACCGCACCAAAGCTAGCAGAACTTCCTGCCACAAA ACCACAAGAAACCGTACTTAGGGAAAATAAAACACCCTTTATAGAAAAAC AAGCAGAAACAAACAAGCAGTCAATTAATATGCCGAGCCTACCAGTAATC CAAAAAGAAGCTACAGAGAGCGATAAAGAGGAAATGAAACCACAAACCGA GGAAAAAATGGTAGAGGAAAGCGAATCAGCTAATAACGCAAACGGAAAAA ATCGTTCTGCTGGCATTGAAGAAGGAAAACTAATTGCTAAAAGTGCAGAA GACGAAAAAGCGAAGGAAGAACCAGGGAACCATACGACGTTAATTCTTGC AATGTTAGCTATTGGCGTGTTCTCTTTAGGGGCGTTTATCAAAATTATTC AATTAAGAAAAAATAATTAA
LLO

(171) TABLE-US-00045 listeriolysinOprecursor(Listeriamonocytogenes EGD-e) (SEQIDNO:43) MKKIMLVFITLILVSLPIAQQTEAKDASAFNKENSISSMAPPASPPASPK TPIEKKHADEIDKYIQGLDYNKNNVLVYHGDAVTNVPPRKGYKDGNEYIV VEKKKKSINQNNADIQVVNAISSLTYPGALVKANSELVENQPDVLPVKRD SLTLSIDLPGMTNQDNKIVVKNATKSNVNNAVNTLVERWNEKYAQAYPNV SAKIDYDDEMAYSESQLIAKFGTAFKAVNNSLNVNFGAISEGKMQEEVIS FKQIYYNVNVNEPTRPSRFFGKAVTKEQLQALGVNAENPPAYISSVAYGR QVYLKLSTNSHSTKVKAAFDAAVSGKSVSGDVELTNIIKNSSFKAVIYGG SAKDEVQIIDGNLGDLRDILKKGATFNRETPGVPIAYTTNFLKDNELAVI KNNSEYIETTSKAYTDGKINIDHSGGYVAQFNISWDEVNYDPEGNEIVQH KNWSENNKSKLAHFTSSIYLPGNARNINVYAKECTGLAWEWWRTVIDDRN LPLVKNRNISIWGTTLYPKYSNKVDNPIE gene= hly (ListeriamonocytogenesEGD-e) (SEQIDNO:44) ATGAAAAAAATAATGCTAGTTTTTATTACACTTATATTAGTTAGTCTACC AATTGCGCAACAAACTGAAGCAAAGGATGCATCTGCATTCAATAAAGAAA ATTCAATTTCATCCATGGCACCACCAGCATCTCCGCCTGCAAGTCCTAAG ACGCCAATCGAAAAGAAACACGCGGATGAAATCGATAAGTATATACAAGG ATTGGATTACAATAAAAACAATGTATTAGTATACCACGGAGATGCAGTGA CAAATGTGCCGCCAAGAAAAGGTTACAAAGATGGAAATGAATATATTGTT GTGGAGAAAAAGAAGAAATCCATCAATCAAAATAATGCAGACATTCAAGT TGTGAATGCAATTTCGAGCCTAACCTATCCAGGTGCTCTCGTAAAAGCGA ATTCGGAATTAGTAGAAAATCAACCAGATGTTCTCCCTGTAAAACGTGAT TCATTAACACTCAGCATTGATTTGCCAGGTATGACTAATCAAGACAATAA AATCGTTGTAAAAAATGCCACTAAATCAAACGTTAACAACGCAGTAAATA CATTAGTGGAAAGATGGAATGAAAAATATGCTCAAGCTTATCCAAATGTA AGTGCAAAAATTGATTATGATGACGAAATGGCTTACAGTGAATCACAATT AATTGCGAAATTTGGTACAGCATTTAAAGCTGTAAATAATAGCTTGAATG TAAACTTCGGCGCAATCAGTGAAGGGAAAATGCAAGAAGAAGTCATTAGT TTTAAACAAATTTACTATAACGTGAATGTTAATGAACCTACAAGACCTTC CAGATTTTTCGGCAAAGCTGTTACTAAAGAGCAGTTGCAAGCGCTTGGAG TGAATGCAGAAAATCCTCCTGCATATATCTCAAGTGTGGCGTATGGCCGT CAAGTTTATTTGAAATTATCAACTAATTCCCATAGTACTAAAGTAAAAGC TGCTTTTGATGCTGCCGTAAGCGGAAAATCTGTCTCAGGTGATGTAGAAC TAACAAATATCATCAAAAATTCTTCCTTCAAAGCCGTAATTTACGGAGGT TCCGCAAAAGATGAAGTTCAAATCATCGACGGCAACCTCGGAGACTTACG