METHOD FOR TREATMENT OR PREVENTION OF A CANCER
20180177845 ยท 2018-06-28
Inventors
Cpc classification
C07K2317/76
CHEMISTRY; METALLURGY
C12N2740/16043
CHEMISTRY; METALLURGY
C07K2317/34
CHEMISTRY; METALLURGY
C12Y207/10002
CHEMISTRY; METALLURGY
A61K48/00
HUMAN NECESSITIES
C07K16/44
CHEMISTRY; METALLURGY
International classification
C07K16/28
CHEMISTRY; METALLURGY
C07K16/44
CHEMISTRY; METALLURGY
Abstract
The present invention is related to a method or a pharmaceutical composition for treatment or prevention of a cancer through blocking the interaction of 4 integrin and focal adhesion kinase (FAK).
Claims
1. A method for treatment or prevention of a cancer, comprising administering to a subject in need thereof an agent or a molecule effective to block the binding of 4 integrin and focal adhesion kinase (FAK).
2. The method of claim 1, wherein the cancer is a cancer in association of regulation of epidermal growth factor (EGF) receptor.
3. The method of claim 2, wherein the cancer is breast cancer, colon cancer, skin cancer, lung cancer or stomach, cancer.
4. The method of claim 1, wherein the agent or molecule is selected from the group consisting of: (1) a peptide derived from FAK, containing at least Glu.sup.380-Lys.sup.381-Gln.sup.382 of SEQ ID NO: 1 (FAK/3aa), or a mimetic peptide thereof; (2) a peptide derived from 4 integrin; (3) an agent for gene therapy, which is a polynucleotide coding for an amino acid fragment of FAK containing at least FAK/3aa (SEQ ID NO: 1); (4) an antibody which is generated against a peptide derived from FAK, containing at least FAK/3aa (SEQ ID NO: 1); or an antibody which is generated against a peptide derived from 4 integrin; and (5) a compound which blocks the binding of 4 integrin and focal adhesion kinase (FAK).
5. The method of claim 1, wherein the molecule is FAK/3aa having the amino acid sequence of SEQ ID NO: 1, FAK/11aa having the amino acid sequence SEQ Ili NO; 2, FAK/25aa having the amino acid sequence SEQ ID NO: 3 or the full length of the amino acids of FAK having the amino acid sequence of SEQ ID NO: 4.
6. The method of claim 5, wherein the molecule is FAK/3aa having the amino acid sequence of SEQ ID NO: 1.
7. The method of claim 5, wherein the molecule is FAK/11 aa having the amino acid sequence SEQ ID NO: 2,
8. The method of claim 5, wherein the molecule is FAK/25aa having the amino acid sequence SEQ ID NO: 3.
9. The method of claim 3, wherein the peptide derived from of 4 integrin is cytodomain of 4 integrin having the amino acid sequence of SEQ ID NO: 5.
10. The method of claim 3, wherein the agent for gene therapy is a 9-nucleotide molecule coding for FAK/3aa, having the nucleotide sequence of SEQ ID NO: 6, a 33-nucleotide moledule coding for FAK/11aa, having the nucleotide sequence of SEQ ID NO: 7, or a 75-nucleotide molecule coding for FAK/25aa, having the nucleotide sequence of SEQ ID NO: 8.
11. The method of claim 3, wherein the antibody is an antibody against FAK/3aa having the amino acid sequence of SEQ ID NO: 1, FAK/11aa having the amino acid sequence of SEQ ID NO; 2, FAK/25aa having the amino acid sequence of SEQ ID NO: 3 or FAK/400aa having the amino acid sequence of SEQ ID NO: 4.
12. The method of claim 3, wherein the antibody is an antibody against cytodoinain of 4 integrin having the amino acid sequence of SEQ ID NO: 5.
13. A pharmaceutical composition for treatment or prevention of a cancer comprising an agent effective to block the binding of 4 integrin and focal adhesion kinase (FAK) and a pharmaceutically acceptable carrier.
14. The pharmaceutical composition of claim 13, wherein the cancer is a cancer in association of regulation of epidermal growth factor (EGF) receptor.
15. The pharmaceutical composition of claim 13, wherein the agent or molecule is selected from the group consisting of: (1) a peptide derived from FAK, containing at least Glu.sup.380-Lys.sup.381-Gln.sup.382 of SEQ ID NO: 1 (FAK/3aa), or a mimetic peptide thereof; (2) a peptide derived from 4 integrin; (3) an agent for gene therapy, which is a polynucleotide coding for an amino acid fragment of FAK containing at least FAK/3aa (SEQ ID NO: 1); (4) an antibody which is generated against a peptide derived from FAK, containing at least FAK/3aa (SEQ ID NO: 1); or an antibody which is generated against a peptide derived from 4 integrin: and (5) a compound which blocks the binding of 34 integrin and focal adhesion kinase (FAK).
16. The pharmaceutical composition of claim 13, wherein the molecule is FAK/3aa having the amino acid sequence of SEQ ID NO; 1, FAK/11aa having the amino acid sequence SEQ ID NO: 2, FAK/25aa having the amino acid sequence SEQ ID NO: 3 or the full length of the rlino acids of FAK having the amino acid sequence of SEQ ID NO: 4.
17. The pharmaceutical composition of claim 16, wherein the molecule is FAK/3aa having the amino acid sequence of SEQ ID NO: 1,
18. The pharmaceutical composition of claim 16, wherein the molecule is FAK/11aa having the amino acid sequence SEQ ID NO: 2.
19. The pharmaceutical composition of claim 16, wherein the molecule is FAK/25aa having the amino acid sequence SEQ ID NO: 3.
20. The pharmaceutical composition of claim 13, wherein the peptide derived from of 4 integrin is cytodomain of 4 integrin having the amino acid sequence of SEQ ID NO: 5.
21. The pharmaceutical composition of claim 13, wherein the agent for gene therapy is a 9-nucleotide molecule coding for FAK/3aa, having the nucleotide sequence of SEQ ID NO: 6, a 33-nucleotide moledule coding for FAK/11aa, having the nucleotide sequence of SEQ ID NO: 7, or a 75-nucleotide molecule coding for FAK/25aa, having the nucleotide sequence of SEQ ID NO: 8.
