HBV epitope reactive exogenous T cell receptor (TCR) and uses thereof
10004801 ยท 2018-06-26
Assignee
Inventors
Cpc classification
A61K39/4632
HUMAN NECESSITIES
A61K39/4611
HUMAN NECESSITIES
C07K14/705
CHEMISTRY; METALLURGY
A61K45/06
HUMAN NECESSITIES
A61K47/6425
HUMAN NECESSITIES
A61K39/292
HUMAN NECESSITIES
Y10T436/143333
GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
A61P35/00
HUMAN NECESSITIES
International classification
C12N5/00
CHEMISTRY; METALLURGY
A61K47/64
HUMAN NECESSITIES
C07K14/705
CHEMISTRY; METALLURGY
Abstract
There is provided at least one isolated cell comprising at least one HBV epitope-reactive exogenous T cell receptor and/or fragment thereof, and methods for producing them. In particular, there is provided polynucleotides, constructs and vectors encoding at least one HBV epitope-reactive exogenous T cell receptor for use in the treatment of Hepatitis B Virus (HBV) and Hepatocellular Carcinoma (HCC). The invention further provides kits and methods of detection of HBV and HCC.
Claims
1. An isolated T-cell comprising at least one exogenous T-cell receptor (TCR) reactive with an HLA-A2 restricted hepatitis B virus (HBV) epitope comprising an HBs370-79 epitope.
2. The isolated T-cell of claim 1, wherein the HBs370-79 epitope has the amino acid sequence of SEQ ID NO: 56, SEQ ID NO: 57 or SEQ ID NO: 58.
3. The isolated T-cell of claim 1, wherein the TCR comprises: i) a V?12 chain comprising: a) the amino acid sequence of SEQ ID NO: 47; or b) the amino acid sequences of SEQ ID NO: 44, SEQ ID NO: 45, and SEQ ID NO: 46; and ii) a V?7.8 chain comprising: a) the amino acid sequence of SEQ ID NO: 55; or b) the amino acid sequences of SEQ ID NO: 52, SEQ ID NO: 53, and SEQ ID NO: 54.
4. The isolated T-cell of claim 1, wherein the TCR comprises: i) a V?12 chain comprising an amino acid sequence that is at least 90% identical to the amino acid sequence of SEQ ID NO: 47; and ii) a V?7.8 chain comprising an amino acid sequence that is at least 90% identical to the amino acid sequence of SEQ ID NO: 55.
5. An isolated polynucleotide encoding a T-cell receptor (TCR) reactive with an HLA-A2 restricted hepatitis B virus (HBV) epitope comprising an HBs370-79 epitope.
6. The isolated polynucleotide of claim 5, wherein the TCR comprises: i) a V?12 chain comprising an amino acid sequence that is at least 90% identical to the amino acid sequence of SEQ ID NO: 47; and ii) a V?7.8 chain comprising an amino acid sequence that is at least 90% identical to the amino acid sequence of SEQ ID NO: 55.
7. The isolated polynucleotide of claim 5 comprising: i) a nucleic acid sequence encoding a V?12 chain comprising: a) the nucleic acid sequence of SEQ ID NO: 43; or b) the nucleic acid sequences of SEQ ID NO: 40, SEQ ID NO: 41, and SEQ ID NO: 42; and ii) a nucleic acid sequence encoding a V?7.8 chain comprising: a) the nucleic acid sequence of SEQ ID NO: 51; or b) the nucleic acid sequences of SEQ ID NO: 48, SEQ ID NO: 49, and SEQ ID NO: 50.
8. The isolated polynucleotide of claim 5 comprising: i) a nucleic acid sequence encoding a V?12 chain comprising the nucleic acid sequences of SEQ ID NO: 40, SEQ ID NO: 41, and SEQ ID NO: 42; and ii) a nucleic acid sequence encoding a V?7.8 chain comprising the nucleic acid sequences of SEQ ID NO: 48, SEQ ID NO: 49, and SEQ ID NO: 50.
