Novel Flavone Hydroxylases, Microorganism for Synthesizing Flavone C-Glycoside Compounds, and Use Thereof
20230102194 · 2023-03-30
Inventors
Cpc classification
C12N9/0071
CHEMISTRY; METALLURGY
C12P19/18
CHEMISTRY; METALLURGY
C12N9/0073
CHEMISTRY; METALLURGY
C12N15/70
CHEMISTRY; METALLURGY
Y02A50/30
GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
International classification
C12N15/70
CHEMISTRY; METALLURGY
C12P17/06
CHEMISTRY; METALLURGY
C12P19/18
CHEMISTRY; METALLURGY
Abstract
Provided are novel flavone hydroxylases, a microorganism for synthesizing flavone C-glycoside compounds, and use thereof. The present inventor obtains novel flavones hydroxylates PhF2H and PhF3′H by cloning, which belong to cytochrome P450 hydroxylates and have the function of hydroxylating specific positions of compounds. Further, the present inventor, by modifying the enzymes and combining a C-glycoside glycosyltransferase and assembly of a synthesis pathway of a flavone precursor, efficiently synthesizes flavone C-glycoside compounds such as oriention, isooriention, vitexin and isovitexin, and related intermediates such as eriodictyol and 2-hydroxynaringenin in the synthesis pathway thereof in an artificial recombinant expression system.
Claims
1. A method of catalyzing C-2 position or C-3′ position hydroxylation of flavanone compounds, comprising: catalyzing with a novel flavone hydroxylase; wherein, the novel flavone hydroxylase is a polypeptide shown in SEQ ID NO:1 or a conservative variant polypeptide thereof, which catalyzes the hydroxylation of flavanone compounds at the C-2 position; or the novel flavone hydroxylase is a polypeptide shown in SEQ ID NO:2 or a conservative variant polypeptide thereof, which catalyzes the hydroxylation of flavanone compounds at the C-3′ position.
2. The method according to claim 1, wherein the flavanone compound has a parent nucleus structure of formula (I), forms a parent nucleus structure of formula (II) after hydroxylation at the C-2 position, or a parent nucleus structure of formula (III) after hydroxylation at the C-3′ position; ##STR00003##
3. The method according to claim 2, wherein, in A ring or B ring, there are 1, 2 or 3 hydroxyl groups.
4. The method according to claim 1, wherein the flavanone compound comprises: naringenin, eriodictyol, pinocembrin, hesperidin, or sakuranetin; the product of hydroxylation at the C-2 position is a 2-hydroxy flavanone compound, comprising: 2-hydroxynaringenin, 2-hydroxyeriodictyol, 2-hydroxypinocembrin, 2-hydroxyhesperidin, or 2-hydroxysakuranetin; after hydroxylation at the C-2 position of the flavanone compound, the 2-hydroxy flavanone compound is formed in an open-loop; or the product of hydroxylation at the C-3′ position is a 3′-hydroxy flavanone compound, comprising: eriodictyol, 3′-hydroxyeriodictyol, or 3′-hydroxysakuranetin.
5-7. (canceled)
8. The method according to claim 1, wherein, in the polypeptide shown in SEQ ID NO: 1 or a conservative variant polypeptide thereof, N-terminal amino acids of transmembrane region are partially or completely truncated; or in the polypeptide shown in SEQ ID NO: 1 or a conservative variant polypeptide thereof, N-terminal amino acids of transmembrane region are partially or completely truncated.
9. The method according to claim 8, wherein it further comprises a tag added at the N-terminus.
10. The method according to claim 1, wherein, conservative variant polypeptide of SEQ ID NO: 1 or 2 comprises: (1) polypeptides derived from the sequence shown in SEQ ID NO: 1 or 2, being formed by substitution, deletion or addition of one or more amino acid residues, and have a catalytic function of C-2 position or C-3′ position hydroxylation of the flavanone compounds; (2) polypeptides having at least 80% sequence identity to the amino acid sequence shown in SEQ ID NO: 1 or 2 and having a catalytic function of C-2 position or C-3′ position hydroxylation of the flavanone compounds; (3) polypeptides derived from the sequence shown in SEQ ID NO: 1 or 2 have a tag added at N-terminus or C-terminus; or, a signal polypeptide fused at N-terminus.
11. A method of synthesizing flavone C-glycoside compounds or intermediates thereof, wherein, it comprises: (1) catalyzing flavanone compounds by a novel flavone hydroxylase to form the hydroxylation at the C-2 position or C-3′ position; the novel flavone hydroxylase is a polypeptide shown in SEQ ID NO:1 or a conservative variant polypeptide thereof, which catalyzes the hydroxylation of flavanone compounds at the C-2 position; or, the novel flavone hydroxylase is a polypeptide shown in SEQ ID NO:2 or a conservative variant polypeptide thereof, which catalyzes hydroxylation of flavanone compounds at the C-3′ position; (2) the product of C-2 position hydroxylation of (1) is C-glycoside glycosylated to obtain C-glycoside-2-hydroxyflavanone compounds; or, the product of C-3′ position hydroxylation of (1) is further hydroxylated at the C-2 position, then C-glycoside glycosylated to obtain flavone C-glycoside compounds or intermediates thereof.
12. The method according to claim 11, wherein, prior to (1), it further comprises: (b) a malonyl-CoA structural analogue and a p-coumaroyl-CoA structural analogue are catalyzed by chalcone synthase and chalcone isomerase to obtain flavanone compounds.
13. The method according to claim 12, wherein, prior to (b), it further comprises: (a) aromatic amino acids are catalyzed by tyrosine ammonia lyase or phenylalanine ammonia lyase and 4-coumaroyl-CoA ligase to obtain p-coumaroyl-CoA structural analogue.
14. The method according to claim 11, wherein the flavanone compound comprises: naringen in, or eriodictyol; the malonyl-CoA structural analogue comprising: malonyl-CoA or methylmalonyl-CoA; the p-coumaroyl-CoA structural analogue comprising: p-coumaroyl-CoA or p-cinnamyl-CoA; the aromatic amino acids comprise: L-tyrosine or L-phenylalanine; or the C-glycoside glycosylation is carried out with C-glycosyltransferase.