22. The pharmaceutical composition of claim 13, wherein the antibody is an antibody against FAK/3aa having the amino acid sequence of SEQ ID NO: 1, FAK/11aa having the amino acid sequence of SEQ ID NO: 2, FAK/25aa having the amino acid, sequence of SEQ ID NO: 3 or FAK/400aa having the amino acid sequence of SEQ ID NO: 4.
23. The pharmaceutical composition of claim 13, wherein the antibody is an antibody against cytodomain of 4 integem having the amino acid sequence of SEQ ID NO: 5.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0019] The drawings presenting the preferred embodiments of the present invention are aimed at explaining the present invention. It should be understood that the present invention is not limited to the preferred embodiments shown.
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
DETAILED DESCRIPTION OF THE INVENTION
[0034] Unless defined otherwise, all technical and scientific terms used herein have the same meanings as commonly understood by one of skill in the art to which this invention belongs.
[0035] Unless clearly specified herein, meanings of the articles a, an, and said all include the plural form of more than one. Therefore, for example, when the term a component is used, it includes multiple said components and equivalents known to those of common knowledge in said field.
[0036] As used herein, the term subject refers to a human or a mammal, such as a patient, a companion animal (e.g., dog, cat, and the like), a farm animal (e.g., cow, sheep, pig. horse, and the like) or a laboratory animal (eg., rat, mouse, rabbit, and the like).
[0037] The term carrier or pharmaceutically acceptable carrier used herein includes, but not limited to, pharmaceutically acceptable excipients, fillers, diluents, or the like, including those well known to one of ordinary skills in the pharmaceutical field.
[0038] In the invention, it was investigated that the EGFR/Src signaling-regulated 4 integrin/FAK complex is involved in cancer malignancy. In light of 4 integrin-mediated FAK activation and signaling involved in tumor progression, the clinicopathological correlation between 4 integrin and FAK signaling and human cancer were clarified. Subsequently, the mechanistic details of FAK activation via 4 integrity leading to malignant progression of a cancer were explored.
[0039] The present invention provides a method for treatment or prevention of a cancer, comprising administering to a subject in need thereof an agent at the amount effective to block the interaction of 4 integrin and Focal adhesion kinase (FAK).
[0040] On the other hand, the present invention provides a use of an, agent or a molecule effective to block the, binding of 4 integrin and focal adhesion kinase (FAX) for manufacturing a medicament for treating or preventing a cancer.
[0041] The present invention also provides a pharmaceutical composition comprising an agent at the amount effective to block the interaction of 4 integrin and focal adhesion kinase (FAK) and a pharmaceutically acceptable carrier.
[0042] According to the invention, the cancer is a cancer in association of regulation of epidermal growth factor (EGF) receptor. Examples of the cancer include but are not limited to breast cancer, colon cancer, skin cancer, lung cancer and stomach cancer.
[0043] In the present invention, it is unexpectedly found that the 380th, 381th and 382th residues (i.e., the Glu.sup.380, Lys.sup.381 and Gln.sup.382 amino acids) out from the amino acids of FAK is critically involved in the interaction of FAK and 4 integrin by using a site-directed mutagenesis approach to convert individual amino acids into alanine.
[0044] Accordingly, the present invention provides an agent for treatment or prevention of a cancer, which is selected from the group consisting of [0045] (1) a peptide derived from FAK, containing at least Glu.sup.380-Lys.sup.381-Gln382, or a mimetic peptide thereof; such as FAK/3aa (the 380.sup.th to 382.sup.th amino acids of FAK, SEQ ID NO: 1), FAK/I11aa (the 376.sup.th to 386.sup.th amino acids of FAK, SEQ ID NO: 2), FAK/25aa (the 376.sup.th to 400.sup.th amino acids of FAK, SEQ ID NO: 3) or the full length of the amino acids of FAK (FAK/400aa, SEQ ID NO: 4); [0046] (2) a peptide derived from of 4 integrin, e.g., cytodomain of 4 integrin (the 796.sup.th to the 1190.sup.th amino acids of 4 integrin, SEQ ID NO: 5); [0047] (3) an agent for gene therapy, which is a polynucleotide coding for an amino acid fragment of FAK containing at least FAK/3aa, such as a 9-nucleotide molecule (a molecule containing 9 nucleotides coding for coding for FAK/11aa (SEQ ID NO: 6), a 33-nucleotide moledule coding for FAK/11aa (SEQ ID NO: 7) or a 75-nucleotide molecule coding for FAK/25aa (SEQ ID NO: 8); [0048] (4) an antibody against a peptide derived from FAK, containing at least Glu.sup.380-Lys.sup.381-Gln.sup.382, such as FAK/3aa (SEQ ID NO: 1), FAK/11aa (SEQ ID NO: 2), FAK/25aa (SEQ ID NO: 3) or FAK/400aa (SEQ ID NO: 4); or an antibody which is generated against a peptide derived from cytodomain of 4 integrin, e.g., cytodornain (the 796.sup.th to the 1190.sup.th amino acids, SEQ ID NO: 5) of 4 integrin; or [0049] (5) a compound which blocks the binding of 4 integrin and focal adhesion kinase (FAK).
[0050] The present invention is explained in the above description of the invention and the following examples, which should not be used to restrict the scope of the present invention.
EXAMPLES
[0051] 1. Materials and Reagents
[0052] 1.1 Preparation of Plasmid DNA Construction
[0053] Full-length FAK and its various mutants, including FRNK, FAK/N375 (the first 375 amino acids), FAK/M386 (the first 386 amino acids). FAK/N400 (the first 400 amino acids), and FAK/25aa (a motif from the 375 to the 400 amino acid) were cloned, into pcDNA-3.1-Myc/6xHis, pDH-GST, and pEGFP, pHAN or pKH3 vectors to generate different tagged fusion proteins. pGEX-2T was employed to generate bacterial expression FAK constructs for GST-FAK recombinant protein purifications. The point mutants (i.e. FAKE380A/K381A/Q382A or FAKR385A/S386A) within the identified 25-amino acid motif (from amino acid 375 to amino acid 400) of FAK were generated by the overlapping PCR mutagenesis approach. The pcDNA3.1-Zeo-4 integrin plasmid was used as a template to generate various 4 integrin mutants. In general, DNA subcloning and PCR were used to generate pcDNA-3.1-Myc/6xHis-4 integrin, pKH3-4/cytodomain (the 796.sup.th to 1190.sup.th amino acid), pKH3-4 Na.sup.+/Ca.sup.2+ exchanger homologous motif (4-CalX) and CalX-deleted (4-deCalX) constructs for mammalian cell expression. All resulting constructs were confirmed by sequencing.
