IN VITRO PRODUCTION OF CYCLIC PEPTIDES

20180179570 ยท 2018-06-28

    Inventors

    Cpc classification

    International classification

    Abstract

    This invention relates to the in vitro production of cyclic peptides using cyanobacterial enzymes, such as patellamide biosynthesis enzymes. Linear peptide substrates are cyclized using an isolated cyanbacterial macrocyclase, such as PatG from Prochloron spp. Before cyclisation, residues in the linear peptide substrates may be heterocyclised using isolated cyanbacterial heterocyclasses, such as PatD or TruD heterocyclase. Methods of the invention may be useful, for example, for the production of cyclic peptidyl molecules, including cyclotides, such as katalas, and cyanobactins, such as patellamides and telomestatins, for example for use in the development of therapeutics.

    Claims

    1. A method of producing a cyclic peptide comprising; (i) providing a linear peptide substrate consisting of a target peptide having 6 to 11 residues and a C terminal cyclisation signal consisting of AYD, AYE, SYD, AFD, FAG or AYR and, (ii) treating said peptide substrate with an isolated cyanobacterial macrocyclase to produce a cyclic peptide.

    2-3. (canceled)

    4. A method according to claim 1 wherein the residue in the target peptide adjacent the cyclisation signal is proline, pseudoproline, a thiazoline, thiazole, oxazoline or oxazole amino acid, or an N-Me residue.

    5. (canceled)

    6. A method according to claim 1 wherein the cyanobacterial macrocyclase comprises an amino acid sequence having at least 60% sequence identity to the amino sequence of residues 492-851 of PatG (SEQ ID NO:1) or an amino sequence selected from the group consisting of SEQ ID NOs: 7 to 19.

    7-8. (canceled)

    9. A method according to claim 1 wherein the cyanobacterial macrocyclase comprises a substitution at one or more residue equivalent to R589, K594, K598 and H746 of PatG (SEQ ID NO:1), and the linear peptide substrate comprises a modified cyclisation signal.

    10. A method according to claim 1 wherein the Cyanobacterial macrocyclase comprises a K598D substitution at the residue equivalent to K598 of PatG and the linear peptide substrate comprises the cyclisation signal AYR.

    11. (canceled)

    12. A method according to claim 1 wherein the linear peptide substrate is treated with the cyanobacterial macrocyclase in 500 mM NaCl and/or pH 9.

    13. A method according to claim 1 wherein the linear peptide substrate is provided by a method comprising; (i) providing a pro-peptide comprising the peptide substrate linked to a pro-sequence by a protease recognition site; and, (ii) treating said pro-peptide with an isolated protease to produce the linear peptide substrate.

    14-16. (canceled)

    17. A method according to claim 13 wherein the protease recognition site is a heterologous protease recognition site and the protease is a heterologous protease.

    18. A method according to claim 17 wherein the heterologous protease recognition site is a K residue and the heterologous protease is trypsin; the heterologous protease site is Y and the protease is chymotrypsin; or the heterologous protease site is ENLYFQ(G/S) (SEQ ID NO: 57) and the protease is Tobacco Etch Virus (TEV) protease.

    19. (canceled)

    20. A method according to claim 1 wherein the linear peptide substrate or the pro-peptide is provided by a method comprising; (iii) providing a pre-pro-peptide comprising one or more heterocyclisable amino acids; (iv) treating said pre-pro-peptide with a PatD or TruD heterocyclase to convert the heterocyclisable amino acids into heterocyclic residues, thereby producing the linear peptide substrate or the pro-peptide.

    21-27. (canceled)

    28. A method according to claim 20 wherein the PatD heterocyclase comprises an amino acid sequence having at least 60% sequence identity to PatD (SEQ ID NO:3) or TruD (SEQ ID NO:4).

    29. (canceled)

    30. A method according to claim 20 wherein the method comprises treating the linear peptide substrate, pro-peptide or cyclic peptide to oxidise the heterocyclic residues.

    31-38. (canceled)

    39. A method according to claim 1 wherein the cyclic peptide is treated with a cyanobacterial prenylase to produce a prenylated or geranylated cyclic peptide.

    40. (canceled)

    41. A method according to claim 1 wherein the cyclic peptide is labelled with a detectable label.

    42. A method according to claim 1 wherein the linear peptide substrate is immobilised on a bead.

    43. A method according to claim 42 wherein a reference copy of said linear peptide substrate is additionally immobilised to said bead, said reference copy lacking a cyclisation signal.

    44. A method according to claim 43 wherein the cyclic peptide is released from the bead following said treatment with the cyanobacterial macrocyclase and the reference copy remains immobilised to the bead.

    45. A method according to claim 44 comprising isolating and screening said cyclic peptide to identify a biological activity.

    46. A method according to claim 45 comprising identify the bead which released the cyclic peptide and sequencing the reference copy immobilised on said bead.

    47-50. (canceled)

    51. A method of producing a cyclic peptide comprising; (i) providing a linear peptide substrate; and, (ii) treating said peptide substrate with an isolated cyanobacterial macrocyclase to produce a cyclic peptide, wherein the linear peptide substrate is provided by a method comprising; (i) providing a pro-peptide comprising the peptide substrate linked to a pro-sequence by a heterologous protease recognition site; and, (ii) treating said pro-peptide with an isolated heterologous protease to produce the linear peptide substrate, wherein the heterologous protease recognition site is a K residue and the heterologous protease is trypsin; the heterologous protease site is Y and the protease is chymotrypsin; or the heterologous protease site is ENLYFQ(G/S) (SEQ ID NO: 57) and the protease is Tobacco Etch Virus (TEV) protease.

    Description

    [0189] Certain aspects and embodiments of the invention will now be illustrated by way of example and with reference to the figures and tables described herein.

    [0190] FIG. 1 shows the relative reaction rates of PatGmac and VGAGIGFPAYDG (SEQ ID NO: 68) in different buffers and temperatures as determined by LC-MS.

    [0191] FIG. 2 shows ion counts of VGAGIGFPAYRG (SEQ ID NO: 69) processed by PatGmac wild-type and PatGmac K598D for linear and macrocyclized products as determined by LC-MS.

    [0192] FIG. 3 shows LC-MS of the macrocyclization of the peptide substrate VGAGIGFPAYRG (SEQ ID NO: 69).

    [0193] FIGS. 4A-4C show patellamide macrocylization. FIG. 4A shows a PatE pre-pro-peptide consisting of an N-terminal leader sequence followed by two eight-residue cassettes with the C-terminal macrocyclase recognition signal AYDG (SEQ ID NO: 20). The macrocyclization domain of PatG catalyzes the formation of two cyclic peptides per pre-pro-peptide (dashed lines). FIG. 4B shows that PatGmac requires a heterocycle or proline (denoted Z) at the P1 position and the AYDG (SEQ ID NO: 20) motif at the P1 to P4 sites respectively. An additional E is often found at P5 but is not required. FIG. 4C shows that the test substrate used in this study can either give a linear peptide of mass 716.375 Da (curved line) or macrocycle, which has a mass 18 Da lighter (octagon).

    [0194] FIG. 5 shows an LC-MS of macrocyclization reactions with PatGmac wild-typeMacrocyclized and linear products are indicated with octagons and curved lines, respectively. The error between observed and calculated mass is shown below the [M+H].sup.+ and [M+Na].sup.+ species.

    [0195] FIG. 6 shows an LC-MS of macrocyclization reactions with PatGmac2m as per FIG. 5.

    [0196] FIG. 7 shows an LC-MS of macrocyclization reactions with PatGmac K594D, as per FIG. 5.

    [0197] FIG. 8 shows LC-MS of a macrocyclization reaction with PatGmac that shiows the existence of a stable acyl-enzyme intermediate (AEI) between PatGmac and substrate.

    [0198] FIG. 9 shows the fragmentation pattern of cyclo [VGAGIGFP] (SEQ ID NO: 70) determined during an MS analysis of macrocyclization reactions.

    [0199] FIGS. 10A, 10B, and 10C show LC-MS of macrocyclization reactions with PatGmac1, PatGmac K598D and PatGmac triple mutant R589D K594D K598D, respectively. Only linear product is observed (curved lines). The error between observed and calculated mass is shown below the [M+H].sup.+ species.

    [0200] FIGS. 11A and 11B show an engineered PatE pre-pro-peptide (PatE2) (SEQ ID NO: 71 and SEQ ID NO: 72).

    [0201] FIG. 12 shows data relating to the in vitro heterocyclization of PatE2. Note that for PatD reaction, species with only three heterocycles might have unique properties and can be separated from the species with four heterocycles by HPLC.

    [0202] FIGS. 13A and 13B show water loss following incubation of PatE2 with TruD. FIG. 13A shows PatE with engineered lysine residue before heterocyclisation and FIG. 13B shows PatE2 after heterocyclisation.

    [0203] FIG. 14 shows a S200 gel filtration trace produced after completion of the heterocyclisation reaction.

    [0204] FIG. 15 shows LC-MS of PatE2 following N-terminal cleavage with Trypsin and heterocyclisation with TruD.

    [0205] FIG. 16 shows LCT-ESI MS data of Patellamide (cyclo(I(MxOxn)A(Thn)I(MeOxn)F(Thn)) (SEQ ID NO: 73) produced from peptide substrate ITACITFC(SEQ ID NO: 21). The data confirms the final product has 4 heterocycles and is macrocyclised (expected mass 781 Da). The 776 Da species is the oxidized product.

    [0206] FIG. 17 shows the proposed mechanism for macrocyclization. Model of the acyl-enzyme intermediate with AYDG remaining bound at the active site.

    [0207] The acyl-enzyme intermediate is in equilibrium with the substrate. In PatGmac the amino terminus of the substrate enters the active site, displacing AYDG and leading to macrocyclization. Mutations that disrupt binding of AYDG lead to linear product, as it is hydrolyzed by water. The role of the His in deprotonating the incoming amino terminus is speculative.

    [0208] FIG. 18 shows two in vitro systems incorporating PatG macrocyclisation. Tag all enzymes and thus simply remove them at the end of each step. Load the PatA cleaved peptide onto a bead by using C-terminally tagged PatE, and add PatGmac as a soluble enzyme. Both approaches have advantages and disadvantages. The first approach allows valuable enzymes to be recovered and used in excess, but requires purification of the product. The second approach simplifies purification as only the macrocycle and PatG are in solution at the end and further, chemical modification of substrate on a bead will be much easier. The disadvantages are recovery of the macrocyclase enzyme may be impossible in a cost efficient manner and the introduction of a bind step mid process (which would need monitoring).

    [0209] FIG. 19 shows possible MS fragmentation pathways for the cassette ITFCITAC(SEQ ID NO: 74) in the PatE peptide treated with the heterocyclase TruD and macrocyclase PatG to produce cyclo-(ITF(Thn)ITA(Thn)) (SEQ ID NO: 75). The accurate masses of the molecular ion and fragments are consistent with the proposed structure and the MS data shown in Table 3.