15. A method of biosynthesizing flavanone compounds, comprising: co-transferring precursor genes for the synthesis of flavanone compounds and genes encoding a novel flavone hydroxylase into host cells; the novel flavone hydroxylase is a polypeptide shown in SEQ ID NO:1 or a conservative variant polypeptide thereof, which catalyzes the hydroxylation of flavanone compounds at the C-2 position to obtain 2-hydroxyflavanone compounds; and/or, the novel flavone hydroxylase is a polypeptide shown in SEQ ID NO:2 or a conservative variant polypeptide thereof, which catalyzes the hydroxylation of flavanone compounds at the C-3′ position to obtain a 3′-hydroxyflavanone compound.
16. A method of biosynthesizing flavone C-glycoside compounds or intermediates thereof, comprising: (i) Co-transferring precursor genes for the synthesis of flavanone compounds, genes encoding novel flavone hydroxylases and genes encoding C-glycosyltransferases into host cells; the novel flavone hydroxylase is a polypeptide shown in SEQ ID NO: 1 or a conservative variant polypeptide thereof, which catalyzes the hydroxylation of flavanone compounds at the C-2 position; and/or, the novel flavone hydroxylase is a polypeptide shown in SEQ ID NO: 2 or a conservative variant polypeptide thereof, which catalyzes hydroxylation of flavanone compounds at the C-3′ position; (ii) Culturing cells of (i), thereby biosynthesizing flavones C-glycoside compounds or intermediates thereof.
17. A genetically engineered cell, comprising: precursor genes for the synthesis of flavanone compounds and genes encoding novel flavone hydroxylases; wherein, the novel flavone hydroxylase is a polypeptide shown in SEQ ID NO: 1 or a conservative variant polypeptide thereof, which catalyzes the hydroxylation of flavanone compounds at the C-2 position; and/or, the novel flavone hydroxylase is a polypeptide shown in SEQ ID NO: 2 or a conservative variant polypeptide thereof, which catalyzes hydroxylation of flavanone compounds at the C-3′ position.
18. The genetically engineered cell according to claim 17, further comprising: genes encoding C-glycosyltransferases.
19. The genetically engineered cell according to claim 17, wherein the method of preparing said cells comprises: co-transferring precursor genes for the synthesis of flavanone compounds, genes encoding novel flavone hydroxylases into host cells; wherein, the novel flavone hydroxylase is a polypeptide shown in SEQ ID NO:1 or a conservative variant polypeptide thereof, which catalyzes hydroxylation of flavanone compounds at the C-2-position; or, the novel flavone hydroxylase is a polypeptide shown in SEQ ID NO: 2 or a conservative variant polypeptide thereof, which catalyzes hydroxylation of flavanone compounds at the C-3′ position.
20. A kit for biosynthesizing flavone C-glycoside compounds or intermediates thereof, comprising: novel flavone hydroxylases; precursor genes for the synthesis of flavanone compounds; wherein the novel flavone hydroxylase is a polypeptide shown in SEQ ID NO: 1 or a conservative variant polypeptide thereof, which catalyzes the hydroxylation of flavanone compounds at the C-2 position; and/or, the novel flavone hydroxylase is a polypeptide shown in SEQ ID NO: 2 or a conservative variant polypeptide thereof, which catalyzes hydroxylation of flavanone compounds at the C-3′ position.
21. (canceled)
22. The method according to claim 15, wherein, the host cells comprise: prokaryotic cells or eukaryotic cells.
23. The method according to claim 11, wherein, the flavone C-glycoside compounds comprise: oriention, isooriention, vitexin, or isovitexin; or the intermediates of the flavone C-glycoside compounds comprise: 2-hydroxynaringenin-C-glucoside, or 2-hydroxyeriodictyol-C-glucoside.
24. The method according to claim 15, wherein, the precursor genes for the synthesis of flavanone compounds comprise genes of aromatic amino acids tyrosine ammonia lyase or phenylalanine ammonia lyase, 4-coumaroyl-CoA ligase, chalcone synthase, and chalcone isomerase; or the cells also comprise genes that synthesize glycosyl donors; or the cells further comprise a cytochrome P450 reductase expression cassette.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
DETAILED DESCRIPTION
[0055] The inventors are committed to the biosynthesis of flavanone compounds or C-glycoside flavone compounds (flavone C-glycoside compounds), by genomics mining of plants, novel flavone hydroxylases PhF2H and PhF3 ′H were obtained, which belong to cytochrome P450 hydroxylases and have the function of hydroxylation of specific positions of the compounds. Further, by modifying the enzymes, using a C-glycoside glycosyltransferase and assembling a synthesis pathway of a flavone precursor, the inventors efficiently synthesize flavone C-glycoside compounds such as orientin, isoorientin, vitexin, isovitexin and related intermediates such as 2-hydroxynaringenin and eriodictyol in the synthesis pathway thereof.
[0056] Bioactive Polypeptides, Encoding Genes, Vectors and Hosts Thereof
[0057] By genomics and transcriptome mining, combined with a large number of research and experimental works, the inventors revealed novel flavone hydroxylases PhF2H and PhF3′H. The finding of the inventors in heterologous (exogenous) expressions of the enzyme shows that PhF2H can efficiently catalyze the hydroxylation of flavones such as naringenin and its derivatives at the C-2 position; PhF3′H can efficiently catalyze the hydroxylation of flavones such as naringenin and its derivatives at the C-3′ position. Preferably, flavone hydroxylases of the present disclosure are derived from Gramineae (Monocotyledoneae); more preferably, they are derived from Phyllostachys edulis (or Phyllostachys heterocycla; Ph).
[0058] The PhF2H has an amino acid sequence shown in SEQ ID NO: 1. The PhF3′H has an amino acid sequence shown in SEQ ID NO: 2.
[0059] The present disclosure also includes conservative variant polypeptides of the flavone hydroxylases PhF2H (flavanone-2-hydroxylase) and PhF3′H (flavanone-3′-hydroxylase). In the present disclosure, the “conservative variant polypeptide (s)” refers to a polypeptide that basically maintains same biological functions or activities as the polypeptide described. The “conservative variant polypeptide(s)” may be (i) polypeptides with one or more conservative or non-conservative amino acid substitution (preferably conservative), where the substituted amino acid residues may or may not be one encoded by the genetic code, or (ii) polypeptides containing substitutions of one or more amino acid residues having a substituent group, or (iii) polypeptides formed having the mature polypeptide fused with another compound (such as compounds that extend half-life of the polypeptide, for example, polyethylene glycol), or (iv) polypeptides formed by having said polypeptide fused with additional amino acid sequence (such as leader sequence or secretory sequence, or sequence used for purification of the polypeptide or proprotein sequence, or fusion protein formed with fragment of antigen IgG). In accordance with the teachings provided herein, these fragments, derivatives and analogs are well known to a person skilled in the art.