[0054] 1.2 Antibodies and Reagents
[0055] Anti-FAK (C20), anti-Myc (9E10), anti-HA (12CA5), anti-GFP (B2), anti-4 integrin (H101), and anti-tubulin were purchased from Santa Cruz Biotechnology (Santa Cruz, Calif., USA). Anti-SAPK/JNK, anti-phospho-SAPK/JNK (Thr183/Tyr185), anti-ERK1/2, ant i-phospho-ERK (pT202/pY204), anti-p38 MAPK (N20), anti-phospho-p38 MAPK (Thr180/Tyr182), anti-AKT, and anti-phospho-AKT (S473) antibodies were obtained from Cell Signaling (Danvers, Mass.). Additionally, anti-phospho-FAK (Y397) antibody was from Invitrogen, anti-GST antibody was from Upstate (Charlottesville, Va.), and anti-phospho-paxillin (Tyr118) and anti-paxillin antibodies were from BD (Becton, Dickinson and Company). The FAX inhibitor PF-573,228 was purchased from Tocris Bioscience (Ellisville, Mo.).
[0056] 2. Statistical Analysis
[0057] Student's t-test was used for statistical analyses. The data in this study are presented as the mean and error bars represent the standard deviation. The data were acquired from at least three independent experiments. *, p<0.05 was considered significant differences among the experimental groups. Spearman's correlation test was used to assess the relationship between X34 integrin and FAK.
[0058] 3 Experiment on the Contribution to Malignancy of Breast Cancer
[0059] 3.1 Samples and Methods
[0060] 3,1.1 Human Tissue Samples
[0061] A tissue microarray containing 48 paraffin-embedded human triple-negative breast cancer samples (BRC964) was purchased from Pantomics, Inc. (Richmond, Calif.). The surgical specimens of primary cancerous breast tissues and surrounding non-cancerous breast tissues that were used for Western blotting and immunoprecipitation analysis were obtained from four patients who were not given preoperative chemotherapy and who had undergone resection with curative intent between September 2010 and December 2013 at National Taiwan University Hospital (Taipei, Taiwan). All tissues were collected with informed consent according to the Institutional Review Board of National Taiwan. University Hospital (Taipei, Taiwan). All experimental protocols in this study were approved by the National Taiwan University Hospital Research Ethics Committee and were carried out in accordance with the Institutional Review Board of National Taiwan University Hospital (Taipei, Taiwan).
[0062] 3.1,2 lanniunohistochemical Analysis
[0063] Paraffin embedded human cancer samples were sectioned and stained after antigen retrieval using primary antibodies against FAK (C20, 1:200) and integrin (H101, 1:200), followed by a biotinylated and peroxidase-conjugated secondary antibody. The sections were processed by using a DAB immunostaining assay kit (DAKO, Glostrup, Denmark) according to the manufacturer's instructions. The samples were further counterstained with hematoxylin before mounting on coverslips. They were then examined under a fluorescence microscope (Model M1, Zeiss, Germany) with a 10 or 40+ objective lens, and the images were captured using a CCD camera (DP7I, Olympus, Japan). The level of staining was scored by Quick-score (Q-score) method based on the staining intensity and the percentage of tumor cells with positive staining. The staining intensity was scored as 0, 1, 2, or 3 corresponding to negative, weak, moderate, or strong, respectively. The percentage of tumor cells positively stained was scored as 0, 1, 2, 3, or 4 corresponding to 0% 1-25%, 26-50%, 51-75%, or 76-100%, respectively. The Q-score of each tissue sample was the sum of the staining intensity and the percentage of tumor cells with positive staining. The score range was from 0 to 7. A Q-score >2 was defined as overexpressed or positive expression, and a Q-score <2 was defined as normal or negative expression.
[0064] 3.1.3 Cell Culture and Transfection
[0065] MCF7 human breast cancer, MDA-MB-231 human breast cancer, MDA-MB-435 human melanoma, and 293T human epithelial kidney cell lines were maintained in Dulbecco's modified Eagle's medium (DMEM) supplemented with 10% fetal bovine serum (FBS) (Invitrogen). MCF10A normal mammary epithelial cells were cultured in Medium-171 containing MEDS (Life Technologies). Mouse fibroblast NIH3T3 cells were cultured in DMEM medium containing 10% calf serum (Invitrogen). All cells were incubated in a 37 C. humidified 5% CO.sub.2 incubator. Cells were transfected with mammalian expression plasmids, as indicated, using Lipofectamine 2000 transfection reagent (Invitrogen) according to the manufacturer's instructions. Experiments were conducted 24-48 h after transfection.
[0066] 3.1.4 Immunofluorescence Staining 100571 The cells were processed for immunofluorescence staining. In the EGF-stimulated condition, cells were treated with 10 ng/ml EGF for 10 min after overnight serum starvation. The primary antibodies used were polyclonal anti-FAK (C20, 1:200) and monoclonal anti-4 integrin (3E1, 1:200). Alexa Fluor 488-conjugated goat anti-rabbit IgG and Texas Red-conjugated goat anti-mouse IgG were used as the secondary antibodies. Cell nuclei were stained with DAPI for 5 min at RT. Cells were then mounted using a SlowFade Light Antifade Kit (Molecular Probes, Inc.) and examined under a confocal laser scanning microscope (LSM 780, ZEISS) with a 63 objective lens.