9. An isolated T-cell receptor (TCR) reactive with an HLA-A2 restricted hepatitis B virus (HBV) epitope comprising an HBs370-79 epitope, wherein the TCR comprises: i) a V?12 chain comprising the amino acid sequences of SEQ ID NO: 44, SEQ ID NO: 45, and SEQ ID NO: 46; and ii) a V?7.8 chain comprising the amino acid sequences of SEQ ID NO: 52, SEQ ID NO: 53, and SEQ ID NO: 54.
10. The isolated TCR of claim 9, wherein the TCR comprises: i) a V?12 chain comprising an amino acid sequence that is at least 90% identical to the amino acid sequence of SEQ ID NO: 47; and ii) a V?7.8 chain comprising an amino acid sequence that is at least 90% identical to the amino acid sequence of SEQ ID NO: 55.
Description
BRIEF DESCRIPTION OF THE FIGURES
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
(24)
(25)
(26)
(27)
DETAILED DESCRIPTION OF THE INVENTION
(28) Bibliographic references mentioned in the present specification are for convenience listed in the form of a list of references and added at the end of the examples. The whole content of such bibliographic references is herein incorporated by reference.
Definitions
(29) For convenience, certain terms employed in the specification, examples and appended claims are collected here.
(30) The term comprising is herein defined to be that where the various components, ingredients, or steps, can be conjointly employed in practicing the present invention. Accordingly, the term comprising encompasses the more restrictive terms consisting essentially of and consisting of.
(31) With the term consisting essentially of it is understood that the exogenous TCR polypeptide and/or polynucleotide according to the invention substantially comprises the indicated sequence as essential element. Additional sequences may be included at the 5 end and/or at the 3 end. Accordingly, a polypeptide consisting essentially of sequence X will be novel in view of a known polypeptide accidentally comprising the sequence X.
(32) With the term consisting of it is understood that the polypeptide and/or polynucleotide according to the invention corresponds to at least one of the indicated sequence (for example a specific sequence indicated with a SEQ ID Number or a homologous sequence or fragment thereof).
(33) The term exogenous T cell receptor (TCR) is herein defined as a recombinant TCR which is expressed in a cell by introduction of exogenous coding sequences for a TCR. In particular, the HBV epitope-reactive TCR may be expressed in a cell in which the TCR is either not natively expressed or is expressed at levels that are insufficient to induce a response by the cell or a responder cell upon TCR ligand binding.
(34) The term fragment is herein defined as an incomplete or isolated portion of the full sequence of the HBV epitope-reactive exogenous TCR which comprises the active site(s) that confers the sequence with the characteristics and function of the HBV epitope-reactive exogenous TCR. In particular, it may be shorter by at least one nucleotide or amino acid. More in particular, the fragment comprises the active site(s) that enable the HBV epitope-reactive exogenous TCR to recognise the HBc18-27 epitope and/or the HBs370-79 epitope.
(35) The term HBV epitope-reactive T Cell Receptor (TCR) is herein defined as a TCR which binds to an HBV epitope in the context of a Major Histocompatibility Complex (MHC) molecule to induce a helper or cytotoxic response in the cell expressing the recombinant TCR. In particular, the HBV epitope may be HBc18-27. More in particular, the HBV epitope may comprise the sequence of SEQ ID NO:25. The HBV epitope may be HBs370-79. More in particular, the HBV epitope may comprise the sequence of SEQ ID NO:56, SEQ ID NO:57 or SEQ ID NO:58.
(36) The term HBc 18-27 epitope is herein defined as an epitope that can stimulate HLA class I restricted T cells. It may be used interchangeably in the present invention as HBc18, HBc18-27, HBc18-27 peptide and the peptide. The sequence of the epitope may be FLPSDFFPSV (SEQ ID NO:25). In the present invention, the term HBc18-27 is used to refer to the HBc18-27 epitope of genotype A/D prevalent amongst Caucasians of sequence SEQ ID NO:25 unless otherwise stated. The region of the T cell receptor that binds to the epitope is referred to as HBc18-27 TCR or HBc18 TCR.