[0060] The “conservative variant polypeptide” may include but are not limited to: deletion, insertion and/or substitution of one or more (usually 1-50, preferably 1-30, more preferably 1-20, most preferably 1-10) amino acids, and addition or deletion of one or several (usually within 50, preferably within 20 or 10, more preferably within 5) amino acids at the C-terminal and/or N-terminal. For example, substitution with amino acids of comparable or similar properties usually does not change protein function in the art. As another example, addition of one or more amino acids to the C-terminus and/or N-terminus usually does not change the function of a protein either. The present disclosure also provides analogs of the polypeptides. The differences between analogs and the original polypeptide may be the difference in amino acid sequences, and may also be the difference in the forms of modifications that will not affect the sequence, or both. These polypeptides include natural or induced genetic variants. Induced variants can be obtained by a variety of techniques, such as generating random mutagenesis by irradiation or exposure to mutagens, and can also be obtained by directed mutagenesis or other known molecular biology techniques. Analogs mentioned herein also include analogs with residue(s) different from natural L-amino acid (e.g., D-amino acids), as well as analogs with a non-naturally occurred or synthetic amino acid (e.g., β, γ-amino acids). It should be understood that the polypeptides of the present disclosure are not limited to the representative polypeptides described above.
[0061] In a preferable embodiment of the disclosure, polypeptide fragments in N-terminal transmembrane region of the flavanone-2-hydroxylase and flavanone-3′-hydroxylase of the present disclosure are removed. The inventors found that removing the N-terminal transmembrane region can increase the soluble expression of the truncated protein, and when it is applied to the biosynthetic pathway, it can exert better activities.
[0062] The N-terminal or C-terminal of the flavone hydroxylase of the present disclosure can also comprise one or more polypeptide fragments as protein tag(s). For example, the tag may be FLAG, HA, HA1, c-Myc, Poly-His, Poly-Arg, Strep-TagII, AU1, EE, T7, 4A6, F, B, gE, and Ty1. In a preferable embodiment of the disclosure, the tag comprises 2B, 17a, MBP, etc.; more preferably, the tag is 2B1.
[0063] When producing the flavone hydroxylase or other enzymes of the present disclosure, in order to make translated proteins be secreted and expressed (such as secreted to the outside of cells), a secretion signal sequence may also be added to the N-terminus of the polypeptide of the present disclosure. The signal peptide can be cut off during the secretion of the polypeptide from cells.
[0064] The bioactive polypeptides of the disclosure can be recombinant polypeptides, natural polypeptides, or synthetic polypeptides. The polypeptide of the present disclosure can be a naturally purified product, or a chemically synthesized product, or can be produced by prokaryotic or eukaryotic hosts (for example, bacteria, yeast, higher plants) using recombinant technology. Depending on the host used in the recombinant production, the polypeptide of the present disclosure may be glycosylated or non-glycosylated. The polypeptide of the present disclosure may include or not include the initial methionine residue.
[0065] The polynucleotide sequences encoding the C-glycoside flavone hydroxylase and other enzymes of the present disclosure can be in the form of DNA or RNA. Forms of DNA include cDNA, genomic DNA or artificially synthesized DNA. DNA can be single-stranded or double-stranded. The DNA can be a coding strand or a non-coding strand. The term “polynucleotide encoding a/the polypeptide” may include a polynucleotide encoding the polypeptide, or a polynucleotide that further includes additional coding and/or non-coding sequences.
[0066] The present disclosure also relates to vectors containing the polynucleotides of the present disclosure, as well as host cells produced by genetic engineering methods using the vectors or coding sequences of the polypeptides of the present disclosure, and methods for producing the polypeptides of the present disclosure through recombinant technology.
[0067] Through conventional recombinant DNA technology, recombinant polypeptides can be expressed or produced. Generally speaking, steps are as follows: (1). Transforming or transducing an appropriate host cell with a polynucleotide encoding the polypeptide (including its conservative variant polypeptides), or with a recombinant expression vector containing the polynucleotide; 2). Culturing the host cells in a suitable medium; (3). Isolating and purifying proteins from the culture medium or cells.
[0068] In the present disclosure, the polynucleotide sequence encoding the polypeptide can be inserted into a recombinant expression vector. The term “recombinant expression vector” refers to bacterial plasmids, phages, yeast plasmids, plant cell viruses, mammalian cell viruses such as adenovirus, retrovirus or other vectors well known in the art. Any plasmid and vector can be used as long as it can replicate and be stable in the hosts. An important characteristic of an expression vector is that it usually contains an origin of replication, a promoter, a marker gene, and translation control elements. Preferably, the expression vector may be a prokaryotic expression vector.
[0069] Suitable methods for constructing expression vector which comprises the polynucleotide encoding the flavone hydroxylase or other enzymes of the present disclosure and appropriate transcriptional/translational control signals are well known to the person skilled in the art. These methods include in vitro recombinant DNA technology, DNA synthesis technology, in vivo recombinant technology and so on. Said DNA sequence may be effectively linked to a proper promoter in the expression vector to direct mRNA synthesis. In addition, the expression vector preferably contains one or more selective marker genes to provide phenotypic traits for the selection of transformed host cells.
[0070] Vectors containing the above appropriate DNA sequences and appropriate promoters or regulatory sequences can be used to transform appropriate host cells so that they can express proteins. The host cell can be a prokaryotic cell, such as a bacterial cell; or a lower eukaryotic cell, such as a yeast cell; or a higher eukaryotic cell, such as a mammalian cell. Representative examples include: bacterial cells of Escherichia coli, Streptomyces, Bacillus subtilis; Salmonella typhimurium; fungal cells such as yeast cells, plant cells, Ganoderma lucidum cells; insect cells of Drosophila S2 or Sf9; CHO, COS, 293 cells, or animal cells of Bowes melanoma cells, etc.
[0071] The present disclosure also provides host cells for the biosynthesis of flavone C-glycoside compounds or intermediates thereof, wherein it comprises: precursor genes of synthetic flavanone compounds, genes of present disclosure encoding flavanone-2-hydroxylase and/or flavanone-3′-hydroxylase and genes encoding C-glycosyltransferases.