[0067] 3.1.5 Western Blotting and Immunoprecipitation
[0068] Various plasmid-transfected or pharmacologically treated cells or tissue samples were homogenized and extracted for Western blot analyses. About 10-20 g whole cell lysate were used for Western blotting. A 1 mg/ml concentration of total protein from cell lysates was employed for immunoprecipitation. Some extracts subjected to immunoprecipitation were incubated with antibodies, as indicated, for 4 h at 4 C., followed by incubation for 4 h or overnight with protein A-Sepharose 4B or protein G-Sepharose beads (Sigma-Aldrich) before proceeding to Western blot analysis. Each experiment was repeated at least three independent times.
[0069] 3.1.6 Preparation of Recombinant Fusion Proteins
[0070] The constructs were transformed into a BL21 strain and grown at 37 C. until at an optical density at 600 nm of 0.6. They were then induced with 1 mM isopropyl--thiogalactopyranoside overnight at 26 C. Subsequently, cells were pelleted and resuspended with PBS following sonication with a Misonix sonicator 3000. Then, Triton X-100 (1%) was added and cells were incubated on ice for 1 h. The lysates were clarified by centrifugation and then immobilized on GST-agarose beads (Sigma-Aldrich) or Nickel-nitrilotriacetic agarose (Ni-NTA. Qiagen) for 6 h at 4 C. Finally, the beads were washed and then eluted.
[0071] 3.1.7 Lentivirus Production and Infection
[0072] Lentiviruses encoding ITGB4 small-hairpin RNAs (shRNA) or LUCIFERASE small-hairpin RNA was obtained from the. TRC lentiviral shRNA library in the National RNAi Core Facility of Academia Sinica, Taiwan. The targeting sequences of specific shRNAs are shown as follows: ITGB4 shRNA (clone ID: TRCN0000057769) 5-CCCATGAAGAAAGTGCTGGTT-3, ITGB4 shRNA (clone ID: TRCN0000057771) 5-GAGGGTGTCATCACCATTGAA-3, and LUCIFERASE shRNA (clone ID: TRCN0000072246) 5-CAAATCACAGAATCGTCGTAT-3. Production of lentiviruses was performed according to the guidelines of the National RNAi Core Facility of Academia Sinica.
[0073] 3.1.8 BrdU Incorporation Assay
[0074] At 24 h after transfection, 210.sup.4 cells were serum starved for 24 h. Cells were then washed twice with DMEM and incubated for 16 h in DMEM plus 10% FBS and 100 M BrdU (Sigma-Aldrich). After that, cells were fixed, permeabilized, heated with DNase I, and processed for immunofluorescence staining, with anti-BrdU (1:200, Sigma-Aldrich) antibody, as described previously.sup.39, with a few modifications. Cells were then counted in multiple fields and scored for BrdU-positive staining in each independent experiment.
[0075] 3.1.9 Anchorage-Independent Growth in Soft Agar Assay
[0076] Experiments were performed as previously described'.sup.9, with the following modifications. A total of 510.sup.4 cells were seeded in 0.3% agar in DMEM plus 10% PBS and EGF (10 ng/ml) over the bottom 0.6% agar layer in DMEM. After incubation for 14 days, the number of colonies was scored.
[0077] 3.1.10 Modified Boyden Chamber Cell Migration Assay
[0078] A Neuro Probe 48-well chemotaxis Boyden chamber (Cabin John, MD) was used. A total of 510.sup.4 cells were allowed to migrate toward 10% FBS, EGF (10 ng/ml) in DMEM, used as the chemoattractant in the lower wells for 6 h. Finally, cells on the upper side of the polycarbonate membrane were removed and the bottom-side cells were fixed with methanol for 8 min and stained with crystal violet (Sigma-Aldrich). The migrated cells were counted from five randomly selected fields of each well.
[0079] 3.1.11 Matrigel Invasion Assay
[0080] BD BioCoat Matrigel invasion chambers were rehydrated by DMEM for 2 h. After removing the DMEM, EGF (10 ng/ml), and 10% FBS in DMEM was used as a chemoattractant in the lower wells of the invasion chamber. A total of 5610.sup.4 cells in DMEM were placed into the upper chamber. Cells were incubated for 20 h to allow them to invade into the Matrigel. Subsequently, cells were fixed with 4% paraformakiehyde for 15 min and stained with crystal violet (Sigma-Aldrich). The number of invaded cells was counted from five randomly selected fields in each welt
[0081] 3.1.12 Modeling Tumorigenesis and Metastasis In Vivo
[0082] All mouse experiments were approved by the Institutional Animal Care and Use Committee, National Taiwan University (Taipei, Taiwan). All experimental procedures were performed in accordance with the protocols and the ethical regulations approved by the Institutional Animal Care and Use Committees of National Taiwan University (Taipei, Taiwan). Female nu/nu mice were purchased from the National Laboratory Animal Center (Taipei, Taiwan). For tumorigenesis, 110.sup.6 MDA-MB-231 stably transfected pools expressing GFP-tagged FAK/25aa, its triple (FAK/25aa.sup.E380A/K381A/Q382A)or double (FAK/25aa.sup.R385A/S386A) mutant, or a mock transfected control that had been selected by 500 g/ml G418 for 2 weeks were injected into the 3.sup.rd mammary fat pad of eight-week-old female nu/nu mice. Stably transfected pools of each construct were injected in 100 l PBS. Tumor volumes and numbers were measured at 12 weeks after injection and then excised, photographed, and weighted. For tumor metastasis, 110.sup.6 MDA-MB-231 cells, described above, that were labeled with luciferase by lentiviral infection were resuspended in 100 l PBS and injected into the tail vein of six-week-old female nu/nu mice. Lung metastasis was monitored by bioluminescent imaging using an IVIS spectrum imaging system. Lung metastasis was measured on the respective day after injection.
[0083] 3.1313 Preparation of TAT-FAK 2.5aa Peptide
[0084] TAT and TAT-FAK/25aa peptides were synthesized. The sequences of TAT and TAT-FAK/25aa peptides were GRKKRRQRRRPQ (SEQ ID NO: 9) and GRKKRRQRRRPQLANNEKQGVRSHTVSVSETDDYAE1 (SEQ ID NO: 3), respectively. Purity of synthesized peptides was confirmed by high-performance liquid chromatography (HPLC).