    [0210] FIG. 20 shows .sup.1H NMR of the purified product (cyclo-I(MxOxn)V(Thn)I(MeOxn)V(Thn)) (SEQ ID NO: 76) produced when the cassette ITVCITVC(SEQ ID NO: 30) in the PatE peptide is treated with the heterocyclase PatD and macrocyclase PatG. Structure was confirmed by comparison of the .sup.1H NMR to that of the naturally obtained material and by analysis of 2D NMR spectra (Table 8).

    [0211] FIG. 21 also shows .sup.1H NMR of the purified product (cyclo-(ITA(Thn)ITF(Thn))) (SEQ ID NO: 77) produced when the cassette ITACITFC (SEQ ID NO: 21) in the PatE peptide is treated with the heterocyclase TruD and macrocyclase PatG. The structure was verified by analysis of 2D NMR data (Table 7).

    [0212] FIG. 22 shows the biosynthetic pathway of patellamides A (1) and C (2). The 71 amino acid structural gene product (PatE pre-propeptide) (SEQ ID NO: 78) is ribosomally synthesised. The tailoring enzymes recognise the N-terminal leader sequence of the PatE pre-propeptide (PatE.sub.1-34, italic) as well as start/stop cyclisation signals. Four cysteine, three threonine and one serine residues (bold) in the downstream sequence (PatE.sub.42-71) are post-translationally modified to thiazole and oxazoline heterocycles. Cleavage and macrocyclisation lead to the formation of patellamides A (1) and C (2).

    [0213] FIG. 23 shows LC-MS of macrocyclized product (cyclo-(ITV(Thn)ITV(Thn)) (SEQ ID NO: 79) produced when the cassette ITVCITVC(SEQ ID NO: 30) in the PatE peptide is treated with the heterocyclase TruD, trypsin and macrocyclase PatGmac.

    [0214] FIG. 24 shows LC-MS of macrocyclized product (cyclo-(ITA(Thn)ITF(Thn)) (SEQ ID NO: 77) produced when the cassette ITACITFC(SEQ ID NO: 21) in the PatE peptide is treated with the heterocyclase TruD, trypsin and macrocyclase PatGmac.

    [0215] FIG. 25 shows oxidation of cyclo-I(MxOxn)V(Thn)I(MeOxn)V(Thn) (SEQ ID NO: 76).

    [0216] FIG. 26 shows far UV CD spectra of cyclo-I(MxOxn)V(Thn)I(MeOxn)V(Thn) (SEQ ID NO: 76) (reduced) and cyclo-I(Mx0xz)V(Thz)I(MeOxz)V(Thz) (SEQ ID NO: 80) (oxidised) produced from the peptide substrate ITVCITVC(SEQ ID NO: 30), and ascidiacyclamide isolated from Lissoclinum patella and 100% MeOH. The spectrum of cyclo-I(MxOxz)V(Thz)I(MeOxz)V(Thz) (SEQ ID NO: 80) is shown to correspond to the spectrum of ascidiacyclamide.

    [0217] FIG. 27 shows the reduction of cyclic peptide dimer (21) to its monomeric form (6) (SEQ ID NO: 81).

    [0218] FIG. 28 shows MALDI MS data for the heterocylisation of 2,3-diaminopropanoic acid in the peptide ITASITFXAYDG(SEQ ID NO: 82) (where X is 2,3-diaminopropanoic acid) using TruD or PatD.

    [0219] Table 1 shows data collection and refinement statistics (molecular replacement) for PatGmac.

    [0220] Table 2 shows the relative ion counts of linear cleaved and macrocyclized peptide substrate.

    [0221] Table 3 shows MS data from the cassette ITFCITAC(SEQ ID NO: 74) in the PatE peptide treated with the heterocyclase TruD and macrocyclase PatG. The accurate masses of the molecular ion and fragments shown in this table are consistent with the proposed structure (see FIGS. 19 and 20) and can be explained as outlined on fragmentation pathwayshown in FIG. 18.

    [0222] Table 4 shows a sequence alignment of PatGmac with its homologs(SEQ ID NOs: 7-19). Secondary structure elements are shown in red. Active site residues are indicated by yellow stars, cysteines involved in disulfide bonding as green triangles (matching directions represent disulfide pairs), residues blocking the S3 and S4 sites as blue diamonds, lysines forming salt-bridges with the substrate as purple circles and His and Phe residues involved in substrate binding are marked by a magenta box.

    [0223] Table 5 shows cyanobacterial proteases on public databases.

    [0224] Table 6 shows cyanobacterial heterocyclases on public databases.

    [0225] Table 7 shows .sup.1H/.sup.13C NMR data in CDCl.sub.3 at 600/150 MHz for cyclo-I (MxOxn)V(Thn) I (MeOxn)V(Thn) (SEQ ID NO: 76) obtained from in vitro biosynthesis.

    [0226] Table 8 shows .sup.1H/.sup.13C NMR data in CDCl.sub.3 at 600/150 MHz for cyclo-ITA(Thn)ITF(Thn) (SEQ ID NO: 77) from Lissoclinum patella and obtained from in vitro biosynthesis using the peptide substrate ITACITFC(SEQ ID NO: 21).

    [0227] Experiments

    [0228] Materials and Methods 1. Protein Cloning, Expression and Purification

    [0229] 1.1 Heterocyclases

    [0230] Codon-optimized full length PatD and TruD were cloned into the pJexpress 411 plasmid (DNA2.0 Inc., USA) with an N-terminal His.sub.6-tag, with TruD containing an additional Tobacco Etch Virus (TEV) protease cleavage site. Both enzymes are expressed in Escherichia coli BL21 (DE3) cells grown on auto-induction medium (Terrific broth base containing trace elements) for 48 h at 20 C. Cells are harvested by centrifugation at 4,000g, 4 C. for 15 min. Pellets are re-suspended in 500 mM NaCl, 20 mM Tris pH 8.0, 20 mM imidazole and 3 mM BME and supplemented with 0.4 mg DNAse g.sup.1 wet cells (Sigma) and complete protease inhibitor tablets (EDTA-free, Roche). Cells are lyzed by passage through a cell disruptor at 30 kPSI or by sonication and the lysates are cleared by centrifugation at 40,000g, 4 C. for 45 min followed by filtration through 0.4 m membrane filter. Cleared lysates are applied to a Ni-sepharose FF column (GE Healthcare) pre-washed with lysis buffer and the protein eluted with 250 mM Imidazole. The His.sub.6-tag of TruD is removed by addition of 1 mg TEV protease per 10 mg TruD incubated at room temperature for 2 hours and the cleaved protein isolated by passage through a second Ni-sepharose FF column. (Note: TruD still functions efficiently if His.sub.6-tag is not removed). Both enzymes are then loaded on to a Superdex 200 gel filtration column (GE Healthcare), pre-equilibrated and run in 150 mM NaCl, 10 mM HEPES pH 7.4, 1 mM TCEP. Peak fractions were pooled and the proteins concentrated to 100 M for use in in vitro reactions.

    [0231] 1.2 Macrocyclases

    [0232] PatGmac (PatG residues 492-851) was cloned from genomic DNA (Prochloron sp.) into the pHISTEV vector (Liu, H. & Naismith, J. H 2009) and expressed in Escherichia coli BL21 (DE3) grown on autoinduction medium (Terrific broth base containing trace elements; Studier, F. W., 2005) for 48 h at 20 C.

    [0233] Cells were harvested by centrifugation at 4,000g, 20 C. for 15 min and resuspended in lysis buffer (500 mM NaCl, 20 mM Tris pH 8.0, 20 mM Imidazole and 3 mM -mercaptoethanol (BME)) with the addition of complete EDTA-free protease inhibitor tablets (Roche) and 0.4 mg DNase g wet cells (Sigma). Cells were lysed by passage through a cell disruptor at 30 kPSI (Constant Systems Ltd), or by sonication, and the lysate was cleared by centrifugation at 40,000g, 4 C. for 45 min followed by filtration through 0.4 m membrane filter. Cleared lysate was applied to a Ni-NTA (Qiagen) column or a Ni-sepharose FF column (GE Healthcare) pre-washed with lysis buffer and protein eluted with 250 mM imidazole.

    [0234] In some methods, the protein was then passed over a desalting column (Desalt 16/10, GE Healthcare) in 100 mM NaCl, 20 mM Tris pH 8.0, 20 mM imidazole, 3 mM m. Tobacco etch virus (TEV) protease was added to the protein at a mass-to-mass ratio of 1:10 and the protein digested for 1 h at 20 C. to remove the His-tag. Digested protein was passed over a second Ni-column and the flow-through loaded onto a monoQ column (GE Healthcare) equilibrated in 100 mM NaCl, 20 mM Tris pH 8.0, 3 mM BME. Protein was eluted from the monoQ column through a linear NaCl gradient, eluting at 350 mM NaCl. Finally, the protein was subjected to size-exclusion chromatography (Superdex 75, GE Healthcare) in 150 mM NaCl, 20 mM Tris pH 8.0, 3 mM m, and concentrated to 60 mg mL.sup.1.

    [0235] In other methods, the protein was then passed over Superdex 75, GE Healthcare in 150 mM NaCl, 10 mM HEPES pH 7.4, 1 mM TCEP and concentrated to 1 mM.

    [0236] All PatGmac point mutants were produced using the Phusion site-directed mutagenesis kit (Finnzymes) following the manufacturer's protocol, while the lid deletion mutants were made with fusion PCR. All mutant proteins were expressed and purified as above.

    [0237] 1.3 Precursor Peptides

    [0238] Variants of PatE, each encoding only one core peptide instead of two tandem patellamide core peptides, was cloned with a C-terminal His.sub.6-tag into pBMS233 for easier analysis of processed products. To enable more efficient N-terminal cleavage, additional residues were in some cases added directly before the core peptide to allow for cleavage by either trypsin (K/R) or TEV (ENLYFQ) (SEQ ID NO: 83). The protein was expressed in BL21(DE3) cells grown on auto-induction medium (Terrific broth base containing trace elements) at 37 C. overnight. Cells were harvested by centrifugation at 4,000g, 20 C., for 15 min and re-suspended in 8 M urea, 500 mM NaCl, 20 mM Tris pH 8.0, 20 mM imidazole and 3 mM BME. Cells were lysed by sonication, and the lysate waas cleared by centrifugation at 40,000g, 20 C. for 45 min followed by filtration through 5, 0.8 and 0.4 m membrane filters respectively. Cleared lysate was applied to a Ni-sepharose FF column (GE Healthcare) column prewashed with lysis buffer, and protein was eluted with 250 mM imidazole. DDT is added to the eluted PatE to a final concentration of 10 mM and the solution was incubated at room temperature for 3 hours. PatE is further purified and separated from protein aggregates by size-exclusion chromatography (Superdex 75, GE Healthcare) in 150 mM NaCl, 10 mM HEPES pH 7.4, 1 mM TCEP and concentrated to 1 mM.