CGATATTTTGAAAAAAGGCGCTACTTTTAATCGAGAAACACCAGGAGTTC CCATTGCTTATACAACAAACTTCCTAAAAGACAATGAATTAGCTGTTATT AAAAACAACTCAGAATATATTGAAACAACTTCAAAAGCTTATACAGATGG AAAAATTAACATCGATCACTCTGGAGGATACGTTGCTCAATTCAACATTT CTTGGGATGAAGTAAATTATGATCCTGAAGGTAACGAAATTGTTCAACAT AAAAACTGGAGCGAAAACAATAAAAGCAAGCTAGCTCATTTCACATCGTC CATCTATTTGCCAGGTAACGCGAGAAATATTAATGTTTACGCTAAAGAAT GCACTGGTTTAGCTTGGGAATGGTGGAGAACGGTAATTGATGACCGGAAC TTACCACTTGTGAAAAATAGAAATATCTCCATCTGGGGCACCACGCTTTA TCCGAAATATAGTAATAAAGTAGATAATCCAATCGAATAA
Internalin B

(172) TABLE-US-00046 internalinB(ListeriamonocytogenesEGD-e) (SEQIDNO:2) MKEKHNPRRKYCLISGLAIIFSLWIIIGNGAKVQAETITVPTPIKQIFSD DAFAETIKDNLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNV TKLFLNGNKLTDIKPLANLKNLGWLFLDENKVKDLSSLKDLKKLKSLSLE HNGISDINGLVHLPQLESLYLGNNKITDITVLSRLTKLDTLSLEDNQISD IVPLAGLTKLQNLYLSKNHISDLRALAGLKNLDVLELFSQECLNKPINHQ SNLVVPNTVKNTDGSLVTPEIISDDGDYEKPNVKWHLPEFTNEVSFIFYQ PVTIGKAKARFHGRVTQPLKEVYTVSYDVDGTVIKTKVEAGTRITAPKPP TKQGYVFKGWYTEKNGGHEWNFNTDYMSGNDFTLYAVFKAETTEKAVNLT RYVKYIRGNAGIYKLPREDNSLKQGTLASHRCKALTVDREARNGGKLWYR LKNIGWTKAENLSLDRYDKMEYDKGVTAYARVRNASGNSVWTKPYNTAGA KHVNKLSVYQGKNMRILREAKTPITTWYQFSIGGKVIGWVDTRALNTFYK QSMEKPTRLTRYVSANKAGESYYKVPVADNPVKRGTLAKYKNQKLIVDCQ ATIEGQLWYRIRTSSTFIGWTKAANLRAQK gene= inlB (ListeriamonocytogenesEGD-e) (SEQIDNO:45) GTGAAAGAAAAGCACAACCCAAGAAGGAAGTATTGTTTAATCTCAGGTTT AGCTATTATTTTTAGTTTATGGATAATTATTGGAAACGGGGCGAAAGTAC AAGCGGAGACTATCACCGTGCCAACGCCAATCAAGCAAATTTTTTCAGAT GATGCTTTTGCAGAAACAATCAAAGACAATTTAAAGAAAAAAAGTGTGAC AGATGCAGTGACACAAAATGAATTAAATAGTATAGATCAAATCATTGCGA ATAATAGTGATATTAAATCCGTTCAAGGAATTCAGTATTTACCCAATGTG ACAAAGTTATTTTTAAACGGGAATAAACTAACAGATATAAAGCCCTTAGC AAACTTGAAAAATTTAGGATGGCTTTTTTTAGACGAAAATAAAGTTAAGG ACCTAAGTTCGCTCAAGGATTTAAAAAAATTAAAATCACTTTCTTTGGAG CATAATGGTATAAGTGATATAAACGGACTTGTTCATTTACCACAGCTGGA AAGTTTGTATTTGGGAAATAATAAAATAACGGATATAACGGTTCTTTCAC GTTTAACTAAACTGGATACTTTGTCTCTCGAAGATAACCAAATTAGTGAT ATTGTGCCACTTGCAGGTTTAACTAAATTGCAGAACCTATATTTAAGTAA AAATCACATAAGCGATTTAAGAGCATTAGCAGGACTTAAAAATCTAGATG TTTTAGAATTATTTAGCCAAGAATGTCTTAATAAGCCTATTAATCATCAA TCTAATTTGGTTGTTCCGAATACAGTGAAAAACACTGATGGGTCGTTAGT GACTCCAGAAATAATAAGTGATGATGGCGATTATGAAAAACCTAATGTTA AATGGCATTTACCAGAATTTACAAATGAAGTGAGTTTTATTTTCTATCAG