(37) The term HBs370-79 epitope is herein defined as an epitope that can stimulate HLA class I restricted T cells. The sequence of the epitope may be SIVSPFIPLL (SEQ ID NO:56). In the present invention, the term HBs370-79 is used to refer to the HBs370-79 epitope of genotype A/D prevalent amongst Caucasians of sequence SEQ ID NO:56 unless otherwise stated. The region of the T cell receptor that binds to the epitope is referred to as HBs370-79 TCR.
(38) The term immunotherapeutically effective amount is herein defined as an amount which results in an immune-mediated prophylactic or therapeutic effect in the subject, i.e., that amount which will prevent or reduce symptoms at least 50% compared to pre-treatment symptoms or compared to a suitable control.
(39) The term isolated is herein defined as a biological component (such as a nucleic acid, peptide or protein) that has been substantially separated, produced apart from, or purified away from other biological components in the cell of the organism in which the component naturally occurs, i.e., other chromosomal and extrachromosomal DNA and RNA, and proteins. Nucleic acids, peptides and proteins which have been isolated thus include nucleic acids and proteins purified by standard purification methods. The term also embraces nucleic acids, peptides and proteins prepared by recombinant expression in a host cell as well as chemically synthesized nucleic acids.
(40) The term operably connected herein defined as a functional linkage between regulatory sequences (such as a promoter and/or array of transcription factor binding sites) and a second nucleic acid sequence, wherein the regulatory sequences direct transcription of the nucleic acid corresponding to the second sequence.
(41) The term mutant or mutant form of a TCR epitope is herein defined as one which has at least one amino acid sequence that varies from at least one reference virus-encoded sequence via substitution, deletion or addition of at least one amino acid, but retains the ability to bind and activate the TCR bound and activated by the non-mutated epitope. In particular, the mutants may be naturally occurring or may be recombinantly or synthetically produced.
(42) The term soluble TCR is herein defined as a soluble (secreted) form of the membrane bound TCR which is the molecule that is responsible for the T cell's recognition of the antigen for which it is specific. In its soluble form it is analogous to a monoclonal antibody except that it recognizes fragments of peptides associated with MHC molecules while antibodies recognize determinants on a whole protein. In particular, the isolated polypeptide of the present invention may be used for producing a soluble TCR using any method known in the art. More in particular, the soluble TCR may bind to the HBc18-27 and/or HBs370-79 epitope of HBV.
(43) The term subject is herein defined as vertebrate, particularly mammal, more particularly human. For purposes of research, the subject may particularly be at least one animal model, e.g., a mouse, rat and the like. In particular, for the animal models, the sequence of the TCR ?- and ?-chains may be selected based on species. In some cases, transgenic animals expressing human MHC molecules may also be useful in evaluating specific aspects of the present invention.
(44) A person skilled in the art will appreciate that the present invention may be practiced without undue experimentation according to the method given herein. The methods, techniques and chemicals are as described in the references given or from protocols in standard biotechnology and molecular biology text books.
(45) In one aspect of the present invention, there is provided at least one isolated cell comprising at least one HBV epitope-reactive exogenous T cell receptor (TCR) and/or fragment thereof. Such cells may be suitable for use in adoptive transfer protocols to provide a particularly effective mode of treatment. The isolated cells of the present invention may circumvent the problem of deletion and sub-optimal function of HBV-specific CD8+ and CD4+ cells which may be present in patients with chronic HBV infection. In particular, the TCR from a patient who resolved the HBV infection may be used to redirect the specificity of the lymphocytes of chronic HBV patients for TCR transfer.
(46) In particular, HBV-reactive TCRs may be prepared by transforming or transducing at least one isolated cell with one or more polynucleotides encoding functional ?- and/or ?-chains and/or polypeptides of functional ?- and/or ?-chains that may assemble to form at least one functional HBV-epitope reactive TCR. In particular, the isolated cell may be isolated using any technique known in the art. More in particular, at least one cell isolation kit, Ficoll-Paque density gradient centrifugation, BD FACSAria Cell Sorting System and the like may be used to isolate the cell.