    [0239] 2. Heterocyclization Reactions

    [0240] Hetrocyclization reactions contained 100 M PatE, 5 M TruD /PatD, 5 mM ATP pH 7, 5 mM MgCl.sub.2, 150 mM NaCl, 10 mM HEPES, pH 7.4, 1 mM TCEP. Reactions were incubated at 37 C. with shaking at 200 rpm for 24 h when using TruD and 48 h for PatD. In some cases, the PatE showed a degree of precipitation. In these instances the peptide was recovered from the precipitate by denaturation in 8M urea as above followed by Ni affinity chromatography and size-exclusion. Reactions were monitored by MALDI.

    [0241] Processed PatE was purified on Superdex 75, GE Healthcare in 150 mM NaCl, 10 mM HEPES pH 7.4, 1 mM TCEP and concentrated.

    [0242] 3. Macrocyclization Reactions

    [0243] For macrocyclization reactions comparing final product ratios after substrate depletion, 100 M peptide (VGAGIGFPAYDG) (SEQ ID NO: 68) was incubated with 50 M enzyme in 150 mM NaCl, 10 mM HEPES pH 8, 1 mM TCEP for 120 h at 37 C. Samples were analyzed by ESI or MALDI MS (LCT, Micromass or 4800 MALDI TOF/TOF Analyser, ABSciex).

    [0244] For other macrocyclization reactions, 100 M peptide (e.g. VGAGIGFPAYDG (SEQ ID NO: 68), VGAGIGFPAYRG (SEQ ID NO: 69), or GVAGIGFPAYRG (SEQ ID NO: 84)) was incubated with 20 M enzyme in a range of buffers for 24 h at 37 C. (see FIGS. 1 to 3).

    [0245] Other macrocyclization reactions contained 100 M peptide (PatE), 5% DMSO, 350 mM NaCl, 20 M PatGmac, 150 mM NaCl and 20 mM Bicine pH 8.0 were incubated at 37 C. with shaking at 200 rpm for 4 days and monitored by MS.

    [0246] 4. LC-MS Analysis of Products

    [0247] LC-MS was performed using a Phenomenex Sunfire C18 column (4.6 mm150 mm). Solvent A was H.sub.2O containing 0.1% formic acid and solvent B was MeOH containing 0.1% formic acid. Gradient: 0-2 min 10% B; 2-22 min 10% B to 100% B; 22-27 min 100% B; 27-30 min 100% B to 10% B. High resolution mass spectral data were obtained from a Thermo Instruments MS system (LTQ XL/LTQ Orbitrap Discovery) coupled to a Thermo Instruments HPLC system (Accela PDA detector, Accela PDA autosampler and Accela Pump). The following conditions were used: capillary voltage 45 V, capillary temperature 320 C., auxiliary gas flow rate 10-20 arbitrary units, sheath gas flow rate 40-50 arbitrary units, spray voltage 4.5 kV, mass range 100-2000 amu (maximum resolution 30000).

    [0248] 5. Crystallization, data collection, and crystallographic analysis

    [0249] Crystals of PatGmac were obtained in 19% PEG6000, 0.07 M calcium acetate, 0.1 M Tris pH 9.0. The crystals were cryoprotected in 30% glycerol and flash-cooled in liquid nitrogen. These crystals belonged to space group C2 with cell dimensions a=132.1 , b=67.6 , c=97.3 , =115.0.

    [0250] Crystals of PatGmac with peptide were obtained from a mixture of PatGmac with peptide (VPAPIPFPAYDG, (SEQ ID NO: 85) 1:4 molar ratio) in 1.2 M sodium citrate, 0.1 M sodium cacodylate pH 7.0. There was electron density for a peptide at one active site but the quality of the map was poor. We reasoned this was due to low occupancy of the peptide and therefore soaked the complex crystals overnight in 7.5 mM peptide prior to data collection. These crystals belonged to space group C2 with a=135.6 , b=67.3 , c=137.9 , p=116.8. Diffraction data of both structures were collected in-house, each on a single crystal at 100 K on a Rigaku 007HFM rotating anode X-ray generator with a Saturn 944 CCD detector and processed with xia2 (Winter, G., 2009).

    [0251] The structure of PatGmac was solved by molecular replacement with PHASER (Storoni, L. C., McCoy, A. J. & Read, R. J., 2004; McCoy, A. J., Grosse-Kunstleve, R. W., Storoni, L. C. & Read, R. J., 2005) using the structure of AkP (PDB entry IDBI) as the search model, followed by automatic rebuilding with Phenix (Adams, P. D. et al., 2004). The structure of PatGmac with peptide was solved by molecular replacement using the PatGmac structure as the search model. Manual rebuilding was performed with COOT (Emsley, P. & Cowtan, K. Coot, 2004) and refinement was performed using REFMAC5 (Murshudov, G. N., Vagin, A. A. & Dodson, E. J., 1997) implemented in the CCP4 program suite (Acta Crystallographica Section D 50, 760-763 (1994). The statistics of data collection and refinement are summarized in Table 1. Molecular graphics figures were generated with the program Pymol (DeLano Scientific, LLC).

    [0252] 6. Synthesis of the Peptide Substrates

    [0253] Fmoc amino acid derivatives, 2-(1H-benzotriazol-1-yl)-1,1,3,3-tetramethyluronium hexafluorophosphate (HBTU) and Fmoc-Gly-NovaSyn TGT resin were purchased from Novabiochem, Merck Biosciences, UK. Trifluoroacetic acid (TFA), N,N-diisopropylethylamine (DIEA), N,N-dimethylformamide (DMF), and piperidine were obtained from Sigma-Aldrich, UK and used without further purification.

    [0254] The peptides, including VGAGIGFPAYDG (SEQ ID NO: 68), VPAPIPFPAYDG (SEQ ID NO: 85), and GVAGIGFPAYRG (SEQ ID NO: 84), were synthesized manually using the standard Fmoc-based strategy (Cammish, L. E. & Kates, S. A., 2000). Amino acids were sequentially coupled after removal of the Fmoc blocking group at each cycle. Fmoc deprotection steps were carried out with 20% piperidine in DMF (v/v) for 12 min while coupling reactions were performed in DMF using a molar ratio of amino acid:HBTU:DIEA:resin of 5:5:10:1. Reactions were monitored using the Kaiser test.

    [0255] The peptides were cleaved from the support and deprotected by treatment with a mixture consisting of 95% TFA, 2.5% triisopropylsilane (TIPS), and 2.5% H.sub.2O (20 mL of mixture g.sup.1 of peptide resin, 3 h at room temperature). The resin was then filtered and washed with TFA. The combined filtrates were concentrated under reduced pressure. The peptide was precipitated with cold diethyl ether and recovered by centrifugation. The peptide sequence was verified by MSMS analysis.

    [0256] The peptide VGAGIGFPAYRG (SEQ ID NO: 68) was purchased from Peptide Protein

    [0257] Research Ltd.

    [0258] 7. Proteolytic Cleavage

    [0259] Different proteases were used, including trypsin and TEV protease, depending on the PatE sequence created. We use 4 g of trypsin per 1 mg of purified processed PatE. The corresponding figure for TEV protease is 1 mg for each 10 mg of PatE. Reactions were incubated at 37 C. with shaking at 200 rpm for up to 4 hours. Reaction products are purified using Superdex 30, GE Healthcare in 150 mM NaCl, 20 mM Bicine pH 8.0. The purified product was concentrated using on Phenomenex Strata C18-E, 55 m, 70 , 2 g/12 mL Giga SPE tube cartridges. After loading the sample, a washing step with deionised water to get rid of buffer salts was carried out and this was followed by elution step with 5 column volume methanol and 5 column volume of acetonitrile. We also washed the column with 5 volume of 0.1% TFA in acetonitrile. Washings with water or acidified acetonitrile were tested separately by MS for all peptides. Peptides were found to be eluted completely with the organic solvents.

    [0260] 8. Purification of Patellamides

    [0261] Macrocyclisation reactions were concentrated on Phenomenex Strata C18-E, 55 m, 70 , 2 g/12 mL Giga SPE tube cartridges following the above procedure. This was followed by final purification of the products using HPLC on C4 ACE column 10250 mm, 5 m and using a gradient of acetonitrile in water. Water was dionised standard while methanol and acetonitrile are both LCMS standards. All glassware was soaked with 1.0 molar nitric acid (12 hours) and rinsed with deionised water and air or oven dried. Purification process was monitored using DAD at wavelengths of 210, 220, 230, 240 and 254 nm.

    [0262] Structures of the purified products were confirmed using NMR and MS. NMR data for two compounds obtained was tabulated (Tables 7 and 8). Purified compounds were chemically oxidised using MnO.sub.2 in dichloromethane for three days at 28 C.

    [0263] Results

    EXAMPLE 1

    Overall Structure of the PatG Macrocyclase Domain

    [0264] The macrocyclase domain of PatG (PatGmac, residues 492-851) was overexpressed in E. coli BL21 (DE3) cells and purified using established protocols (Liu, H. & Naismith, J. H., 2009) The retention profile from gel filtration indicated that the domain was a monomer.

    [0265] The protein formed crystals belonging to the space group C2, with two biological monomers in the asymmetric unit. The structure was determined at 2.19 resolution by molecular replacement using the subtilisin Bacillus Ak.1 protease (AkP) (PDB entry 1DBI) as a search model. Table 1 shows the data collection and refinement statistics. The refined model (PDB entry 4AKS) includes residues 514-653, 659-685, 694-717, 728-745, 754-822, and 835-851 in chain A, and 515-650, 660-688, and 692-850 in chain B. The missing residues are in loops and at the N-terminus and are presumed to be disordered.

    [0266] PatGmac has a spherical shape with dimensions of approximately 53 42 48 . The protein contains a seven-stranded parallel p-sheet with two a helices on each face, a fold common to all subtilisin-like proteases. However, the conserved metal ion of subtilisin-like proteases is not present in PatGmac as the binding site is destroyed by sequence changes.

    [0267] PatGmac contains a catalytic triad consisting of Asp548 located at the C-terminus of the -strand 1, His618 in the middle of 4 and Ser783 at the N-terminus of 7. The carboxyl group of Asp548 is hydrogen bonded to the side-chain of His618 (2.9 ), which is in turn hydrogen bonded to the side-chain of Ser783 (2.7 ). PatGmac has an insertion that extends from 2 as a loop, then forms a helix-loop-helix motif and creates an N-terminal extension of 4, the helix that harbors His618. The insertion is found in other macrocyclases but is not conserved in length or sequence.

    EXAMPLE 2

    Comparison of Subtilisin-Like Protease AkP and PatGmac

    [0268] The amino acid sequences of the AkP and PatGmac are 28% identical and pairwise superposition gives a Ca rmsd of 1.23 over 145 structurally equivalent residues. The most striking difference is that PatGmac contains a helix-turn-helix insertion between 2 and 4 (A574 to K610) that sits above the active site; we denote this as the macrocyclization insertion. Eight of these residues form a two turn N-terminal extension of 4 when compared to the typical subtilisin structure. This results in the catalytic His being in the middle of this helix rather than at the end. The other 29 residues form a helix-turn-helix motif.