[0072] In a preferable embodiment of the disclosure, the host cells is prokaryotic cells; preferably Escherichia coli cells, yeast cells or Streptomyces cells, more preferably Escherichia coli cells. The host cell is a type of production tools. Those skilled in the art can modify other host cells except for E. coli by some technical means, so as to also realize the biosynthesis of the present disclosure. The modified host cells and preparation methods should also be included in the present disclosure.
[0073] In a preferable embodiment of the disclosure, in the host cells, the precursor genes for the synthesis of flavanone (class) compounds comprise genes of aromatic amino acids tyrosine ammonia lyase (TAL) or phenylalanine ammonia lyase (PAL), 4-coumaroyl-CoA ligase, chalcone synthase (CHS), chalcone isomerase (CHI). The present disclosure also comprises conservative variant polypeptides of the chalcone synthase (CHS), chalcone isomerase (CHI), aromatic amino acids tyrosine ammonia lyase (TAL), phenylalanine ammonia lyase (PAL), 4-coumaroyl-CoA ligase, C-glycosyltransferases, and so on.
[0074] In a preferable embodiment of the disclosure, the cells also comprise genes that synthesize glycosyl donors. The glycosyl group comprises glucose; preferably, the glycosyl donor is a compound carrying a glucose group; for example, the glycosyl donor comprises UDP glucose.
[0075] In a preferable embodiment of the disclosure, the cells further comprise a cytochrome P450 reductase expression cassette, which is used in combination with the cytochrome P450 hydroxylase of the present disclosure to provide reduction. The present disclosure also includes conservative variant polypeptides of the cytochrome P450 reductase.
[0076] Use and Preparation Methods
[0077] The flavone hydroxylates PhF2H and PhF3′H or their conservative variant polypeptides of the present disclosure can be applied to specifically and efficiently catalyze the hydroxylation of the C-2 or C-3′ positions of flavanone compounds to produce a type of products hydroxylating at specific positions, combined with glycosylation of C-glycosides to further obtain C-glycoside-2-hydroxyflavanone compounds or C-glycoside-2,3′-dihydroxyflavanone compounds, and by further dehydration reaction to form flavone C-glycoside compounds.
[0078] Therefore, the present disclosure provides a use of the flavone hydroxylases PhF2H and PhF3′H or their conservative variant polypeptides for catalyzing C-2 or C-3′ position hydroxylation of flavanone compounds; wherein, the flavone hydroxylase PhF2H is a polypeptide shown in SEQ ID NO: 1 or its conservative variant polypeptides; the flavone hydroxylase PhF3′H is a polypeptide shown in SEQ ID NO: 2 or its conservative variant polypeptides.
[0079] As used herein, the 2-hydroxy flavanone compounds comprise 2-hydroxy flavanone or its derivatives, structural analogues and isomers. The C-glycoside-2-hydroxyflavanone compounds comprise C-glycoside-2-hydroxyflavanone or its derivatives, structural analogues and isomers. The flavone C-glycoside compounds comprise flavone C-glycoside or its derivatives, structural analogues and isomers.
[0080] In a preferable embodiment of the disclosure, the flavanone compounds comprise: naringenin, eriodictyol, pinocembrin, hesperidin, sakuranetin. In addition, their analogues or variants with substituted groups should also be included.
[0081] In a preferable embodiment of the disclosure, the 2-hydroxy flavanone compounds comprise: 2-hydroxynaringenin, 2-hydroxyeriodictyol; and/or the C-glycoside-2-hydroxy flavanone compounds comprise: 2-hydroxynaringenin-6-C(8-C)-glucoside, 2-hydroxyeriodictyol-6-C(8-C)-glucoside. In addition, their analogues or variants with substituted groups should also be included.
[0082] During the glycosylation of C-glycosides, UDP glucose can be used as the glycosyl donor. It should be understood that other compounds carrying active glycosyl groups can also be used as donors and should also be included in the present disclosure.
[0083] The present disclosure also provides a method for catalyzing C-2 position or C-3′ position hydroxylation of flavanone compounds, comprising: catalyzing with a novel flavone hydroxylase; wherein the novel flavone hydroxylase is a polypeptide shown in SEQ ID NO: 1 or a conservative variant polypeptide thereof, which catalyzes the C-2 hydroxylation of flavanone compounds; or wherein the novel flavone hydroxylase is a polypeptide shown in SEQ ID NO:2 or a conservative variant polypeptide thereof, which catalyzes the hydroxylation of flavanone compounds at the C-3′ position.
[0084] The present disclosure also provides a method of synthesizing flavone C-glycoside compounds, comprising: (1) catalyzing flavanone compounds by a novel flavone hydroxylase to induce hydroxylation at the C-2 position or C-3′ position; the novel flavone hydroxylase is a polypeptide shown in SEQ ID NO:1 or a conservative variant polypeptide thereof, which catalyzes the hydroxylation of flavanone compounds at the C-2 position; or, the novel flavone hydroxylase is a polypeptide shown in SEQ ID NO:2 or a conservative variant polypeptide thereof, which catalyzes hydroxylation of flavanone compounds at the C-3′ position; (2) the product of C-2 position hydroxylation of (1) is C-glycoside glycosylated to obtain C-glycoside-2-hydroxyflavanone compounds; or, the product of C-3′ position hydroxylation of (1) is further hydroxylated at the C-2 position, then C-glycoside glycosylated to obtain C-glycoside-2,3′-dihydroxy flavanone (class) compounds. Preferably, prior to catalyzation with the novel flavone hydroxylase, it further comprises: (b) a malonyl-CoA structural analogue and a p-coumaroyl-CoA structural analogue are catalyzed by chalcone synthase (CHS) and chalcone isomerase (CHI) to obtain flavanone (class) compounds. Preferably, prior to (b), it further comprises: (a) aromatic amino acids are catalyzed by tyrosine ammonia lyase (TAL), or phenylalanine ammonia lyase (PAL) and 4-coumaroyl-CoA ligase to obtain p-coumaroyl-CoA structural analogue.
[0085] In a preferable embodiment of the disclosure, the malonyl-CoA structural analogue comprises: malonyl-CoA, methylmalonyl-CoA; the p-coumaroyl-CoA structural analogue comprises: p-coumaroyl-CoA or p-cinnamyl-CoA; the L-tyrosine structural analogue comprises: L-tyrosine, L-phenylalanine. It should be understood that according to the overall description of the present disclosure, their analogues or variants can also be applied to the present disclosure.