(47) The isolated cell may be at least one autologous cell, i.e., they may be derived from at least one subject that may receive the resultant transduced or transformed cells. In particular, the isolated cells may be derived from the peripheral blood lymphocytes and/or hematopoietic stem cells of the subject.
(48) More in particular, the isolated cell may be at least one T cell that innately expresses at least one CD4+ cell surface marker, at least one CD8+ cell surface marker, both CD4+ and CD8+ marker or neither CD4+ nor CD8+ cell surface markers. In particular, the cell according to the present invention may be at least one T cell that also natively expresses at least one TCR. The HBV-reactive exogenous TCR may bind the same epitope as the natively expressed TCR, and/or may bind a different epitope. In particular, the HBV-reactive exogenous TCR may be expressed in at least one cell in which the TCR may be either not natively expressed or may be expressed at levels that may be insufficient to induce response by the cell or responder cell upon TCR ligand binding. In particular, the isolated cell according to the present invention may be transduced with two or more different HBV-reactive exogenous TCRs, i.e., TCRs which bind to two or more different HBV epitopes.
(49) HBV-exposed patients who have cleared their viral infections, may provide excellent source of HBV-reactive T cells expressing high affinity TCRs. In particular, HBV-epitope reactive TCRs may be prepared by isolating at least one HBV-reactive T cell from at least one HBV-exposed aviremic individual, and cloning the polynucleotide sequence encoding the ?- and ?-chains of the TCR from the HBV reactive T cell. Once these sequences have been cloned using standard methods known in the art, the sequences may be delivered to at least one isolated cell and the isolated cell may be incubated under conditions suitable for expression of the TCR by the isolated cell. More in particular, the suitable conditions may include standard cell culture conditions. When the TCR is expressed in vitro or ex vivo, the cell expressing the TCR may be evaluated for reactivity with HBV epitopes, among other parameters of interest, as known in the art and as exemplified below. In some protocols, i.e., those wherein the vector may be administered to at least one subject, the TCR may also be expressed in vivo to provide a therapeutic effect in at least one subject in need thereof, i.e., at least one subject with acute or chronic HBV infection or HBV-associated condition.
(50) The HBV-reactive TCRs according to the present invention may be functional in the isolated cell in which they may be expressed. In particular, they may be functional heterodimers of a and 13 TCR chains associated with a CD3 complex that recognizes at least one HBV epitope in the context of at least one Class I or Class II MHC molecule. In humans, the MHC restriction of at least one epitope may be dependent on at least one particular Human Leukocyte Antigen (HLA) expressed by at least one cell presenting the antigen. HBV-reactive TCRs that may recognize HBV epitopes restricted to any HLA type (i.e., HLA-A, HLA-B, HLA-C, HLA-DPA1, HLA-DPB1, HLA-DQA1, HLA-DQB1, HLA-DRA, and HLA-DRB1) may be used in the present invention. For purposes of study, the HBV-reactive TCR may recognize at least one HBV epitope in the context of at least one MHC molecule of at least one species other than human, e.g., H-2K of mouse.
(51) In particular, the HBV-reactive TCR recognizes HBV epitopes that may be HLA-A2 restricted. Approximately 50% of the general population expresses the MHC class I molecule HLA-A2, an HLA-A serotype. Therefore, HLA-A2-restricted TCRs may find widespread therapeutic use. In particular, the subtype may identify gene products of many HLA-A*02 alleles, comprising HLA-A*0201, *0202, *0203, *0206, and *0207 gene products. There may be distinct differences in the subtypes between Caucasian and Asian populations. Whereas more than 95% of the HLA-A2 positive Caucasian population is HLA-A0201 the HLA-A2 positive Chinese population may be broken down into 23% HLA-A0201; 45% HLA-A0207; 8% HLA-A0206; 23% HLA-A0203.
(52) The TCRs of the present invention may be HBV-epitope reactive. A list of known immunoreactive HBV epitopes and their sequences may be found on page 233, chapter 11 (The effect of pathogens on the immune system: Viral hepatitis) of the book In immunodominance: The choice of the Immune System, J. A. Frelinger, ed (Weinheim: Wiley-VCH) which is herein incorporated by reference. The HBV epitope may comprise at least one core antigen, envelope antigen, surface antigen and/or mutants thereof.