    [0269] Four cysteines, which are highly conserved in PatG and its homologs (Table 4), make two disulfide bonds: Cys685/724 and Cys823/834. The Cys685/724 disulfide bond in PatGmac is different from that seen in subtilisins. Cys137 of AkP is equivalent to Cys685 of PatGmac and it forms an intraloop disulfide bond with Cys139, making an 11-atom ring that is proposed to rigidify the active site.

    [0270] In contrast, PatGmac Cys685/724 bridges two loops, one of which connects 4 to 6 adjacent to the active site. As a result Phe684 and Arg686 pack against the side-chain of Met660, completely filling the S4 and S3 substrate binding pockets. Cys823/834 links the ends of the loop that connects 8 to 9 at the C-terminus of the domain and is distant from the active site.

    EXAMPLE 3

    PatGmac Substrate Complex

    [0271] The VPAPIPFPAYDG (SEQ ID NO: 85) peptide was chosen to match the residues equivalent to P8-P4, the eight-residue cassette and four C-terminal residue macrocyclization signature. The proline residues were chosen to mimic the heterocycles of the natural substrate and the peptide can in fact be macrocyclized by PatGmac (albeit slowly).

    [0272] The structure of the complex of PatGmacH618A (inactive mutant) was determined at 2.63 by molecular replacement using PatGmac native as a search model (Table 1). The difference electron density for bound peptide in the active site of one promoter was unambiguous for PIPFPAYDG (SEQ ID NO: 86) (P5 to P4) and showed that three N-terminal residues (VPA) of the substrate mimic are disordered. The refined model (PDB entry 4AKT) contains residues 514-686, 694-719, 727-747, 754-823, and 833-851 in chain A, and 515-651, 657-688, and 692-851 in chain B.

    [0273] Residues P5 and P4 of the substrate (Pro and Ile) make no contact with the protein while P3 (Pro) has weak van der Waals interactions with Tyr210. P2 (Phe) also makes limited van der Waals contacts and the side chain sits in a shallow pocket. The Pro of P1 adopts a cis peptide conformation that results in the substrate pointing away from the protein and the side-chain makes van der Waals contacts with His618Ala and Val622. The carbonyl of the P1-P1 peptide is 4.3 from and correctly oriented for nucleophilic attack by the hydroxyl of Ser783. The side-chain of Met784 sits on this face of the carbonyl while the side-chain of the absolutely conserved Asn717 points towards the opposite face in the correct position to stabilize the tetrahedral intermediate. The P1 Ala Ca and side-chain make only a few hydrophobic interactions, including contacts with Met784 and the protein backbone. It sits in a cavity that appears to be large enough for bulkier residues. The P2 (Tyr) residue makes extensive contacts with the protein: a n-stacking interaction with the highly conserved Phe747, a hydrogen bond to His746 (conserved as His or Lys in homologs) and a hydrogen bond between the Tyr main-chain oxygen and the nitrogen of Thr780. The side-chain of P3 (Asp) is oriented towards a large electropositive patch created by Arg589, Lys594, and Lys598. It makes a salt bridge with Lys598 and possibly Lys594, though the side chain of Lys594 is not well ordered. The P4 Gly residue makes no contact with the protein, although the terminal carboxyl group is close to Lys594. The binding of the peptide is accompanied by changes in PatGmac at Phe684, as the main chain moves 2 at the Ca position to avoid a clash with the substrate. The side chains of Met660, Phe684 and Arg686 prevent the binding of substrates that adopt an extended conformation.

    [0274] The active site where the acyl-enzyme intermediate would be formed is shielded from solvent by the macrocyclization insertion and the AYDG peptide.

    [0275] During macrocyclization, the acyl-enzyme intermediate is in equilibrium with the substrate. In PatGmac, the amino terminus of the substrate enters the active site, displacing AYDG (SEQ ID NO: 20) and leading to macrocyclization. Mutations that disrupt binding of AYDG (SEQ ID NO: 20) lead to linear product, as it is hydrolyzed by water. The role of the His in deprotonating the incoming amino terminus is speculative.

    EXAMPLE 4

    Biochemical Characterization of Macrocyclization

    [0276] The peptide VGAGIGFPAYDG (SEQ ID NO: 68) was used as a substrate for PatGmac in biochemical assays (FIG. 4C[[c]]). The ratio of macrocyclized to linear product using this substrate peptide was determined by ion counts obtained from liquid chromatography-electrospray ionization mass spectrometry (LC-ESI MS). For native protein only macrocyclized product (cyclo[VGAGIGFP] (SEQ ID NO: 70)) was detected (Table 2, FIGS. 5-10).

    [0277] PatGmac is a slow enzyme; turnover rates reported to date are 1 per day (Lee, J., McIntosh, J., Hathaway, B. J. & Schmidt, E. W., 2009; McIntosh, J. A. et al., 2010). Increasing the sodium chloride concentration from 150 mM to 500 mM gave greater than an order of magnitude improvement in rate. Increasing the pH from 8 to 9, further tripled the rate. Adding DMSO gave a small increase in rate but shifted the optimum pH, thus a buffer containing 500 mM NaCl and 5% DMSO at pH 8 gave a reaction rate over 50 times greater (FIG. 1). Under these conditions, about 7% linearized VGAGIGFP (SEQ ID NO: 70) byproduct was observed which can be separated from cyclo[VGAGIGFP] (SEQ ID NO: 70) by HPLC.

    [0278] Site-directed mutants K594D and K598D as well as two deletion mutants 578-608 (the helix-loop-helix insertion motif, PatGmac1) and 578-614 (the helix-loop-helix insertion and the N-terminal extension of 4, PatGmac2) consumed substrate at approximately the rate of native protein (FIGS. 5 to 8 and FIGS. 10A-10C). For K594D approximately one third of the product was macrocyclized with two thirds being the linear peptide. K598D and both deletions gave only linear VGAGIGFP (SEQ ID NO: 70) (FIGS. 5 to 8 and FIGS. 10A-10C). The triple mutant R589D/K594D/K598D was substantially slower and only produced linear substrate. All mutants purified normally and were folded according to CD spectroscopy.

    [0279] The substrate VGAGIGFPAYRG (SEQ ID NO: 69) has a modified recognition sequence (Asp to Arg); as expected PatGmac wild-type (and K594D and R589D/K594D/K598D) reacted extremely slowly with the substrate giving equal amounts of macrocyclized and linear products. PatGmac K598D produced cyclo[VGAGIGFP] with only 8% linear product, at a rate over an order of magnitude faster than wild-type PatGmac with VGAGIGFPAYDG (SEQ ID NO: 68) (FIGS. 2 and 3). The precise nature of the N terminus of the substrate influenced the rate, VGAGIGFPAYRG (SEQ ID NO: 69) was processed an order of magnitude faster than GVAGIGFPAYRG (SEQ ID NO: 84).

    [0280] Site-directed mutants S783A and H618A (both catalytic triad) gave no detectable reaction. Mass spectrometry clearly identified an acyl-enzyme intermediate (VGAGIGFP-PatGmac) during turnover (FIG. 8).

    [0281] To further explore macrocyclization, PatE pre-pro-peptide (PatE2) was engineered consisting of the 37-residue N-terminal leader sequence and N- and C- terminal cleavage recognition sites flanking a single cassette (ITACITFC) (SEQ ID NO: 21) corresponding to the natural product Patellamide D. In addition, a C-terminal His.sub.6-tag was added to aid in the purification process (FIGS. 11A and 11B).

    [0282] Precursor peptide PatE2, PatD and TruD (heterocyclases), PatApr (subtilisin-like protease domain) and PatGmac (subtilisin-like protease/macrocyclase domain) were cloned and expressed in E. coli and purified for use in biochemistry reactions (see materials & methods, above).

    EXAMPLE 5

    Purification and Refolding of PatE2

    [0283] PatE2 was cloned into the pBMS vector and expressed in E. coli BL21 (DE3) grown in auto-induction medium for 24 hours at 30 C., driving the protein to inclusion bodies. Cells were harvested by centrifugation at 4,000g for 15 min at 20 C., re-suspended in urea lysis buffer (8 M urea, 500 mM NaCl, 20 mM Tris pH 8.0, 20 mM Imdiazole and 3 mM -mercaptoethanol (mE)) and lysed by sonication at 15 microns (SoniPrep 150, MSE). The lysate was cleared by centrifugation at 40,000g, 20 C. followed by passage through a 0.45 m filter. The cleared lysate was applied to a His-Select column (GE Healthcare) equilibrated with lysis buffer and protein eluted with 250 mM imidazole. The protein was then supplemented with 10 mM Dithiothreitol (DTT) to induce refolding and subjected to size-exclusion chromatography (Superdex 75, GE Healthcare) in 150 mM NaCl, 10 mM HEPES pH 7.4, 1 mM TCEP. The protein eluted as a single monomer peak with final yields of between 250 to 300 mg/L culture.

    EXAMPLE 6

    In Vitro Heterocyclization of PatE2

    [0284] In order to assess heterocyclization of our single cassette PatE, we carried out several in vitro reactions. Incubation of 100 M PatE2 with 5 M PatD in 150 mM NaCl, 10 mM HEPES pH 7.4, 1 mM TCEP, 5 mM ATP, 5 mM MgCl.sub.2 at 37 C. for 30 minutes results in a loss of 72 amu corresponding to the expected four water losses, indicating that both threonine and both cysteine residues within the cassette were heterocyclized (FIG. 12).

    [0285] Alternatively, incubation of 100 M PatE2 with 5 M TruD under the same conditions resulted in the expected loss of 36 amu corresponding to two water losses and confirming that only the cysteine residues were heterocyclized (FIGS. 13A and 13B).

    [0286] Of all the enzymes used the two heterocyclases are by far the most difficult to express and purify (40 mg pure protein /L culture). We therefore wanted to investigate if they can be used in smaller amounts and recycled. When the heterocyclization reaction is incubated at 37 C. overnight the amount of enzyme can be reduced from 1:20 to 1:200 (Enzyme:Substrate) but the reaction time is significantly longer.

    [0287] Passing the finished reaction over a Superdex S200 gel filtration column (GE Healthcare) gives three peaks: Enzyme, substrate and ATP/ADP (FIG. 14). When the enzyme peak is pooled, concentrated and used for another reaction it is still fully functional, clearly showing that enzyme recycling is possible without the downside of longer reaction times.

    EXAMPLE 7

    N-Terminal Cleavage

    [0288] N-terminal cleavage of the cassette is mediated by the subtilisin-like protease domain of PatA. The protease domain acts on the recognition site GLEAS(SEQ ID NO: 41), cleaving between the S and the first residue of the cassette. We have found that turnover of this reaction in vitro is a slow process. In fact, incubation of 100 M PatE2 (with or without prior heterocyclase treatment) with 20 M PatApr at 37 C. for 200 hours is required for complete cleavage. The cassette portion is purified from PatApr and cleaved leader sequence by injecting the reaction on to a Superdex S30 column (GE Healthcare), pre-equilibrated in 150 mM NaCl, 20 mM Bicine pH 8.1. PatApr is highly expressed in E. coli with yields of >250 mg purified protein per litre of culture.