[0086] In a preferable embodiment of the disclosure, the 2-hydroxy flavanone compound is 2-hydroxynaringenin, which is obtained from naringenin through flavanone-2-hydroxylase (F2H) catalysis; or the 2-hydroxy flavanone compound is 2-hydroxyeriodictyol, which is obtained from eriodictyol by flavanone-2-hydroxylase (F2H) catalysis; preferably, the eriodictyol is obtained from naringenin through flavanone-3′-hydroxylase (F3′H) catalysis. It should be understood that according to the overall description of the present disclosure, their analogues or variants can also be applied to the present disclosure.
[0087] The present disclosure also provides a method of biosynthesizing flavanone compounds, comprising: co-transferring precursor genes for the synthesis of flavanone compounds and genes encoding a novel flavone hydroxylase into host cells to obtain 2-hydroxyflavanone compounds and/or 3′-hydroxyflavanone compounds.
[0088] The present disclosure also provides a method of biosynthesizing flavone C-glycoside compounds, comprising: (i) co-transferring precursor genes for the synthesis of flavanone compounds, genes encoding novel flavone hydroxylases and genes encoding C-glycosyltransferases into host cells; wherein, the novel flavone hydroxylase is a polypeptide shown in SEQ ID NO: 1 or a conservative variant polypeptide thereof, which catalyzes the hydroxylation of flavanone compounds at the C-2 position; and/or, the novel flavone hydroxylase is a polypeptide shown in SEQ ID NO: 2 or a conservative variant polypeptide thereof, which catalyzes hydroxylation of flavanone compounds at the C-3′ position; (ii) culturing cells of (i), thereby biosynthesizing C-glycoside flavone compounds.
[0089] In specific embodiments of the present disclosure, the inventors found that the biosynthesis system of flavone C-glycoside compounds constructed by the present disclosure has very high product yield, that is, high-efficient biosynthesis is realized.
[0090] Compared with traditional plant extraction methods, microbial fermentation has several advantages, such as more fast extraction, less affection by external factors and so on. Also, the yield of some compounds synthesized by microorganisms is much higher than that of plant extraction. Microbial fermentation has become an important method of obtaining natural products. Due to the low natural abundance of flavone C-glycoside compounds and the coexistence with a large number of similar structural flavone glycosides and phenylpropanoids in plant extracts, isolation and purification of flavone C-glycoside compounds are cumbersome and complicated. In the present disclosure, the method of microbial fermentation is used to efficiently and directionally synthesize flavone C-glycoside compounds, which extremely effectively reduces the cost of isolation and purification of such compounds.
[0091] The present disclosure also provides a kit for biosynthesizing flavone C-glycoside compounds or intermediates thereof, wherein, it comprises: novel flavone hydroxylases shown in SEQ ID NO: 1-2 or conservative variant polypeptides thereof; C-glycosyltransferases; precursor genes for the synthesis of flavanone (class) compounds; preferably, it further comprises host cells. More preferably, the kit further comprises instructions of biosynthetic methods.
[0092] The Main Advantages of the Present Disclosure are:
[0093] After a large number of screenings, novel flavone hydroxylases PhF2H and PhF3′H have been obtained. They have functions of hydroxylating the C-2 or C-3′ positions of flavanone compounds, and their effects are better than that of OsF2H, OsF3′H with known functions. The inventor also optimized the two enzymes, which effectively improved their expression efficiency.
[0094] Using the novel flavone hydroxylase (especially optimized and modified) and other enzymes, with host cells modified by genetic engineering methods, engineering strains of high-yield flavone C-glycoside compounds such as oriention, isooriention, vitexin and isovitexin are obtained.
[0095] The disclosure if further illustrated by the specific examples described below. It should be understood that these examples are merely illustrative, and do not limit the scope of the present disclosure. The experimental methods without specifying the specific conditions in the following examples generally used the conventional conditions, such as those described in J. Sambrook, Molecular Cloning: A Laboratory Manual (3.sup.rd ed. Science Press, 2002) or followed the manufacturer's recommendation.
[0096] Experimental Materials
[0097] Phyllostachys edulis was collected from Shanghai Chenshan Botanical Garden, and rice, sorghum, and corn were all taken from Chinese Academy of Sciences (CAS) center for excellence in molecular plant sciences in Shanghai.
[0098] Oligonucleotide primers were purchased from Sangon Biotech and GenScript Biotech Corp.
[0099] The synthesized optimized sequence was purchased from GenScript Biotech Corp.
[0100] AxyPrep Total RNA Miniprep Kit, PCR Gel Extraction kit, Plasmid Extraction Kit are all from Axygen (American); PrimeScript RT reagent Kit with gDNA Eraser (Perfect Real Time), PrimeSTAR Max DNA Polymerase are from TAKARA. Blunt-end cloning was used by pEASY-Blunt Simple Cloning Kit (Beijing Quanshijin Biotechnology Co., Ltd.).
[0101] Plant genomic DNA extraction was used by TIANGEN Plant Genome Extraction Kit.
[0102] Restriction endonucleases are all from NEB.
[0103] E. coli DH10B, BL21(DE3) and pET21a, pET28a vectors were used for gene cloning and protein expression.
[0104] Naringenin, eriodictyol, oriention, isooriention, vitexin and isovitexin Standards were purchased from Dalian Meilun Biotechnology Co., Ltd.
[0105] Other reagents are analytical grade reagent or chromatographic grade reagent, purchased from Sinopharm Chemical Reagent Co., Ltd.
[0106] PCR was conducted on Arktik Thermal Cycler (Thermo Fisher Scientific).
[0107] Dionex UltiMate 3000 Liquid Chromatography System (Thermo Fisher Scientific) was used for HPLC.
[0108] HRMS was measured by the Thermo Fisher Scientific LTQ-Orbitrap combined with MS Q Exactive.