[0085] 3.2 Result
[0086] 3.2.1 The physical interaction between 4 integrin and FAK correlates with tumor malignancy.
[0087] The putative interaction between 4 integrin and FAK in relation to tumor malignancy was analyzed by immunoprecipitation in varied cancer cell lines. The interaction between 4 integrin and FAK was identified in the malignant triple-negative breast cancer cell line (MDA-MB-231) (
[0088] To clarify the physical interaction between 4 integrin and PAK, we demonstrated that the recombinant His-tagged FAK/N400 was capable of precipitating 4 integrin from MDA-MB-231 cells, but neither His-tagged FAK/N375 nor His-taged FRNK (
[0089] In light of the above findings, we further dissect the binding sites for these two molecules. Firstly. we generated a serial FAK truncated mutants to be subjected for co-immunoprecipitation with 4 integrin. Collectively, as summarized in
[0090] On the other hand, we sought for the FAK binding site on 4 integrin by co-immunoprecipitation using distrinctive regions derived from the 4 integrin cytoplasmic domain, such as the cytodomain, the FNIII(1-2), the FNIII(1-2-L), and the FNIII(3-4-C). Collectively, as summarized in
[0091] 3.2.2 EGF/Sre Signaling Regulates 4 Integrin Phosphorylation and Integrin/FAK Complex Formation.
[0092] The discrepancy between metastatic MDA-MB-231 cells and non-metastatic MCF7 cells in the 4 integrin/FAK complex formation prompted us to investigate the regulatory mechanisms involved in the formation of this complex. We observed that EGFR autophosphorylation at Tyr.sup.1173, Src phosphorylation at Tye.sup.418, tyrosine phosphorylation of 4 integrin, and FAK autophosphorylation at Tyr.sup.397 were more prevalent in MDA-MB 231 cells compared to MCF7 cells (
[0093] 3.2.3 Interaction with 4 Integrin Enhances the Activity and Downstream Signaling of FAK
[0094] The downstream effects of the 4 integrin/FAK complex on breast cancer malignancy were then investigated. We noticed that the 4 integrin that co-immunoprecipitated with FAX was predominately phosphorylated at Tyr.sup.397 (
[0095] Next, several potential downstream signaling targets were examined to test whether any of them participates in 4 integrin/FAK complex-mediated cancer functions. As a result, AKT and p38MAPK were revealed to participate in 4 integrinIFAX complex-mediated signal transduction in triple-negative breast cancer (
[0096] 3.2.4 The 4 Integrin/FAK Complex Leads to Tumor Malignancy In Vitro.
[0097] The involvement of 4 integrin FAK, in tumor malignancy is well documented. Thus, along with our findings, overexpression of FAK/25aa, which decreases 4 integrin/FAK complex formation and FAK activation (
[0098] Then, we performed various functional assays to evaluate the role of the 4 integrin/FAK complex in tumor malignancy in MDA-MB-231 cells. We found that cell proliferation was decreased in FAK/25aa and the FAK/25aa.sup.R385A/S386A transfectants compared to mock and the FAK/25aa.sup.E380A/K381A/Q382A-transfected cells (
[0099] Given that the 4 integyM/FAK complex enables the activation of AKT- and p38MAPK-mediated signaling (
[0100] 3.2.5 The 4 Integrin/FAK Complex is Involved in Tumor Malignancy In Vivo.
[0101] To confirm the tumorigenic effects of the 4 integrin/FAK complex we observed in the above in vitro studies, we performed in vivo tumorigenesis studies by orthotopically injecting MDA-MB-23 I cells that stably overexpressed varied FAK/25aa mutants into the mammary fat-pads of nude mice. Mice injected with stably expressing FAK/25aa or FAK/25aa.sup.R385A/S386A but not FAK/25aa.sup.E380A/K381A/Q382A transfectants of MDA-MB-231 cells showed significant reductions in the size and weight of tumors (
[0102] Subsequently, the involvement of the 4 integrin/FAK complex in breast cancer metastasis was explored by tail vein injection and bioluminescence imaging of various MDA-MB-231 transfectants in nude mice. In comparison with mock and FAK/25aa.sup.E380A/K381A/Q382A-expressing cells, lung metastatic nodules were less-developed in FAK/25aa- and FAK/25aa.sup.R385/S386A-transfectants 84 days after injection in mice (
[0103] 3.2.6 Concomitant Overexpression of 4 Integrin and FAK in Human Triple-Negative Breast Cancer.
[0104] We next analyzed the relationship of 4 integrin and FAK in four subtypes (luminal A, lumina B, HER.sup.2+, and triple-negative) of human breast cancer (T) and their adjacent non-cancerous counterpart (N) tissues. Consistent with a malignant role for the 4 integrin/FAK complex in triple-negative breast cancer, the 4 integrin co-immunoprecipitated by FAK was predominately associated with triple-negative breast cancer compared to other subtypes (
[0105] 3.2.7 Targeting the Formation of the 4 Integrin/FAK Complex Potentiates the Intervention Against Triple-Negative Breast Cancer.
[0106] The FAK/25aa was fused with the TAT peptide to facilitate cellular uptake [32]. Then, the extracellular administration of the TATs-FAK/25aa peptide was apparantly capable of alleviating the formation of the 4 integrin/FAK complex in MDA-MB-231 cells (
[0107] 4. Experiment on the Contribution to Malignancy of Colon Cancer
[0108] 4.1 Samples and Methods
[0109] 4.1.1 Human Tissue Samples from Patients Diagnosed with Colon Cancer
[0110] Patients diagnosed with colon cancer were enrolled in this study with the approval of the Institutional Review Board of National Taiwan University Hospital, Taiwan. The surgical specimens of primary colon cancer tissues and its normal mucosa counterparts were collected for Western blotting and irnmunohistochernical staining.