    [0289] Due to the slow nature of PatApr, we re-engineered the PatE2 pre-pro-peptide to contain a lysine residue (PatE2K) between the PatA recognition sequence GLEAS(SEQ ID NO: 41) and the cassette residues to allow for trypsin cleavage (FIGS. 11A and 11B) (e.g. X.sub.n-GLEASK(SEQ ID NO: 59) [cassette]-X.sub.m) To test if this addition affected heterocyclase activity, we incubated 100 M PatE2K separately with 0.5 M of both PatD and TruD overnight at 37 C. Expected water losses of four and two respectively were found by MS. The heterocyclized peptides were purified as previously described and cleaved with 1:1000 trypsin at 37 C. for 2 hours. Complete cleavage was confirmed by MS (FIG. 15) and the resulting fragments purified as above and subjected to macrocyclisation with PatGmac. Macrocyclisation of the peptide substrate was confirmed by MS.

    [0290] The PatE2 pre-pro-peptide also re-engineered to contain a TEV protease signal (ENLYFQ) (SEQ ID NO: 58)) between the PatA recognition sequence GLEAS and the cassette residues to allow for TEV cleavage (e.g. X.sub.n-GLEASENLYFQ (SEQ ID NO: 60) [cassette]-X.sub.m) To test if this addition affected heterocyclase activity, we incubated 100 M PatE2TEV separately with 0.5 M of PatD overnight at 37 C. Expected water losses of four and two respectively were found by MS. The heterocyclized peptides were purified as previously described and cleaved with 1:1000 TEV at 37 C. for 2 hours. Complete cleavage was confirmed by MS and the resulting fragments purified as above and subjected to macrocyclisation with PatGmac. Macrocyclisation of the peptide substrate was confirmed by MS.

    EXAMPLE 8

    C-Terminal Cleavage and Macrocyclization

    [0291] The final stage in patellamide production is C-terminal cleavage and macrocyclization. This step is catalyzed by the PatGmac domain. In order to macrocyclize our single cassette we incubated 100 M heterocyclized (with either PatD or TruD) and N-terminally cleaved PatE2/PatE2K with 20 M PatGmac for 24 hours at 37 C. in 20 mM Bicine pH 8.1, 500 mM NaCl, 5% DMSO to complete the reaction. Completeness of the reaction was confirmed by LCT-ESI MS (FIG. 16). Ion count analysis shows that the sample was 100% macrocyclized with no linear product or non-cleaved substrate present. PatGmac is also highly expressed in E. coli with between 200 and 250 mg purified protein obtained per liter of culture. The final macrocycles were purified by HPLC on a C18 peptide column. PatD and TruD heterocyclised macrocycles were subjected to HRMS and their structures confirmed by fragmentation (see FIGS. 19 to 21; Table 3). NMR analysis was carried out on TruD and PatD heterocyclised macrocycles, as shown in FIGS. 20 and 21) (Tables 7 and 8).

    EXAMPLE 9

    Purification of Patellamides

    [0292] PatE substrates with the core sequence cassettes ITVCITVC (SEQ ID NO: 30) (TruD), ITACITFC (SEQ ID NO: 21) (TruD, PatD), ITACITYC (SEQ ID NO: 25) (TruD, PatD), IMACIMAC (SEQ ID NO: 28) (TruD), IDACIDFC (SEQ ID NO: 29) (TruD), VTVCVTVC (SEQ ID NO: 33) (TruD, PatD), ITA(SeCys)ITF(SeCys) (SEQ ID NO: 27) (TruD), ACIMAC (SEQ ID NO: 35) (TruD),IACIMAC (SEQ ID NO: 36) (TruD), IITACIMAC (SEQ ID NO: 37) (TruD), ICACITFC (SEQ ID NO: 23) (TruD), IAACITFC (SEQ ID NO: 24) (TruD), ITACITAC (SEQ ID NO: 26) (TruD), ATACITFC (SEQ ID NO: 38) (TruD), ITAAITFC (SEQ ID NO: 31) (TruD) and ITACISFC (SEQ ID NO: 22) (TruD) were treated with either PatD or TruD heterocyclase as indicated, then subjected to proteolysis with trypsin and macrocyclisation with PatGmac, as described above. The cyclic products cyclo(ITV(Thn)ITV(Thn)) (SEQ ID NO: 79), cyclo(ITA(Thn)ITF(Thn)) (SEQ ID NO: 77), cyclo(I(MeOxn)A(Thn)I(MeOxn)F(Thn)) (SEQ ID NO: 73), cyclo(ITA(Thn)ITY(Thn)) (SEQ ID NO: 87), cyclo(I(MeOxn)A(Thn)I(MeOxn)Y(Thn)) (SEQ ID NO: 88), cyclo-(IMA(Thn)IMA(Thn)) (SEQ ID NO: 89), cyclo-(IDA(Thn)IDF(Thn)) (SEQ ID NO: 90), cyclo-(VTV(Thn)VTV(Thn) (SEQ ID NO: 91), cyclo-(V(MeOxn)V(Thn)V(MeOxn)V(Thn)) (SEQ ID NO: 92), cyclo-(ITA(Sen)ITF(Sen)) (SEQ ID NO: 93), cyclo-(A(Thn)IMA(Thn)) (SEQ ID NO: 94), cyclo-(IA(Thn)IMA(Thn)) (SEQ ID NO: 95), cyclo-(IITA(Thn)IMA(Thn)) (SEQ ID NO: 96), cyclo-(I(Thn)A(Thn)ITF(Thn)) (SEQ ID NO: 97), cyclo-(IAA(Thn)ITF(Thn)) (SEQ ID NO: 98), cyclo-(ITA(Thn)ITA(Thn)) (SEQ ID NO: 99), cyclo-(ATA(Thn)ITF(Thn)) (SEQ ID NO: 100), cyclo-(ITAAITF(Thn)) (SEQ ID NO: 101) and cyclo-(ITA(Thn)ISF(Thn)) (SEQ ID NO: 102)were then purified and analysed by NMR and MS.

    [0293] The production of heterocycle-containing macrocyclic structures was confirmed for all of these peptide substrates.

    [0294] NMR data for cyclo-(I(MeOxn)V(Thn)I(MeOxn)V(Thn)) (SEQ ID NO: 76) (Cmpd 32) produced from substrate peptide ITVCITVC(SEQ ID NO: 30) and cyclo-(ITA(Thn)ITF(Thn)) (SEQ ID NO: 77) (Cmpd 33) produced from substrate peptide ITACITFC (SEQ ID NO: 21) were tabulated (Tables 7 and 8). Furthermore, the NMR spectrum from in vitro cyclo-(I(MeOxn)V(Thn)I(MeOxn)V(Thn)) (SEQ ID NO: 76) was found to correspond to the NMR spectrum of the natural tetrahydroascidiacyclamide produced by Lissoclinum patella

    [0295] The ability to oxidise heterocycles following macrocyclisation was determined by assessing the conversion of thioazolines to thiazoles. Reduced cyclo-(I(MeOxn)V(Thn)I(MeOxn)V(Thn)) (SEQ ID NO: 76) produced from substrate peptide ITVCITVC (SEQ ID NO: 30) was subjected to oxidation using MnO.sub.2 in dichloromethane for three days at 28 C. The resulting mixture was subjected to silica gel and celite column chromatography followed by HPLC chromatography to yield the oxidized product (FIG. 25). Far UV CD spectra of cyclo-(I(MeOxn)V(Thn)I(MeOxn)V(Thn)) (SEQ ID NO: 76) (reduced form), cyclo-I(MeOxz)V(Thz)I(MeOxz)V(Thz)) (SEQ ID NO: 80) (oxidised form) and ascidiacyclamide isolated from Lissoclinum patella were recorded at room temperature in a 0.02 cm pathlength quartz cuvette using notional concentrations of 1 mg/mL. The CD spectrum of the oxidised cyclo-I(MeOxz)V(Thz)I(MeOxz)V(Thz)) (SEQ ID NO: 80) was found to correspond to the CD spectrum of ascidiacyclamide (FIG. 26).

    EXAMPLE 10

    Use of SUMO (Small Ubiquitin-Like Modifier) Tags

    [0296] A peptide substrate was engineered with a SUMO-tag (Marblestone et al Protein Sci. 2006 January; 15(1): 182-189) and a cassette sequence that previously showed no soluble expression. SUMO tags are small solubility tags (linked to a His.sub.6tag) of total size 13.6 kDa (MBP=42 kDa, GST=30 kDa) which can be used to increase the level of soluble expression of a target protein. SDS-PAGE analysis showed that the peptide substrate was expressed in soluble form and the SUMO tag could be removed from the substrate with TEV protease.

    EXAMPLE 11

    Use of a Reduced Leader Sequence

    [0297] It has previously been reported that the leader sequence of PatE is essential for heterocyclisation. We probed the interaction of .sup.15N-PatE with TruD (titrating until two-fold molar excess of TruD to PatE).

    [0298] Residues 1-15 undergo no change and thus appear uninvolved in binding to TruD. The remainder of the residue signals are broadened to such an extent that they become invisible, indicating that binding occurs at or after residue 16. The most highly conserved sequence in the leader region of PatE spans residues 26-34. A synthetic peptide with the first 25 residues of PatE (25PatE) deleted is processed as efficiently by TruD as native PatE. Three additional peptides were tested 37PatE (has only the five residue protease signature prior to the core peptide), 42PatE (first residue is core peptide) and the eight-residue core peptide itself. No reaction is seen with the core peptide alone, and surprisingly both 37PatE and 42PatE peptides are processed at a rate within an order of magnitude of the native, but only one residue of the core peptide (the terminal cysteine) reacts.

    [0299] Targeting individual residues within the conserved leader region revealed S30 was unimportant (S30F has wild type activity), but L29 and E31 were important. L29R and E31R both processed more slowly and gave mixtures of one and two heterocycles. Mutations G38I, L39N and A411 (within GLEAS protease signature) had no effect on heterocyclisation, while S42Q was processed at a much slower rate and intriguingly gave a mixture of 0 and 2 heterocycles while S42C was processed like wild-type. The mutation A52D was processed much slower, at the rate of S42Q, and also gave a mixture of 0 and 2 heterocycles. In contrast mutations Y53A and D54R, also within the macrocyclization sequence AYDG immediately C-terminal, were both processed.

    [0300] Two PatE mutants with core peptide sequences ITACITFP (SEQ ID NO: 103) (C51P) and ITACITFA (SEQ ID NO: 104) (C51A) were analyzed. The internal cysteine in C51P heterocyclised (judged by mass spectrometry) within 60 min at 37 C. (similar to native). The C51A mutant PatE without a five-membered ring at the C-terminus on the other hand reacted much more slowly, requiring 16 h at 37 C. for 50% product formation.