Example 1. Novel Cytochrome P450 Hydroxylase
[0109] In present disclosure, by mining the genomic information of Phyllostachys edulis, two novel cytochrome P450 hydroxylases were obtained, the amino acid sequences of which are as follows:
TABLE-US-00001 >PhF2H (SEQ ID NO: 1; underline is the N-terminal transmembrane region) MAMELVALVLAAMLLLTVIMRRYGGSAGSSKHGRLPPSPMALPFIGHLHL IRPPPHRAFDRIIARHGPLIYLRLGPSTHCVVVGSADVARDFLRFEASIP ERPLTAVTRQLAYGSAGFAFAPYGPHWRFMKRLCMSELLGPRTVEQLRPV RDAELAGVLRAVRAAAERGESVDMSRELIRMSNNAIMRMVASALPGDMAE AARDCAKQVAELVGAFNVEDYVAMCRGWDLQGIGRRTREVHARFDALLET MIRAKEEARRDPLPRDKSRTTKDLLDILMDVAEDEAAEVRLTRENIKAFV LDIFTAGSDTTATSVEWMLAELINHPAYLEKLRAEVDAVVGGSRLVGEPD VAQMPYLQAVLKETLRLRPPAVFAQRETIEAVHVCGYTIPPKTSVFFNIF SIGRDPACWEDPLEFRPERFMPGGASAGVDPKGQHQQLMPFGSGRRACPG MGLAMQAVPAFLAALVQCFDWAVPLPQGTPLDMEEAEGLVSARKQPLVLV PTQRLRPLPAGAAAALA* >PhF3′H (SEQ ID NO: 2; underline is the N-terminal transmembrane region) MGDVPLPLLLGSLAVSALVWYVLFRRGGGEGAKRPPGPRGWPVLGNLPQL GAKPHHTMCAMAREYGPLFRLRFGSAEVVVAASAGVAAQFLRGLDANFSN RPPNSGAEHVAYNYQDLVFAPYGARWRALRKLCALHLFSAKALDDLRAVR EGEVALLVRELARAAAGGVPAVALGQEANVTATNTLARATVGRRVFAVDG GEGAREFKEMVVELMQLAGVFNVGDFVPALRWLDPQGVVAKMKRLHRRYD DMLNGFIKERKAVVKPDGLSGGDQGKDLLSVLLARMREEQPLDGEDGKIT ETDIKALLLNLFTAGTDTTSSTVEWALAELIRHPDVLKQAQHELDAVAGR DRLVSESDLPRLTFLAAVIKETFRLHPSTPLSLPRVAAEECTVDGYRVPK GTTLLVNVWAIARDPASWPNPLDFNPARFLPGGTHESVDLKGSDFELIPF GAGRRVCAGLSWGLRMVTLMTATLVHAFDWALVDGMTPDKLNMEEAYGLT LQRAVPLMVQPAPRLLPSAYGM*
[0110] The above two novel cytoc rome y roxy ases were use to perform in vivo functional verification based on a recombinant microbial system in the subsequent Examples 2 and 3.
Example 2. Production of 2-Hydroxynaringenin by Using Cytochrome P450 Hydroxylase PhF2H
[0111] In this example, predicted biosynthetic pathway of 2-hydroxynaringenin is shown in
[0112] 1. Construction of a Plasmid for De Novo Synthesis of Naringenin
[0113] The artificially synthesized and codon-optimized (E. coli preference) precursor gene sequence was constructed into the pET28a vector to obtain pET28-RtPAL, pET28-Pc4CL, pET28-PxhCHS and pET28a-MsCHI, respectively. Among them, PxhCHS: GenBank Accession No. KF765781; MsCHJ: GenBank Accession No. KF765782; Pc4CL: GenBank Accession No. KF765780; RtPAL: GenBank Accession No. AAA33883. PCR primers are shown in Table 1.
[0114] Pc4CL fragment was amplified using pET28-Pc4CL as template and 4CL-F-NcoI/4CL-R-BamHI as primers. pYH40 was obtained by ligation of the amplified products with NcoI/BamHI digested pCDFDuet-1.
[0115] PxhCHS fragment was amplified using pET28-PxhCHS as template and CHS-F-NdeI/CHS-R-XhoI as primers. pYH50 was obtained by ligation of the amplified products with NdeI/XhoI digested pYH40.
[0116] McCHI fragment was amplified using pET28-MsCHI as template and T7CHI—F-XhoI/CHI-R-AvrII as primers. pYH51 was obtained by ligation of the amplified products with XhoI/AvrII digested pYH50.
[0117] RtPAL fragment was amplified using pET28-RtPAL as template and T7PAL-F-BamHI/PAL-R-HindIII as primers. pYH55 obtained by ligation of the amplified products with BamHI/HindIII digested pYH51 was used to de novo synthesis of naringenin.
TABLE-US-00002 TABLE 1 Primers used in the construction of expression cassettes with precursor genes for the synthesis of naringenin Primers Sequences (5′.fwdarw.3′) 4CL-F-NcoI tataccatgggtgactgcgttgccccg (SEQ ID NO: 3) 4CL-R-BamHI cgggatccttacttcggcaggtcgccgctc (SEQ ID NO: 4) T7PAL-F-BamHI cgggatcccttatgcgactcctgcattag (SEQ ID NO: 5) PAL-R-HindIII gcccaagcttttatgccagcatcttc (SEQ ID NO: 6) CHS-F-NdeI agatatacatatggttacggtggaagaatac (SEQ ID NO: 7) CHS-R-XhoI ccgctcgagttaggtagccacactatgcag (SEQ ID NO: 8) T7CHI-F-XhoI ccgctcgagctagaaataattttgtttaac (SEQ ID NO: 9) CHI-R-AvrII gagcctaggttagttaccgattttaaag (SEQ ID NO: 10)
[0118] 2. Optimization of PhF2H Polypeptide Sequence and Construction of PhF2H/CPR Expression Cassette
[0119] Codon optimized coding gene (E. coli preference) of flavanone-2-hydroxylase PhF2H is suitable for the expression in E. coli. The codon-optimized sequence of PhF2H was modified at the N-terminal of the protein by truncating the N-terminal transmembrane region (positions 2-24), and adding a 2B1 tag (MAKKTSSKGKLPPGPS) before the first amino acid M. This fragment was cloned into the blunt-ended pEASY-Blunt Simple Cloning Vector.