(53) In particular, the HBV epitope may comprise at least one hepatitis B core antigen, and/or mutants thereof. More in particular, the HBV epitope may comprise HBc18-27, and/or mutants thereof. The HBc18-27 epitope may comprise FLPSDFFPSV (SEQ ID NO:25) or mutants thereof. Furthermore, the HBc18-27 epitope present in genotype A and D which may comprise FLPSDFFPSV (SEQ ID NO: 25), which are most prevalent in Europe, differs from HBc18-27 epitope of genotypes B and C which may comprise FLPSDFFPSI (SEQ ID NO: 26), which are most prevalent in Asia.
(54) In particular, the HBV epitope may comprise at least one hepatitis B envelope antigen, and/or mutants thereof. More in particular, the HBV epitope may comprise HBs370-79, and/or mutants thereof. The HBs370-79 epitope may comprise SIVSPFIPLL (SEQ ID NO:56) or mutants thereof. Furthermore, the HBs370-79 epitope present in genotype A and D which may comprise SIVSPFIPLL (SEQ ID NO:56), which are most prevalent in Europe, differs from HBs370-79 epitope of genotype B which may comprise NILSPFMPLL (SEQ ID NO: 57), and epitope of genotype C which may comprise NILNPFLPLL (SEQ ID NO: 58), which are most prevalent in Asia.
(55) In particular, the cell according to the present invention may further comprise at least one second HBV epitope-reactive exogenous TCR and/or fragment thereof, wherein the second HBV-reactive exogenous TCR may be the same epitope as the first epitope or different from the first HBV epitope. In particular, the second HBV epitope may be HBs370-79 and the first epitope may be HBc18-27.
(56) The exogenous TCR may comprise at least one ?-chain comprising at least one amino acid sequence selected from the group consisting the sequences SEQ ID NO:9, SEQ ID NO:10 and SEQ ID NO:11 and/or mutants thereof. In particular, the exogenous TCR comprises at least one ?-chain comprising the sequences SEQ ID NO:9, SEQ ID NO:10 and SEQ ID NO:11. More in particular, the ?-chain comprises all three sequences, SEQ ID NO:9, SEQ ID NO:10 and SEQ ID NO:11. The ?-chain may comprise the sequences of SEQ ID NO:9, SEQ ID NO:10 and SEQ ID NO:11 consecutively. In particular, the ?-chain may consist essentially of the sequences SEQ ID NO:9, SEQ ID NO:10 and SEQ ID NO:11. All sequences used in the present invention are given in Tables 1 and 2.
(57) The exogenous TCR may further comprise at least one ?-chain comprising at least one amino acid sequence selected from the group consisting of the sequences SEQ ID NO:21, SEQ ID NO:22 and SEQ ID NO:23 and/or mutants thereof. In particular, the ?-chain may comprise all three sequences, SEQ ID NO:21, SEQ ID NO:22 and SEQ ID NO:23. In particular, the ?-chain may comprise the sequences of SEQ ID NO:21, SEQ ID NO:22 and SEQ ID NO:23 consecutively. More in particular, the ?-chain may consist essentially of the sequences SEQ ID NO:21, SEQ ID NO:22 and SEQ ID NO:23.
(58) In particular, the exogenous TCR may comprise at least one ?-chain having at least 80% amino acid identity to SEQ ID NO:12 or a fragment thereof and/or at least one ?-chain having at least 80% amino acid identity to SEQ ID NO:24 or a fragment thereof. In particular, the ?-chain and ?-chain may be at least about 85%, at least about 90%, or at least about 95% identical to SEQ ID NO:12 and SEQ ID NO:24 respectively. More in particular, the ?-chain may comprise all sequences SEQ ID NO:9, SEQ ID NO:10 and SEQ ID NO:11 and ?-chain may comprise all sequences SEQ ID NO:21, SEQ ID NO:22 and SEQ ID NO:23.