[0111] 4.11 Tissue Microarray and Immanohistochemical Analyses
[0112] The human colon adenocarcinoma tissue microarray was purchased from Biomax, Inc. (MD, USA). The paraffin embedded samples were stained with antibodies against 4 integrin and FAK. The sections were processed using the DAB immunostaining kit (DAKO) according to the manufacturer's instructions. The samples were counterstained with hernatoxylin, mounted, and examined. Scoring was performed according to staining intensities (0, none; +1, weak; +2, moderate; +3, strong) of 4 integrin or FAK. The results were recorded as low (0 and +1) or high (+2 and +3) intensity levels,
[0113] 4.1.3 Cell Culture and Transfection
[0114] HCT-116 human colon cancer, HeLa human cervical cancer, and HEK-293 human epithelial kidney cell lines were maintained in Dulbecco's modified Eagle's medium (DMEM) supplemented with 10% fetal bovine serum (FBS) (Invitrogen). ALL cells were incubated in a 37 C. humidified 5% CO.sub.2 incubator. Cell transfection was performed using Lipofectarnine 2000 reagent (Invitrogen) according to the manufacturer's instructions.
[0115] 4.1.4 Western Blotting and Immunoprecipitation
[0116] Cells or tissue samples were homogenized and extracted for Western blotting. For immunoprecipitation, proteins were incubated with antibodies as indicated at 4 C. overnight, followed by incubation for 4 hrs with protein A-Sepharose 4B beads (Sigma-Aldrich). All experiments were conducted at least three independent times.
[0117] 4,1.5 Preparation of Recombinant Fusion Proteins
[0118] The constructs were transformed into a BL-21 bacterial strain and grown at 37 C. until they reached an optical density at 600 rim of 0.6. They were induced with 1 inM isopropyl--thiogalactopyranosicle overnight at 25 C. and subsequently pelieted and resuspended with PBS following sonication. The lysates were clarified by centrifugation and immobilized on GST-agarose heads (Sigma-Aldrich). The beads were washed, and proteins were eluted.
[0119] 4.1.6 Lentiviras Production and Infection
[0120] Lentiviruses encoding LUCIFER.ASE or ITGB4 shRNAs were obtained from the TRC lentiviral shRNA library in the National RNAi Core Facility of Academia Sinica, Taiwan. The targeting sequences of specific shRNAs used are as follows: LUCIFERASE shRNA 5-CAAATCACAGAATCGTCGTAT-3 (SEQ ID NO: 9), and ITGB4 shRNA 5-CCCASGAAGAAAGTGCTGGTT-3 (SEQ ID NO: 10), 5-GAGGGTGTCATCACCATTGAA-3 (SEQ ID NO: 11). Production of lentiviruses was processed according to the guidelines of the National RNAi Core Facility of Academia Sirtica.
[0121] 4.1.7 BrdU Incorporation Assay
[0122] A BrdU incorporation assay was performed. Briefly, serum-starved cells were incubated in DMEM with 10% FBS and 100 M BrdU (Sigma-Aldrich) for 16 hrs. Cells were fixed, permeabilized, treated with DNase I, and processed for immunofluorescence staining with anti-BrdU (Sigma-Aldrich) antibody. The BrdU-positive staining cells were scored.
[0123] 4.1.8 Anchorage-Independent Growth Assay
[0124] An anchorage-independent growth assay was conducted with several modifications. Briefly, 510.sup.4 cells were seeded in a 0.3% agar in DMEM containing 10% FBS over the bottom 0.6% agar layer in DIVIEM. After incubation for 14 days, the number and size of colonies were scored.
[0125] 4.2 Results.
[0126] 4.2.1 Co-Overexpression of 4 Integrin and FAX in Advanced Stage Human Colon Cancer Tissues
[0127] To elucidate the relationship between 4 integrin and FAK in human colon cancer, we first explored the pathological relevance of 4 integrin and FAK in paired primary colon cancer tissues and normal mucosa counterparts by immunohistochernical staining. This analysis suggested that the co-expression of both p4 integrin and FAK is clinically relevant. To further attempt to investigate the clinicopathologic relevance of 4 integrin and FAK co-expression in human colon cancer, we analyzed the expression of 4 integrin and FAK in a cohort of 67 human colon cancer specimens with early (stage I) and advanced (stage II, III and IV) stage tumors. Our results indicated that 4 integrin and FAK were highly expressed in 63% and 82% of advanced stage tumors, respectively; whereas 80% and 60% of early stage tumors expressed low levels of 4 integrin and FAK, respectively (
[0128] 4.2.2 4 Integrin Physkally Interacts with a 25-Amino Acid Motif within the Amino-Terminal FAK in HCT-116 Human Colon Cancer Cells
[0129] To investigate molecular mechanisms of 4 integrin-FAK signaling underlying human colon cancer progression, we performed biochemical analyses. First, we found that 4 integrin co-immunoprecipitated with FAK from primary colon cancer tissues but not from paired samples of normal mucosa (
[0130] We then examined if 4 integrin could physically interact with FAK in human colon cancer using in vitro pull-down, assays and mutational analyses. We found that 4 integrin immunoprecipitated with recombinant GST-FAK/N400 (the first 400 amino acids of FAK) but not GST-FAK/N375 (the first 375 amino acids of FAK) in LICT-116 cell lysates (
[0131] We also assessed these 25 amino acids within FAK that are essential for 4 integrin binding by site-directed mutagenesis. Our results showed that mutations of three amino acids (Glu380, Lys381, and Gln382) within this region of FAK diminished its 4 integrin binding ability. A triple mutation mutant, FAK.sup.E380A/K381A/Q382A, almost abolished FAK interaction with 4 integrin in HCT-116 cells, whereas 4 integrin binding remained intact with other FAK mutations of this 25-amino-acid motif, such as FAK.sup.R385A/S386A (