[0120] A primer pair CZ277-F/CZ277-R (see Table 2) was used to amplify the optimized PhF2H fragment. The fragment was inserted into the site between NcoI and BamHI in the multiple cloning site 1 of the pDuet-1 vector by seamless cloning. AtCPR2 (GenBank Accession No. NM_179141.2) was amplified using primer pair InfuNde-AtCPR2-F/InfuXho-AtCPR2-R (see Table 2), then was inserted into the site between NdeI and XhoI in the multiple cloning site 2 of the pDuet-1 vector. Therefore, pCZ277 was constructed (
[0121] In addition, as a positive control, rice OsF2H (GenBank Accession No. XP_015642954.1, optimized for E. coli preferred codons) was truncated at the N-terminal transmembrane region (positions 2-26), with a 2B1 tag added before the first amino acid M. pCZ203 was constituted by linking the optimized OsF2H and AtCPR2 into the pDuet-1 vector in the same way (
TABLE-US-00003 TABLE 2 Primers used in the construction of pCZ203 and pCZ277 Gene Primers Sequences (5′.fwdarw.3′) OsF2H CZ203-F ctcccaccaggacctagcatgcgtagcgcgggta gccg (SEQ ID NO: 11) CZ203-R tcgaattcggatccactagtttagctataaaagc tcggcagcg (SEQ ID NO: 12) PhF2H CZ277-F agctcccaccaggacctagcatgggcagcgcggg (SEQ ID NO: 13) CZ277-R tcgaattcggatccactagtttacgccagcgccg (SEQ ID NO: 14) AtCPR2 InfuNde- ataagaaggagatatacatatgtcctcttcttct AtCP tcttcgtcaacc R2-F (SEQ ID NO: 15) InfuXho- ttctttaccagactcgagttaccatacatctcta AtC agatatcttccactcgtttgc PR2-R (SEQ ID NO: 16)
[0122] 3. Construction of 2-Hydroxynaringenin Producing Strain
[0123] Successfully constructed pCZ203 and pCZ277 were co-transformed with plasmid pYH55 into competent cells of E. coli BL21 (DE3) to obtain engineered strains, named sSYW80 and sSYW81, respectively.
[0124] The cells were cultured in LB solid medium (containing 100 μg/mL ampicillin, 80 g/mL spectinomycin) overnight at 37° C. Single colony of sSYW80 and sSYW81 was transferred to a 2 mL LB liquid medium (containing 100 μg/mL ampicillin, 80 μg/mL spectinomycin) and incubated overnight. The bacterial fluid was transferred to a new 20 mL MOPS liquid medium with antibiotics and incubated at 37° C. and 250 r/min until OD.sub.600 reached 0.5-0.6. The culture was cooled down to 16° C., in a water bath, then IPTG inducer was added at a final concentration of 0.1 mM, and 2 g/L sterilized tyrosine was added. The mixture was placed at 22° C. and cultured for 120 h at 220 r/min on the shaker. After completion of the fermentation reaction, 0.5 mL of the fermentation broth was taken out and was mixed with 0.5 mL ethyl acetate, the solution was extracted for 3 times. The organic phase was concentrated, and the resulting residue was dissolved with 100 μL of methanol, wherein 20 μL was used for HPLC analysis.
[0125] It was detected that the reaction solution contains 2-hydroxynaringenin and unconverted naringenin, as shown in
Example 3. Cytochrome P450 Hydroxylase (F2H) Combined with C-Glycosyltransferase to Produce Vitexin, Isovitexin and their Intermediates
[0126] In this example, biosynthetic pathway of glycosylated vitexin, isovitexin, and 2-hydroxynaringenin is shown in
[0127] 1. Construction of a Plasmid for De Novo Synthetic Naringenin
[0128] The same as in Example 2.
[0129] 2. Construction of Optimized F2H/CPR Expression Cassette
[0130] The same as in Example 2.
[0131] 3. Construction of Engineered Strains and Fermentation to Produce Vitexin, Isovitexin and their Intermediates.
[0132] Construction of plasmid pCZ86 for the glycosylation: target gene PhCGT1 was amplified using Phyllostachys edulis genomic DNA as template and Primestar max DNA polymerase as PCR enzyme (primer F: tgccgcgcggcagccatatgatgggccacctggtgc (SEQ ID NO: 17); primer R: tggtgctcgagtgcggccgcctagtccaacactgcaagatccc (SEQ ID NO: 18)). The amplified target band was purified and recovered by agarose gel electrophoresis. pET28a was digested with two restriction endonucleases, NdeI/NotI, and the PCR target gene PhCGT1 was cloned into the NdeI/NotI site of pET28a by seamless cloning to obtain pCZ86.
[0133] Successfully constructed pCZ203 and pCZ277 were co-transformed with plasmid pYH86 into competent cells of E. coli BL21 (DE3) to obtain engineered strains, named sCZ4 and sCZ89, respectively.
[0134] The cells were cultured in LB solid medium (containing 100 μg/mL ampicillin, 50 μg/mL Kanamycin and 80 μg/mL spectinomycin) overnight at 37° C. Single colony was transferred to a 2 mL LB liquid medium (containing 100 μg/mL ampicillin, 50 μg/mL kanamycin and 80 μg/mL spectinomycin) and incubated overnight. The bacterial fluid was transferred to a new 20 mL MOPS liquid medium with antibiotics and incubated at 37° C. and 250 r/min until OD.sub.600 reached 0.5-0.6. The culture was cooled down to 16° C., in a water bath, then IPTG inducer was added at a final concentration of 0.1 mM, and 2 g/L sterilized tyrosine was added. The mixture was placed at 22° C. and cultured for 120 h at 220 r/min on the shaker. After completion of the fermentation reaction, 0.5 mL of the fermentation broth was taken out and was mixed with 0.5 mL n-butanol, the solution was extracted for 3 times. The organic phase was concentrated, and the resulting residue was dissolved with 100 μL of methanol, wherein 20 μL was used for HPLC analysis.
[0135] It was detected that the reaction solution contains vitexin, isovitexin and 2-hydroxynaringenin-C-glucoside, as shown in
Example 4. Using Cytochrome P450 Hydroxylase F3′H to Produce Eriodictyol
[0136] In this example, predicted biosynthetic pathway of eriodictyol is shown in
[0137] 1. Construction of a Plasmid for De Novo Synthetic Naringenin
[0138] The same as in Example 2.
[0139] 2. Optimization of PhF3′H and Construction of PhF3′H/CPR Expression Cassette
[0140] Codon optimized coding gene (E. coli preference) of flavanone-3′-hydroxylase PhF3′H is suitable for use in E. coli. The codon-optimized sequence of PhF3′H was modified at the N-terminal of the protein by truncating the N-terminal transmembrane region (positions 2-24), and adding a 2B1 tag (MAKKTSSKGKLPPGPS(SEQ ID NO: 19)) before the first amino acid M. This fragment was cloned into the blunt-ended pEASY-Blunt Simple Cloning Vector.