    EXAMPLE 12

    Dimer Formation from Cys Containing Cyclic Peptide

    [0301] The MALDI mass spectrum of the novel cyclo[VGICAGFP] (SEQ ID NO: 81) macrocyclic peptide (6; FIG. 27), exhibited a peak at 1509 Da, which provided indication that it was in a dimeric form, (21; FIG. 27) where two cyclic peptides were linked via a disulfide bond between their cysteine residues (FIG. 27). The VGICAGFP (SEQ ID NO: 81) cyclic monomer has a mass of 744 Da, and dimerization through the thiols would result in a mass of 2744 (cyclic monomer) 2 (two hydrogens lost on disulfide bond formation)=1486 Da, and the sodiated ion would produce the peak at 1486+23=1509 Da.

    [0302] Modification of the peptides at the cysteine residues could not be carried out without reducing the disulfide bond first. Reduction was attempted using several different reducing agents, namely TCEP, DTT, mercaptoethanol and TCEP immobilized on resin. Reduction with TCEP and DTT were shown to be the most effective, achieving complete reduction of the dimer at t=1 hr, where the peak at 1509 Da completely disappeared and peaks at 745 Da and 767 Da (corresponding to the protonated and sodiated forms of the monomeric cyclic peptide, respectively) appeared. TCEP immobilized on resin and -mercaptoethanol resulted in partial reduction.

    EXAMPLE 13

    Formation of Cyclotides using the Engineered PatGmac

    [0303] Cyclotides e.g. katala B1 are a family of plant proteins (28-40 amino acids) that have a unique topology, which combines a circular peptide backbone and a tightly knotted disulfide network that forms a CCK (cyclic cysteine knot) motif and makes the more than 80 known cyclotides exceptionally stable. The cyclotides are resistant to thermal unfolding, chemical denaturants and proteolytic degradation. There is a wide interest in making these compounds for wide range of applications.

    [0304] We tested the ability of the engineered PatGmac to macrocyclise the linear peptide sequence of katala B1, monitored the reaction using MALDI and compared the MS of the synthetic product with that of the purified native Katala B1. The reaction substrates were the oxidised and reduced form of the linear peptide sequence and contain at their C-term the recognition signal of PatG (AYDG) (SEQ ID NO: 20). PatGmac was found to cyclise both the reduced and oxidised precursors. The reduced precursor gave no traceable starting material after reaction with the enzyme and the oxidised version being less efficient.

    EXAMPLE 14

    Formation of Imidazolines using PatD or TruD

    [0305] A minimal peptide ITASITFXAYDG (SEQ ID NO: 82) (where X is g the unnatural amino acid 2,3-diaminopropanoic acid) was incubated with TruD or PatD as described above The reaction was analysed by MALDI MS and shows a loss of 18 Da consistent with heterocycle formation (formation of imidazoline) for both reactions, although the enzyme TruD was more efficient in this reaction (FIG. 28).

    [0306] Compounds

    TABLE-US-00001 [00001]embedded image R.sub.1 R.sub.2 R.sub.3 R.sub.4 R.sub.5 Patellamide A (1) CHMeEt CHMe.sub.2 CHMeEt H CHMe.sub.2 Patellamide B (2) CH.sub.2CHMe.sub.2 Me CHMeEt Me CH.sub.2Ph Patellamide C (3) CHMe.sub.2 Me CHMeEt Me CH.sub.2Ph Patellamide D (4) CHMeEt Me CHMeEt Me CH.sub.2Ph Patellamide E (5) CHMe.sub.2 CHMe.sub.2 CHMeEt Me CH.sub.2Ph Patellamide F (6) CHMe.sub.2 CHMe.sub.2 CHMe.sub.2 Me CH.sub.2Ph Patellamide G (7) CHMeEt Me CH.sub.2CHMe.sub.2 Me CH.sub.2Ph Ascidiacyclamide CHMeEt CHMe.sub.2 CHMeEt Me CHMe.sub.2 (8) [00002]embedded image R.sub.1 R.sub.2 Stereochemistry Lissoclinamide 1 (9) CHMe.sub.2 CHMeEt a = b = thiazole [A] = S [C] = R Lissoclinamide 2 (10) CHMeEt Me a = thiazoline, b = thiazole [A] = R [C] = R Lissoclinamide 3 (11) CHMeEt Me a = thiazoline, b = thiazole [A] = R [B] = R [C] = S Lissoclinamide 4 (12) CHMe.sub.2 CH.sub.2Ph a = thiazoline, b = thiazole [A] = S [B] = R [C] = R Lissoclinamide 5 (13) CHMe.sub.2 CH.sub.2Ph a = b = thiazole [A] = S [C] = R Lissoclinamide 6 (14) CHMe.sub.2 CH.sub.2Ph a = thiazoline, b = thiazole [A] = R [B] = R [C] = R Lissoclinamide 7 (15) CHMe.sub.2 CH.sub.2Ph a = b = thiazoline Lissoclinamide 8 (16) CHMe.sub.2 CH.sub.2Ph a = thiazoline, b = thiazole Lissoclinamide 9 (17) CHMeEt CHMe.sub.2 a = thiazoline, b = thiazole [A] = S [B] = R [C] = R Lissoclinamide 10 (18) CHMeEt CHMeEt a = thiazoline, b = thiazoline [A] = S [B] = R [C] = S [D] = R Ulicyclamide (19) CHMeEt Me a = b = thiazole [A] = S [C] = R [00003]embedded image R.sub.1 R.sub.2 Ulithiacyclamide A (20) CH.sub.2CHMe.sub.2 CH.sub.2CHMe.sub.2 Ulithiacyclamide B (21) CH.sub.2Ph CH.sub.2CHMe.sub.2 [00004]embedded image R Tawicyclamide A (22) CH.sub.2CHMe.sub.2 Tawicyclamide B (23) CH.sub.2Ph [00005]embedded image R Ulithiacyclamide E (24) CH.sub.2Ph Preuithiacyclamide (25) CH.sub.2CHMe.sub.2 (26) [00006]embedded image Ulithiacyclamide F (27) [00007]embedded image Ulithiacyclamide G (28) [00008]embedded image Ulithiacyclamide F (29) [00009]embedded image Prelissoclinamide-2 (30) [00010]embedded image Preulicyclamide (31) [00011]embedded image Patellin 2 (32) [00012]embedded image ITVCITVC (33) [00013]embedded image ITACITFC

    TABLE-US-00002 TABLE 1 PatGmac PatGmac + Peptide Data collection Space group C2 C2 Cell dimensions a, b, c () 132.08, 67.58, 97.34 135.63, 67.32, 137.87 , , () 90, 115.01, 90 90, 116.76, 90 Resolution () 2.19 (2.24-2.19) 2.63 (2.77-2.63) R.sub.sym or R.sub.merge 6.1 (49.8) 10.7 (52.2) I I 13.7 (2.9) 10.1 (2.3) Completeness (%) 99.5 (98.8) 99.3 (96.4) Redundancy 3.6 (3.5) 3.7 (3.1) Refinement Resolution () 33.79-2.19 21.42-2.63 No. reflections 38,196 31,502 R.sub.work/R.sub.free 0.203/0.224 0.191/0.218 No. atoms 4,877 5,108 Protein 4,653 4,897 Ligand/ion N/A 69 Water 224 142 B-factors 50.11 60.56 Protein 50.04 60.70 Ligand/ion N/A 77.98 Water 51.5 47.19 R.m.s. deviations Bond lengths () 0.009 0.009 Bond angles () 1.249 1.253 *1 crystal user per structure *Values in parentheses are for highest-resolution shell.

    TABLE-US-00003 TABLE 2 Unprocessed Linear Cyclic ion count (%) ion count (%) ion count (%) (M + H = 1123) (M + H = 717) (M + H = 699) PatGmac 0 0 100 PatGmac1 8 92 0 PatGmac2 <1 >99 0 PatGmac K598D 0 100 0 PatGmac K594D 0 71 29 PatGmac R589D 94 6 0 K594D K598D

    TABLE-US-00004 TABLE 3 Mass/Error (ppm) Molecular Formula Loss 817.3735 (1.11) C.sub.38H.sub.57N.sub.8O.sub.8S.sub.2 [M + H].sup.+ 789.3752 (4.34) C.sub.37H.sub.57O.sub.7N.sub.8S.sub.2 CO 781.3490 (4.35) C.sub.38H.sub.53O.sub.6N.sub.8S.sub.2 2H.sub.2O 771.3650 (3.96) C.sub.37H.sub.55O.sub.6N.sub.8S.sub.2 CO + H.sub.2O 754.3388 (3.57) C.sub.37H.sub.52O.sub.6N.sub.7S.sub.2 2H.sub.2O + CNO 686.2761 (4.13) C.sub.32H.sub.44O.sub.6N.sub.7S.sub.2 Thr-Ala 447.2040 (4.47) C.sub.22H.sub.31N.sub.4O.sub.4S Cys-Ile-Thr-Ala 817.3735 (1.11) C.sub.38H.sub.57N.sub.8O.sub.8S.sub.2 [M + H].sup.+

    TABLE-US-00005 TABLE 4 [00014]embedded image [00015]embedded image [00016]embedded image [00017]embedded image [00018]embedded image [00019]embedded image