[0132] 4.2.3 Interaction with 134 Integrin Leads to FAX Autophosphorylation in Human Colon Cancer
[0133] Given that 4 integrin-bound FAX was highly phosphorylated at Tyr397 in human colon cancer (
[0134] The 25-amino-acid motif of FAK that is responsible for interacting with 4 integrin, contains the Tyr397-autophosphorylation site. We were therefore prompted to test whether the interaction between 4 integrin and FAK directly modulates the outcome of Tyr397-autophosphorylation of FAK. While overexpressing the FAK/25aa motif (resulting in competition and disruption of 4 integrin/FAK complex foimation) as well as the triple mutant (FAKI25aa.sup.E380A/K381A/Q382A, results in loss of interaction with 4 integrin) and double mutant (FAK/25aa.sup.R385A/S386A, maintains interaction with 4 integrin), we found that the Tyr397-autophosphorylation of FAK was diminished in FAK/25aa- and FAK/25aa.sup.R385A/S386A-transfected cells but remained in FAK/25aa.sup.E380A/K381A/Q382A-transfectants, indicating that FAK-Tyr397 undergoes autophosphorylation when bound to 4 integrin (
[0135] 424 Activation of FAK Through Interaction With 4 Integrin is an EGFR/Src Dependent Manner
[0136] The activity of Src family kinases (SFKs) is required for 4 integrin- and FAK-mediated signalings. To explore whether Src activity is essential for the 4 integrin/FAK complex formation as well as FAK activation in human colon cancer, we firstly investigated that the 4 integrin/FAK complex formation is increased in HCT-116 cells which were transfected with a constitutively active Src expression construct (Y527F) (
[0137] 4.2.4 AKT as a Downstream Effector of 4 Integrin/FAK Complexes
[0138] We sought to determine the signaling events that emanate from 4 integrin/FAK complexes in HCT-116 cells. By testing several potential downstream signaling transducers, AKT was revealed to participate in 4 integrin/FAK complex-mediated signaling (
[0139] 4.2.5 4 Integrin/FAK Complexes are Essential for Human Colon Cancer Tumorigenesis In Vitro and In Vivo
[0140] We then investigated functional effects of 4 integrin/FAK complexes in human colon cancer cells. To achieve this, we disrupted 4 integrin/FAK complexes by overexpressing FAK/25aa (
[0141] 4.2.6 Targeting the FAK Activity in Human Colon Cancer
[0142] In agreement with 4 integrin/FAK complex-mediated FAK activation being essential for colon cancer progression, anchorage-independent growth was impaired when FAK Tyr397-autophosphorylation was blocked with a pharmacological FAK inhibitor in HCT-116 cells (
[0143] In conclusion, it was demonstrated in the present invention that 4 integrin and FAK physically and functionally interact with each other in vitro and in vivo. This interaction is modulated by EGF/Sre signaling, which triggers a tyrosine phosphorylation cascade that regulates tumor proliferation, migration, and invasion as well as metastasis in vitro and in vivo. Several signaling mediators, i.e., AKT and p38MAPK, may play pivotal roles in 4 integrin/FAK-mediated tumor functions. The present invention demonstrates a crucial signaling module involved in the regulation of malignancy in triple-negative breast cancer and a novel target for future interventions and anti-cancer therapeutics.
REFERENCES
[0144] [1] Tejpar, S., et al., Integrating biomarkers in colorectal cancer trials in the West and China. Nat Rev Clin Oncol. 2015. [0145] [2] Arvelo, F., F. Sojo, and C. Cotte, Biology of colorectal cancer. E cancer medical science, 2015.9: p. 520. [0146] [3] Siegel, R., C. Desantis, and. A. Jemal, Colorectal cancer statistics. 2014. CA Cancer J Clin, 2014. 64(2): p. 104-17. [0147] [4] Sineshaw, H. M., A. S. Robbins, and A. Jemal, Disparities in survival improvement for metastatic colorectal cancer by race/ethnicity and age in the United States. Cancer Causes Control, 2014. 25(4): p. 419-23. [0148] [5] Tai, Y. L., L. C. Chen, and T. L. Shen, Emerging roles of focal adhesion kinase in cancer Biomed Res Int, 2015. 2015: p. 690690. [0149] [6] Golubovskaya, V. M., F. A. Kweh, and W. G. Cance, Focal adhesion kinase and cancer. Histol Histopathol, 2009. 24(4): p. 503-10. [0150] [7] Lai, I. R., et al., Phosphorylation of focal adhesion kinase at Tyr397 in gastric carcinomas and its clinical significance. Am J Pathol, 2010. 177(4): p. 1629-37. [0151] [8] Cance, W. G., et al., Immunohistochernical analyses of focal adhesion kinase expression in benign and malignant human breast and colon tissues: correlation with preinvasive and invasive phenotypes. Clin Cancer Res, 2000. 6(6): p. 2417-23. [0152] [9] Han, N. M., et al., Overexpression of focal adhesion kinase (p125FAK) in human colorectal carcinoma liver metastases: independence from c-sic or c-yes activation. Ann Sorg Oncol, 1997. 4(3); p. 264-8. [0153] [10] Yu, H. G., et al, Rapid tyrosine phosphorylation of focal adhesion kinase, paxillin, and p130Cas by gastrin in human colon cancer cells. Biochem Pharmacol, 2004, 67(1): p. 135-46. [0154] [11] H. G., et al., Enhanced expression of cholecystokinin-2 receptor promotes the progression of colon cancer through activation of focal adhesion kinase. Int J Cancer, 2006. 119(12): p. 2724-32. [0155] [12] Heftier, M., et al., Focal adhesion kinase autophosphorylation inhibition decreases colon cancer cell growth and enhances the efficacy of chemotherapy, Cancer Biol Ther, 2013. 14(8): p. 761-72. [0156] [13] Thakur, R., et al., Inhibition of STAT3, FAK and Src mediated signaling reduces cancer stem cell load, tumorigenic potential and metastasis in breast cancer Sci Rep, 2015. 