[0141] Using CZ285-F/CZ285-R as a primer pair (see Table 3), the optimized PhF3′H fragment was amplified by PCR. The amplified fragment was inserted into the site between NcoI and BamHI in the multiple cloning site 1 of the pDuet-1 vector by seamless cloning. AtCPR2 was amplified using primer pair InfuNde-AtCPR2-F/InfuXho-AtCPR2-R (see Table 2), then inserted into the site between NdeI and XhoI in the multiple cloning site 2 of pDuet-1 vector. Therefore, pCZ285 was constructed (
[0142] As a positive control, rice OsF3′H (GenBank Accession No. XP_015613041.1, optimized for E. coli preferred codons for E. coli) was truncated at the N-terminal transmembrane region (positions 2-26), with a 2B1 tag added before the first amino acid M. pCZ257 was constituted by linking the optimized OsF3′H and AtCPR2 into the pDuet-1 vector in the same way (
TABLE-US-00004 TABLE 3 Primers used in the construction of pCZ285 and pCZ257 Gene Primers Sequences (5′.fwdarw.3′) PhF3′H CZ285-F agctcccaccaggacctagcatgcgtcgtggtg gggtgac (SEQ ID NO: 20) CZ285-R gagctcgaattcggatccactagtttacatacc atacgcgctcggc (SEQ ID NO: 21) OsF3′H CZ257-F agctcccaccaggacctagcatgctgcgtggtg gcag (SEQ ID NO: 22) CZ257-R gagctcgaattcggatccactagtttaaacgcc atacgcgctcg (SEQ ID NO: 23)
[0143] 3. Construction of Eriodictyol Producing Strain
[0144] Successfully constructed pCZ257 and pCZ285 were co-transformed with plasmid pYH55 into competent cells of E. coli BL21 (DE3) to obtain engineered strains, named sCZ51 and sCZ97, respectively.
[0145] The cells were cultured in LB solid medium (containing 100 μg/mL ampicillin and 80 μg/mL spectinomycin) overnight at 37° C. Single colony of sCZ51 and sCZ97 was transferred to a 2 mL LB liquid medium (containing 100 μg/mL ampicillin and 80 μg/mL spectinomycin) and incubated overnight. The bacterial fluid was transferred to a new 20 mL MOPS liquid medium with antibiotics and incubated at 37° C. and 250 r/min until OD.sub.600 reached 0.5-0.6. The culture was cooled down to 16° C., in a water bath, then IPTG inducer was added at a final concentration of 0.1 mM, and 2 g/L sterilized tyrosine was added. The mixture was placed at 22° C. and cultured for 120 h at 220 r/min on the shaker. After completion of the fermentation reaction, 0.5 mL of the fermentation broth was taken out and was mixed with 0.5 mL ethyl acetate, the solution was extracted for 3 times. The organic phase was concentrated, and the resulting residue was dissolved with 100 μL of methanol, wherein 20 μL was used for HPLC analysis.
[0146] As shown in
Example 5. Cytochrome P450 Hydroxylase (F3′H) Combined with C-Glycosyltransferase to Produce Oriention, Isooriention and their Intermediates
[0147] In this example, predicted biosynthetic pathway of glycosylated oriention, isooriention and 2-hydroxyeriodictyol is shown in
[0148] 1. Construction of a Plasmid for De Novo Synthetic Naringenin
[0149] The same as in Example 2.
[0150] 2. Construction of optimized F2H/F3′H/CPR binary P450 expression cassette
[0151] After pCZ277 Digested by BamHI/NotI, PhF3′H-CPR Fragment was Amplified by PCR using pCZ285 as templates and SYW100-F/SYW100-R as primers. pSYW100 (containing PhF2H/PhF3′H binary P450 expression cassette) was constructed into the BamHI and NotI sites of pCZ277 by one-step cloning method.
[0152] As a positive control, after pCZ203 digested by BamHI/NotI in the same way, OsF3′H-CPR fragment was amplified by PCR using pCZ257 as templates and SYW101-F/SYW101-R as primers. pSYW101 (containing OsF2H/OsF3′H binary P450 expression cassette) was constructed into the BamHI and NotI sites of pCZ203 by one-step cloning method.
TABLE-US-00005 TABLE 4 Primers used in the construction of pSYW100 and pSYW101. Gene Primers Sequence (5′.fwdarw.3′) (SEQ ID NO:) PhF3′H SYW100-F ggcgtaaactagtggatccctctagaaataattt tgtttaactttaagaaggagatataccatg (SEQ ID NO: 24) SYW100-R cttaagcattatgcggccttacataccatacgcg ctcggc (SEQ ID NO: 25) OsF3′H SYW101-F tagctaaactagtggatccctctagaaataattt tgtttaactttaagaaggagatataccatg (SEQ ID NO: 26) SYW101-R cttaagcattatgcggccttaaacgccatacgcg ctcg (SEQ ID NO: 27)
[0153] 3. Construction of Engineered Strains and Fermentation to Produce Oriention, Isooriention and their Intermediates
[0154] The construction plasmid pCZ86 for the glycosylation was the same as in Example 3.
[0155] Successfully constructed pSYW100 and pSYW101 were co-transformed with plasmid pYH55 and plasmid pCZ86 into competent cells of E. coli BL21 (DE3) to obtain engineered strains, named sSYW82 and sSYW83, respectively.
[0156] The cells were cultured in LB solid medium (containing 80 μg/mL spectinomycin, 100 μg/mL ampicillin and 50 μg/mL kanamycin) overnight at 37° C. Single colony was transferred to a 2 mL LB liquid medium (containing 80 μg/mL spectinomycin, 100 μg/mL ampicillin and 50 μg/mL kanamycin) and incubated overnight. The bacterial fluid was transferred to a new 20 mL MOPS liquid medium with antibiotics and incubated at 37° C. and 250 r/min until OD.sub.600 reached 0.5-0.6. The culture was cooled down to 16° C., in a water bath, then IPTG inducer was added at a final concentration of 0.1 mM, and 2 g/L sterilized tyrosine was added. The mixture was placed at 22° C. and cultured for 120 h at 220 r/min on the shaker. After completion of the fermentation reaction, 0.5 mL of the fermentation broth was taken out and was mixed with 0.5 mL n-butanol, the solution was extracted for 3 times. The organic phase was concentrated, and the resulting residue was dissolved with 100 μL of methanol, wherein 20 μL was used for HPLC analysis. The amounts of various products detected in the fermentation broth are shown in the Right panel of
[0157] As shown in
[0158] Each reference provided herein is incorporated by reference to the same extent as if each reference was individually incorporated by reference. In addition, it should be understood that based on the above teaching content of the disclosure, those skilled in the art can practice various changes or modifications to the disclosure, and these equivalent forms also fall within the scope of the appended claims.