    TABLE-US-00006 TABLE 5 GI: 62910837 AAY21150.1 subtilisin-like protein [Prochloron didemni] >gi|167859094|gb|ACA04487.1|TruA [uncultured Prochloron sp. 06037A] >gi|119492363|ref|ZP_01623699.1|hypothetical protein L8106_29035 [Lyngbya sp. PCC 8106] >gi|389832535|emb|CCI23777.1|conserved hypothetical protein [Microcystis aeruginosa PCC 9809] >gi|389678159|emb|CCH92969.1|conserved hypothetical protein [Microcystis aeruginosa PCC 9432] >gi|159027542|emb|CAO86912.1|unnamed protein product [Microcystis aeruginosa PCC 7806] >gi|158934368|emb|CAO82081.1|subtilisin-like protein [Microcystis aeruginosa NIES- 298] >gi|389788450|emb|CCI15917.1|Subtilisin-like protein [Microcystis aeruginosa PCC 9806] >gi|167859086|gb|ACA04480.1|TenA [Nostoc spongiaeforme var. tenue str. Carmeli] >gi|291571097|dbj|BAI93369.1|putative peptidase [Arthrospira platensis NIES-39] >gi|376002137|ref|ZP_09779984.1|putative Subtilisin-like serine protease, PatA-like [Arthrospira sp. PCC 8005] >gi|280987221|gb|ACK37888.2|anacyclamide synthesis protein AcyA [Anabaena sp. 90] >gi|332002613|gb|AED99426.1|N-terminal cyanobactin protease [Planktothrix agardhii NIES-596] >gi|300866524|ref|ZP_07111214.1|peptidase S8/S53 subtilisin kexin sedolisin [Oscillatoria sp. PCC 6506] >gi|113475994|ref|YP_722055.1|peptidase S8/S53 subtilisin kexin sedolisin [Trichodesmium erythraeum IMS101] >gi|389882390|emb|CCI37139.1|Peptidase S8 and S53, subtilisin, kexin, >gi|389826374|emb|CCI23117.1|Peptidase S8 and S53, subtilisin, kexin, sedolisin [Microcystis aeruginosa PCC 9808] >gi|389731215|emb|CCI04699.1|Peptidase S8 and S53, subtilisin, kexin, sedolisin [Microcystis aeruginosa PCC 9443] >gi|389802077|emb|CCI18837.1|Peptidase S8 and S53, subtilisin, kexin, sedolisin [Microcystis aeruginosa PCC 9807] >gi|119512478|ref|ZP_01631559.1|hypothetical protein N9414_11234 [Nodularia spumigena CCY9414] >gi|307591572|ref|YP_003900371.1|peptidase S8 and S53 subtilisin kexin sedolisin [Cyanothece sp. PCC 7822] >gi|220905947|ref|YP_002481258.1|peptidase S8/S53 subtilisin kexin sedolisin [Cyanothece sp. PCC 7425] >gi|217316976|gb|ACK37899.1|subtilisin-like protease [Microcystis sp. 130] >gi|217316978|gb|ACK37900.1|subtilisin-like protease [Oscillatoria sp. 327/2] >gi|217316980|gb|ACK37901.1|subtilisin-like protease [Tolypothrix sp. TOL328] >gi|113475997|ref|YP_722058.1|peptidase S8/S53 subtilisin kexin sedolisin [Trichodesmium erythraeum IMS101] >gi|217316950|gb|ACK37886.1|subtilisin-like protease [Aphanizomenon flos-aquae TR183] >gi|217316958|gb|ACK37890.1|subtilisin-like protease [Nodularia spumigena AV1] >gi|217316952|gb|ACK37887.1|subtilisin-like protease [Anabaena lemmermannii var. minor NIVA-CYA 83/1] >gi|217316956|gb|ACK37889.1|subtilisin-like protease [Anabaena planctonica 1tu33s10] >gi|217316968|gb|ACK37895.1|subtilisin-like protease [Planktothrix sp. 28] >gi|217316974|gb|ACK37898.1|subtilisin-like protease [Planktothrix agardhii NIVA-CYA 126/8] >gi|217316970|gb|ACK37896.1|subtilisin-like protease [Planktothrix agardhii 2] >gi|217316972|gb|ACK37897.1|subtilisin-like protease [Planktothrix agardhii 49] >gi|217316948|gb|ACK37885.1|subtilisin-like protease [Anabaena lemmermannii 202A2/41] >gi|284053852|ref|ZP_06384062.1|peptidase S8 and S53 subtilisin kexin sedolisin [Arthrospira platensis str. Paraca] >gi|217316964|gb|ACK37893.1|subtilisin-like protease [Snowella litoralis 0tu35s07] >gi|217316984|gb|ACK37903.1|subtilisin-like protease [Oscillatoria sancta PCC 7515] >gi|217316966|gb|ACK37894.1|subtilisin-like protease [Snowella litoralis 0tu37s04] >gi|217316982|gb|ACK37902.1|subtilisin-like protease [Lyngbya aestuarii PCC 7419]

    TABLE-US-00007 TABLE 6 gi|62910840|gb|AAY21153.1|adenylation/heterocyclization protein >gi|167859097|gb|ACA04490.1|TruD [uncultured Prochloron sp. 06037A] >gi|167859089|gb|ACA04483.1|TenD [Nostoc spongiaeforme var. tenue str. Carmeli] >gi|389788447|emb|CCI15911.1|heterocyclization protein [Microcystis aeruginosa PCC 9806] >gi|158934371|emb|CAO82084.1|heterocyclization protein [Microcystis aeruginosa NIES-298] >gi|159027545|emb|CAO86915.1|unnamed protein product [Microcystis aeruginosa PCC 7806] >gi|389832532|emb|CCI23771.1|heterocyclization protein [Microcystis aeruginosa PCC 9809] >gi|119492367|ref|ZP_01623703.1|hypothetical protein L8106_29055 [Lyngbya sp. PCC 8106] >gi|389678157|emb|CCH92967.1|conserved hypothetical protein [Microcystis aeruginosa PCC 9432] >gi|284051362|ref|ZP_06381572.1|hypothetical protein AplaP_07802 [Arthrospira platensis str. Paraca] >gi|291571091|dbj|BAI93363.1|hypothetical protein [Arthrospira platensis NIES-39] >gi|376002141|ref|ZP_09779988.1|conserved hypothetical protein, PatD-like [Arthrospira sp. PCC 8005] >gi|300866528|ref|ZP_07111218.1|conserved hypothetical protein [Oscillatoria sp. PCC 6506] gi|113475987|ref|YP_722048.1|hypothetical protein [Trichodesmium erythraeum IMS101] >gi|220905960|ref|YP_002481271.1|hypothetical protein [Cyanothece sp. PCC 7425] >gi|307591570|ref|YP_003900369.1|hypothetical protein Cyan7822_6535 [Cyanothece sp. PCC 7822] >gi|254415697|ref|ZP_05029455.1|YcaO-like family protein [Microcoleus chthonoplastes PCC 7420] >gi|307592449|ref|YP_003900040.1|Cyan7822_6146 [Cyanothece sp. PCC 7822] >gi|218442712|ref|YP_002381032.1|PCC7424_5737 [Cyanothece sp. PCC 7424] >gi|307592454|ref|YP_003900045.1|Cyan7822_6152 [Cyanothece sp. PCC 7822] >gi|389804481|emb|CCI16484.1|Genome sequencing data, contig C264 [Microcystis aeruginosa PCC 9807] >gi|389714868|emb|CCI00585.11|Genome sequencing data, contig C264 [Microcystis aeruginosa PCC 9717] >gi|307150541|ref|YP_003885925.1|hypothetical protein Cyan7822_0614 [Cyanothece sp. PCC 7822] >gi|389883469 emb|CCI36141.1|Genome sequencing data, contig C264 [Microcystis aeruginosa PCC 9701] >gi|374996241|ref|YP_004971740.1|bacteriocin biosynthesis cyclodehydratase domain protein [Desulfosporosinus orientis DSM 765] >gi|389732059|emb|CCI03939.1|Genome sequencing data, contig C264 [Microcystis aeruginosa PCC 9443] >gi|114567303|ref|YP_754457.1|hypothetical protein Swol_1788 [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|300864741|ref|ZP_07109593.1|conserved hypothetical protein [Oscillatoria sp. PCC 6506] >gi|159026417|emb|CAO87926.1|unnamed protein product [Microcystis aeruginosa PCC 7806] >gi|126661106|ref|ZP_01732187.1|hypothetical protein CY0110_05027 [Cyanothece sp. CCY0110] >gi|335387282|gb|AEH57221.1|cyclodehydratase/YcaO-domain protein [Prochloron didemni P1-Palau] >gi|115375227|ref|ZP_01462493.1|adenylation/heterocyclization protein [Stigmatella aurantiaca DW4/3-1] >gi|166366054|ref|YP_001658327.1|hypothetical protein MAE_33130 [Microcystis aeruginosa NIES- 843] >gi|389830836|emb|CCI26902.1|Genome sequencing data, contig C264 [Microcystis aeruginosa PCC 9809] >gi|172039012|ref|YP_001805513.1|hypothetical protein cce_4099 [Cyanothece sp. ATCC 51142] gi|357391463|ref|YP_004906304.1_adenylation/heterocyclization protein [Kitasatospora setae KM- 6054] >gi|330467969|ref|YP_004405712.1|[Verrucosispora mans AB-18-032] >gi|78042201|dbj|BAE46919.1|goadsporin biosynthetic protein [Streptomyces sp. TP-A0584] >gi|269126981|ref|YP_003300351.1|Tcur_2767 [Thermomonospora curvata DSM 43183]

    TABLE-US-00008 TABLE 7 In vitro In vitro Residue/Atom .sub.C/ppm .sub.H/ppm Ile1.sup.a CH 56.7 4.52 CH 38.4 1.76 .sub.1 CH.sub.3 15.3 0.88 .sub.2 CH.sub.2 25.0 1.48/1.12 CH.sub.3 11.0 0.89 CO C n.o. NH 7.56 Thr2.sup.b CH 56.6 4.32 CH 65.1 4.44 CH.sub.3 18.4 1.14 CO C 172.6 NH 7.07 Ala3 CH 48.4 4.69 CH 20.7 1.37 CN C 174.9 NH 8.48 Cys4 CH 77.6 5.05 CH.sub.2 36.6 3.70 CO C 170.3 Ile5.sup.a CH 56.8 4.53 CH 38.4 1.76 .sub.1 CH.sub.3 14.1 0.85 .sub.2 CH.sub.2 25.0 1.45/1.10 CH.sub.3 11.0 0.83 CO C n.o. NH 7.42 Thr6.sup.b CH 56.2 4.30 CH 65.1 4.41 CH.sub.3 17.27 1.10 CO C 170.6 NH 7.07 Phe7 CH 54.2 4.86 CH.sub.2 40.9 3.18/2.72 C 136.2 (CH).sub.2 129.2 7.18 (CH).sub.2 128.3 7.24 CH 127.1 7.21 CN C 173.3 NH 8.46 Cys8 CH 77.12 4.94 CH.sub.2 36.53 157/3.44 CO C 170.2 a/bResidues may be exchanged n.o.not observed

    TABLE-US-00009 TABLE 8 Natural In vitro Natural In vitro Residue/Atom .sub.C/ppm .sub.C/ppm .sub.H/ppm .sub.H/ppm Ile1/Ile5 CH 51.2 51.1 4.68 4.73 CH 38.5 38.6 1.81 1.85 .sub.1 CH.sub.3 15.2 15.1 0.84 0.89 .sub.2 CH.sub.2 24.7 25.2 1.41/1.08 1.46/1.11 CH.sub.3 11.2 11.3 0.83 0.88 CN C 169.4 170.0 NH 7.42 7.39 Thr2/Thr6 CH 74.3 74.3 4.21 4.22 CH 80.6 80.6 4.85 4.85 CH.sub.3 21.8 21.7 1.46 1.50 CO C 170.7 170.8 Val3/Val7 CH 55.4 55.1 4.78 4.81 CH 32.0 32.1 2.12 2.14 .sub.1 CH.sub.3 19.3 19.3 0.97 0.98 .sub.2 CH.sub.3 16.6 17.0 0.86 0.91 CN C 174.0 174.7 NH 7.24 7.22 Cys4/Cys8 CH 77.3 78.6 5.10 5.13 CH.sub.2 35.9 35.6 3.64 3.68 CO C 170.9 170.7

    MAIN REFERENCES

    [0307] Blunt, J. W. et al Nat Prod Rep 29, 144-222 (2012). Mayer, A. M. et al Comp Biochem Physiol C Toxicol Pharmacol 153, 191-222 (2011).

    [0308] Driggers, E. M. et al Nat Rev Drug Discov 7, 608-624 (2008).

    [0309] Cuevas, C. et al Nat Prod Rep 26, 322-337 (2009).

    [0310] McIntosh, J. A. et al. Nat Prod Rep 26, 537-559 (2009).

    [0311] Sivonen, K. et al Appl Microbiol Biotechnol 86, 1213-1225 (2010).