5: p. 10194. [0157] [14] Mitra, S. K. and D. D. Schlaepfer, Integrin-regulated FAK-Src signaling in normal and cancer cells. Curr Opin Cell Riot, 2006. 18(5): p. 516-23. [0158] [15] Chu, P. Y., et al., Tyrosine phosphorylation of growth factor receptor-bound protein-7 by focal adhesion kinase in the regulation of cell migration. proliferation, and tumorigenesis. J Biol Chem, 2009. 284(30): p. 20215-26. [0159] [16] Thamilselvan, V., D. H. Craig, and M. D. Basson, FAK association with multiple signal proteins mediates pressure-induced colon cancer cell adhesion via a Src-dependent PI3K/Akt pathway. FASEB J, 2007. 21(8): p. 1730-41. [0160] [17] McLean, G. W., et al., The role offival-adhesion kinase in cancera new therapeutic opportunity. Nat Rev Cancer, 2005. 5(7): p. 505-15. [0161] [18] Borradori, L. and A. Sonnenberg, Structure and function of hemidesmosomes: more than simple adhesion complexes. J Invest Dermatol, 1999. 112(4): p. 411-8. [0162] [19] Boelens, M. C., et al., Differential expression and distribution of epithelial adhesion molecules in non-small cell lung cancer and normal bronchus. J Clin Pathol, 2007. 60(6): p. 608-14. [0163] [20] Ni, H., et al., Upregulation of altinctional form of the beta4 integrin subunit in colorectal cancers correlates with c-Myc expression. Oncogene, 2005. 24(45): p. 6820-9. [0164] [21] Chung, J., et Integrin (alpha 6 beta 4) regulation of eIF-4E activity and VEGE translation: a survival mechanism for carcinoma cells. J Cell Biol, 2002. 158(1): p. 165-74. [0165] [22] Gianeotti, F. G., Targeting integrin beta4 for cancer and anti-angiogenic therapy. Trends Pharmacol Sci. 2007. 28(10): p. 506-11. [0166] [23] Bertotti, A., P. M. Comoglio, and L. Trusolino, Beta4 integrin activates a Shp2-Src signaling pathway that sustains IIGF-induced anchorage-independent growth. J Cell Biol, 2006. 175(6): p. 993-1003. [0167] [24] Guo, W., et al., Beta 4 integrin amplifies ErbB2 signaling to promote mammary tumorigenesis. Cell, 2006. 126(3): p. 489-502. [0168] [25] Bertotti, A., P. M. Comoglio, and L. Trusolino, Beta4 integrin is a transforming molecule that unleashes Met tyrosine kinase tumorigenesis. Cancer Res, 2005. 65(23): p. 10674-9. [0169] [26] Shaw, L. M., et al., Activation of phosphoinositide 3-OH kinase by the alpha6beta4 integrin promotes carcinoma invasion. Cell. 1997. 91(7): p. 949-60. [0170] [27] Murata, T., et al., Localization of EAK is related with colorectal carcinogenesis. Int J Oncol, 2008. 32(4): p. 791-6. [0171] [28] Beaulieu, J. F., Integrin alpha6beta4 in colorectal cancer. World J Gastrointest Pathophysiol, 2010. 1(1): p. 3-11. [0172] [29] Tai, Y. L., et al., An EGFR/Src-dependent /4 integrin/FAK complex contributes to malignancy of breast cancer. scientific reports, 2015. in press. [0173] [30] Abdel-Ghany, M., et al., Focal adhesion kinase activated by beta(4) integrin ligation to mCLCAl mediates early metastatic growth. J Biol Chem, 2002. 277(37): p. 34391-400. [0174] [31] Chen, Q., et al., Down-regulation of Gli transcription factor leads to the inhibition of migration and invasion of ovarian cancer cells via integrin beta4-mediated FAK signaling. PLoS One, 2014. 9(2): p. e88386. [0175] [32] Shen, T. L., D. C. Han, and J. L. Guan, Association of Grb7 with phosphoinositides and its role in the regulation of cell migration. J Biol Chem, 2002. 277(32): p. 29069-77. [0176] [33] Chu, P. Y., et at., EGF-induced Grb7 recruits and promotes Ras activity essential for the tumorigenicity of Sk-Br3 breast cancer cells. J Biot Chem, 2010. 285(38): p. 29279-85. [0177] [34] Mang, S. and D. Yu, Targeting Src family kinases in anti-cancer therapies:
[0178] turning promise into triumph. Trends Pharmacol Sci, 2012. 33(3): p. 122-8. [0179] [35] Mariotti, A., et al., EGF-R signaling through Fyn kinase disrupts the function of integrin alpha6beta4 at hemidesmosomes: role in epithelial cell migration and carcinoma invasion. J Cell Biol, 2001. 155(3): p. 447-58. [0180] [36] Zhao, J. and J. L. Guan, Signal transduction by focal adhesion kinase in cancer. Cancer Metastasis Rev, 2009. 28(1-2): p. 35-49. [0181] [37] Parsons, J. T., et al., Focal adhesion kinase: targeting adhesion signaling pathways for therapeutic intervention. Clin Cancer Res, 2008. 14(3): p. 627-32 [0182] [38] Weiner, T. M., et al., Expression offocal adhesion kinase gene and invasive cancer. Lancet, 1993. 342(8878): p, 1024-5. [0183] [39] Owens, L. V., et al., Overexpression of the focal adhesion kinase (p125FAK) in invasive human tumors. Cancer Res, 1995. 55(13): p. 2752-5. [0184] [40] Lark, A. L., et al., Overexpression offbeat adhesion kinase in primary colorectal carcinomas and colorectal liver metastases: immunohistochemistry and real-time PCR analyses. Clin Cancer Res, 2003. 9(1): p. 215-22. [0185] [41] Roberts, W. G, et al., Antitumor activity and phannacology of a selective focal adhesion kinase inhibitor, PF-562,271. Cancer Res, 2008.58(6): p. 1935-44. [0186] [42] Sun, H., et al., Bioluminescent imaging study: FAK inhibitor PF-562,271, preclinical study in PC3M-luc-C6 local implant and metastasis xenograft models. Cancer Biol Ther, 2010. 10(1): p. 38-43. [0187] [43] Lietha, D., et al., Structural basis ,for the autoinhibition offocal adhesion kinase. Cell, 2007. 129(6): p. 1177-87. [0188] [44] Cooper, L A., T. L. Shen, and J. L. Guan, Regulation offocal adhesion kinase by its amino-terminal domain through an autoinhibitoty interaction. Mol Cell Biol, 2003.23(22): p. 8030-41, [0189] [45] Dunty, J. M., et al., FERM domain interaction promotes FAK signaling. Mol Cell Biol, 2004. 24(12): p. 5353-68.