CCAGTCACTATTGGAAAAGCAAAAGCAAGATTTCATGGGAGAGTAACCCA ACCACTGAAAGAGGTTTACACAGTAAGTTATGATGTTGATGGAACGGTAA TAAAAACAAAAGTAGAAGCAGGGACGCGGATAACTGCACCTAAACCTCCG ACTAAACAAGGCTATGTTTTTAAAGGATGGTATACTGAAAAAAATGGTGG GCATGAGTGGAATTTTAATACGGATTATATGTCCGGAAATGATTTTACTT TGTACGCAGTATTTAAAGCGGAAACGACCGAAAAAGCAGTCAACTTAACC CGCTATGTCAAATATATTCGCGGGAATGCAGGCATCTACAAACTTCCACG AGAAGATAACTCGCTTAAACAAGGAACTCTAGCCTCGCACCGCTGTAAAG CTCTAACTGTTGATAGAGAAGCCCGAAATGGCGGAAAATTATGGTACAGG TTAAAAAATATTGGCTGGACTAAAGCGGAAAACCTTTCCTTAGACCGATA CGATAAAATGGAATATGACAAAGGGGTTACCGCTTATGCAAGAGTGAGAA ATGCGTCTGGAAATTCGGTTTGGACAAAACCCTACAACACAGCCGGCGCT AAACACGTGAATAAGCTATCGGTCTACCAAGGTAAAAATATGCGTATCTT GCGCGAAGCCAAAACACCAATTACTACATGGTATCAATTTAGCATTGGTG GTAAAGTAATTGGTTGGGTCGATACCCGAGCACTTAACACATTCTACAAA CAAAGCATGGAAAAGCCAACCCGTTTAACTCGTTATGTCAGCGCCAATAA AGCTGGCGAATCGTACTATAAAGTCCCGGTAGCAGATAATCCAGTCAAAA GGGGTACTTTAGCCAAGTATAAAAATCAAAAGTTAATTGTTGATTGTCAA GCAACCATCGAAGGTCAACTTTGGTACCGAATAAGGACTAGTTCCACTTT CATTGGTTGGACGAAAGCAGCTAATTTAAGGGCACAGAAATAA
PrfA

(173) TABLE-US-00047 listeriolysinpositiveregulatoryprotein (ListeriamonocytogenesEGD-e) (SEQIDNO:3) MNAQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTS ISENGTIMNLQYYKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKIN ELKELLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSINGKLGSICGQLLIL TYVYGKETPDGIKITLDNLTMQELGYSSGIAHSSAVSRIISKLKQEKVIV YKNSCFYVQNLDYLKRYAPKLDEWFYLACPATWGKLN gene= prfA complement(1...714)prfA (ListeriamonocytogenesEGD-e) (SEQIDNO:46) TTAATTTAATTTTCCCCAAGTAGCAGGACATGCTAAATAAAACCATTCAT CTAATTTAGGGGCATATCTTTTGAGATAATCAAGATTTTGTACATAAAAG CATGAATTTTTATACACGATAACTTTCTCTTGCTTTAATTTGGAAATAAT TCTGCTAACAGCTGAGCTATGTGCGATGCCACTTGAATATCCTAACTCCT GCATTGTTAAATTATCCAGTGTAATCTTGATGCCATCAGGAGTTTCTTTA CCATACACATAGGTCAGGATTAAAAGTTGACCGCAAATAGAGCCAAGCTT CCCGTTAATCGAAAAATCATTAAATTTAGCTAGACTGTATGAAACTTGTT TTTGTAGGGTTTGGAAAACATAGAAAAAGTGCGTAAGATTTTTGCTCAGT AGTTCTTTTAGTTCGTTTATTTTGATAACGTATGCGGTAGCCTGCTCGCT AATGACTTCTAAATTATAATAGCCAACCGATGTTTCTGTATCAATAAAGC CAGACATTATAACGAAAGCCCCTTTGTAGTATTGTAAATTCATGATGGTC CCGTTCTCGCTAATACTCGTGAGCTTTGTGATACCATCATATAGAAAAAT ACAATATTCTTGTGGATCCCATTGGTTAAAAATAAGTTCTTTTTTATGAA ATTGTTTTGGTTTTATCCCGTTAGTTTCTAAATATTTTTTGAATTCTTCT GCTTGAGCGTTCAT