    [0312] Schmidt, E. W. et al. PNAS. U S A 102, 7315-7320 (2005).

    [0313] Long, P. F. et al Chembiochem 6, 1760-1765 (2005).

    [0314] Schmidt, E. W., BMC Biol 8, 83 (2010).

    [0315] Houssen, W. E. & Jaspars, M. Chembiochem 11, 1803-1815 (2010).

    [0316] Donia, M. S. et al. Nat Chem Biol 2, 729-735 (2006).

    [0317] Donia, M. S. et al Nat Chem Biol 4, 341-343 (2008).

    [0318] Houssen, W. E. et al. Chembiochem 11, 1867-1873 (2010).

    [0319] Lee, J. et al. J. Am. Chem. Soc. 131, 2122-2124 (2009).

    [0320] McIntosh, J. A. et al. J. Am. Chem. Soc. 132, 15499-15501 (2010).

    [0321] Schechter, I. et al Biochem. Biophys. Res. Commun. 27, 157 (1967).

    [0322] Katoh, T. et al Chem. Commun. 47, 9946-9958 (2011).

    [0323] Trauger, J. W. et al Nature 407, 215-218 (2000).

    [0324] Schneider, A. et al Archives of Microbiology 169, 404-410 (1998).

    [0325] Cane, D. E. et al. Chemistry & Biology 6, R319-R325 (1999).

    [0326] Liu, H. et al Protein Expr Purif 63, 102-111 (2009).

    [0327] Dodson, G. et al Trends Biochem. Sci. 23, 347-352 (1998).

    [0328] Perona, J. J. et al Protein Sci 4, 337-360 (1995).

    [0329] Ziemert, N. et al. Appl Environ Microbiol 74, 1791-1797 (2008).

    [0330] Donia, M. S. et al. Chem Biol 18, 508-519 (2011).

    [0331] Popp, M. W. et al Angew Chem Int Ed Engl 50, 5024-5032 (2011).

    [0332] Ahvazi, B. et al. Exp Mol Med 35, 228-242 (2003).

    [0333] Zhu, X. et al J. Am. Chem. Soc. 129, 14597-14604 (2007).

    [0334] Milne, B. F. et al Org Biomol Chem 4, 631-638 (2006).

    [0335] Liu, H. Protein Expr Purif 63, 102-111 (2009).

    [0336] Studier, F. W. Protein expression and purification 41, 207-234 (2005).

    [0337] Winter, G. Journal of Applied Crystallography 43, 186-190 (2009).

    [0338] Storoni, L. C.et al. Acta Crystallographica Section D-Biological Crystallography 60, 432-438 (2004).

    [0339] McCoy, A. J. et al. Acta Crystallographica Section D-Biological Crystallography 61, 458-464 (2005).

    [0340] Adams, P. D. et al. Journal of Synchrotron Radiation 11, 53-55 (2004).

    [0341] Emsley, P. Acta Crystallographica Section D-Biological Crystallography 60, 2126-2132 (2004).

    [0342] Murshudov, G. N. et al. Acta Crystallographica Section D-Biological Crystallography 53, 240-255 (1997).

    [0343] CCP4. The CCP4 suite: Programs for Protein Crystallography. Acta Crystallographica Section D 50, 760-763 (1994).

    [0344] Cammish, L. E. & Kates, S. A. Fmoc Solid Phase Peptide Synthesis: A Practical Approach. (2000).

    TABLE-US-00010 Sequences PatGfromProchlorondidemni(AAY21156.1) SEQIDNO:1 1 mfsimitidypftvslnrdiqvtstedyytlqvtesdpsawltfattpamdmafdhlkag 61 ttteslvqtlaelggpaareqfaltlqqldergwlsyavlplaeaipmvesaelnlpgnp 121 hwmetgvtlsrfayqhpyegtmvlesplskfrvklldwrasallaqlaqpqtlgtiappp 181 ylgpetayqflnllwatgflasdhepvslqlwdfhnllfhsrsrlgrhdypgtdlnvdnw 241 sdfpvvkppmsdrivplprpnlealmsndatlteaietrksvreydddnpitieqlgell 301 yraarvtkllspeerfgklwqqnkpvfeeagvdegefshrpypgggamyeleiypvvrlc 361 qglsqgvyhydplnhqleqiveskddifavsgsplasklgphvllvitarfgrlfrlyrs 421 vayalvlkhvgvlqqnlylvatnmglapcaggagdsdafaqvtgidyveesavgefilgs 481 lasevesdvvegedeiesagvsasevessatkqkvalhphdlderipgladlhnqtlgdp 541 qitiviidgdpdytlscfegaevskvfpywhepaepitpedyaafqsirdqglkgkekee 601 aleavipdtkdrivlndhachvtstivgqehspvfgiapncrvinmpqdavirgnyddvm 661 splnlaraidlalelganiihcafcrptqtsegeeilvqaikkcqdnnvlivsptgnnsn 721 eswclpavlpgtlavgaakvdgtpchfsnwggnntkegilapgeeilgaqpcteepvrlt 781 gtsmaapvmtgisallmslqvqqgkpvdaeavrtallktaipcdpevveeperclrgfvn 841 ipgamkvlfgqpsvtvsfaggqatrtehpgyatvapasipepmaeratpavqaatatemv 901 iapstepanpatveastafsgnvyalgtigydfgdearrdtfkermadpydarqmvdyld 961 rnpdearsliwtlnlegdviyaldpkgpfatnvyeiflqmlagqlepetsadfierlsvp 1021 arrttrtvelfsgevmpvvnvrdprgmygwnvnalvdaalatveyeeadedslrqgltaf 1081 lnrvyhdlhnlgqtsrdralnftvtntfqaastfaqaiasgrqldtievnkspycrlnsd 1141 cwdvlltfydpehgrrsrrvfrftldvvyvlpvtvgsikswslpgkgtvsk PatAfromProchlorondidemni SEQIDNO:2 1 mnrdilrtlslkgdhnirvaildgpvdiahpcfqgadltvlptlaptaarsdgfmsahgt 61 hvasiifgqpetsvpgiapqcrglivpifsddrrritqldlargieravnagahiinisg 121 geltdfgeadgwlenayslcrqnnvllvaaagnngcdclhvpaalpavlavgamddhghp 181 ldfsnwgstyeqqgilapgedilgakpgggterlsgtsfatpivsgvaalllseqvrrge 241 tpdpqkvrqlllqsalpcdddapegarrclagrlnvsgaftllkggnmseelatasfpsv 301 eascgcngglvaaepttnsgsmpalsyssfagaspatmeaagpldepqplpspaqpltqm 361 paqplpspaqpltqmpaqplpfpaqpltqmpaqpltqmpaptqtlsmttnqvtpsqapse 421 lansqfayvlgtlgydfgtearrdtfkqlmppfdfagnmvpanpydarqmvdylgnnise 481 arsliwtvnieltpvyaidptgpfasstyhalqellsgqiqaedneeyvervsipgvltn 541 rsvklfsgqvvpvvepqstrglygwkvnglvnaaleavraeggdagearirqtldgflnr 601 iyydlrnlgttsqdralnfavtnafqaaqtfsqsvaagmeldsvtvekspfcrldsdcwd 661 iklkffdpennrrakkiyrftidvsdlvpvtmgevrswsssy PatDfromProchlorondidemni SEQIDNO:3 1 mqptalqikphfhveiiepkqvyllgeqgnhaltgqlycqilpflngeytreqivekldg 61 qvpeeyidfvlsrlvekgyltevapelslevaafwselgiapsvvaeglkqpvtvttagk 121 giregivanlaaaleeagiqvsdpkapkapkagdstaqlqvvltddylqpelaainkeal 181 erqqpwllvkpvgsilwlgplfvpgetgcwhclaqrlrgnreveasvlqqkralqerngq 241 nkngaysclptaratlpstlqtglqwaateiakwmvkrhlnaiapgtarfptlagkiftf 301 nqttlelkahplsrrpqcptcgdqeilqrrgfeplklesrpkhftsdgghrattpeqtvq 361 kyqhligpitgvvtelvrisdpanplvhtyraghsfgssagslrglrntlrykssgkgkt 421 dsqsrasglceaierysgiflgdeprkratlaelgdlaihpeqclhfsdrqydnrdalna 481 egsaaayrwiphrfaasqaidwtplwslteqkhkyvptaicyynyllppadrfckadsng 541 naagnsleeailqgfmelverdsvalwwynrlrrpevelssfeepyflqlqqfyrsqnre 601 lwvldltadlgipafaglsrrtvgsservsigfgahldpkiailraltevsqvgleldkv 661 pdekldgeskdwmlevtlethpclapdpsqprktandypkrwsddiytdvmacvemakva 721 gletivldqtrpdiglnvvkvmipgmrtfwsrygpgrlydvpvqlgwlkeplaeaemnpt 781 nipf TruDfromProchlorondidemni SEQIDNO:4 1 mqptalqikphfhveiiepkqvyllgeqgnhaltgqlycqilpflngeytreqivekldg 61 qvpeeyidfvlsrlvekgyltevapelslevaafwselgiapsvvaeglkqpvtvttagk 121 giregivanlaaaleeagiqvsdprdpkapkagdstaqlqvvltddylqpelaainkeal 181 erqqpwllvkpvgsilwlgplfvpgetgcwhclaqrlqgnreveasvlqqkralqerngq 241 nkngaysclptaratlpstlqtglqwaateiakwmvkrhlnaiapgtarfptlagkiftf 301 nqttlelkahplsrrpqcptcgdretlqrrgfeplklesrpkhftsdgghramtpeqtvq 361 kyqhligpitgvvtelvrisdpanplvhtyraghsfgsatslrglrnvlrhkssgkgktd 421 sqsrasglceaierysgifqgdeprkratlaelgdlaihpeqclhfsdrqydnressner 481 atvthdwipqrfdaskandwtpvwslteqthkylptalcyyrypfppehrfcrsdsngna 541 agntleeailqgfmelverdsvclwwynrvsrpavdlssfdepyflqlqqfyqtqnrdlw 601 vldltadlgipafvgvsnrkagsseriilgfgahldptvailraltevnqigleldkvsd 661 eslkndatdwlvnatlaaspylvadasqplktakdyprrwsddiytdvmtcveiakqagl 721 etlvldqtrpdiglnvvkvivpgmrfwsrfgsgrlydvpvklgwreqplaeaqmnptpmp 781 f PatFfromProchlorondidemni SEQIDNO:5 1 mdlidrlqnnqrkdrrlqfvrthqeafdvkptfplplfeeaileiegscsvesscqvegd 61 rlqggryevcnnqgttwpeslthafklldkidsqlgvrinrdsfdrfaaahvnsrkiinn 121 tigvhlgskledssvmlyihikpeedteelartalvldggrysdeltrvllrdtmvigfe 181 lffdgrsrvdlgpcapgksgtlkmkgkhleqytqknlsrkvnsifregylfgaffsktrv 241 epilffyhsiikdlpkyftfnslgdkiynfcqsqgcitdvaiavteteleksrlenfcfy 301 ydqwdeckpssdydterhlh