(59) The exogenous TCR may comprise at least one ?-chain comprising at least one amino acid sequence selected from the group consisting the sequences SEQ ID NO:44, SEQ ID NO:45 and SEQ ID NO:46 and/or mutants thereof. In particular, the exogenous TCR comprises at least one ?-chain comprising the sequences SEQ ID NO:44, SEQ ID NO:45 and SEQ ID NO:46. More in particular, the ?-chain comprises all three sequences, SEQ ID NO:44, SEQ ID NO:45 and SEQ ID NO:46. The ?-chain may comprise the sequences of SEQ ID NO:44, SEQ ID NO:45 and SEQ ID NO:46 consecutively. In particular, the ?-chain may consist essentially of the sequences SEQ ID NO:44, SEQ ID NO:45 and SEQ ID NO:46. All sequences used in the present invention are given in Tables 1 and 2.
(60) The exogenous TCR may further comprise at least one ?-chain comprising at least one amino acid sequence selected from the group consisting of the sequences SEQ ID NO:52, SEQ ID NO:53 and SEQ ID NO:54 and/or mutants thereof. In particular, the ?-chain may comprise all three sequences, SEQ ID NO:52, SEQ ID NO:53 and SEQ ID NO:54. In particular, the ?-chain may comprise the sequences of SEQ ID NO:52, SEQ ID NO:53 and SEQ ID NO:54 consecutively. More in particular, the ?-chain may consist essentially of the sequences SEQ ID NO:52, SEQ ID NO:53 and SEQ ID NO:54.
(61) In particular, the exogenous TCR may comprise at least one ?-chain having at least 80% amino acid identity to SEQ ID NO:47 or a fragment thereof and/or at least one ?-chain having at least 80% amino acid identity to SEQ ID NO:55 or a fragment thereof. In particular, the ?-chain and ?-chain may be at least about 85%, at least about 90%, or at least about 95% identical to SEQ ID NO:47 and SEQ ID NO:55 respectively. More in particular, the ?-chain may comprise all sequences SEQ ID NO:44, SEQ ID NO:45 and SEQ ID NO:46 and ?-chain may comprise all sequences SEQ ID NO:52, SEQ ID NO:53 and SEQ ID NO:54.
(62) The sequences encoding the ?-chain and ?-chain have been determined to be the amino acid sequence for at least one productively rearranged ?-chain and ?-chain respectively of a TCR reactive against HBV epitope HBc18-27 and/or HBs370-79.
(63) More in particular, the exogenous TCR reactive against HBV epitope HBc18-27 may comprise at least one ?-chain of SEQ ID NO:12 and/or at least one ?-chain of SEQ ID NO:24. Even more in particular, the exogenous TCR reactive against HBV epitope HBc18-27 may consists essentially of at least one ?-chain of SEQ ID NO:12 and at least one ?-chain of SEQ ID NO:24. The exogenous TCR reactive against HBV epitope HBc18-27 may consists of at least one ?-chain of SEQ ID NO:12 and at least one ?-chain of SEQ ID NO:24. In particular, the exogenous TCR reactive against HBV epitope HBc18-27 may consist of two ?-chains and two ?-chains.
(64) More in particular, the exogenous TCR reactive against HBV epitope HBs370-79 may comprise at least one ?-chain of SEQ ID NO:47 and/or at least one ?-chain of SEQ ID NO:55. Even more in particular, the exogenous TCR reactive against HBV epitope HBs370-79 may consists essentially of at least one ?-chain of SEQ ID NO:47 and at least one ?-chain of SEQ ID NO:55. The exogenous TCR reactive against HBV epitope HBs370-79 may consists of at least one ?-chain of SEQ ID NO:47 and at least one ?-chain of SEQ ID NO:55. In particular, the exogenous TCR reactive against HBV epitope HBs370-79 may consist of two ?-chains and two ?-chains.
(65) Percentage identity may be determined using the algorithm of Karlin and Altschul (Proc. Natl. Acad. Sci. 87: 2264-68 (1990), modified Proc. Natl. Acad. Sci. 90: 5873-77 (1993)). Such algorithm is incorporated into the BLASTx program, which may be used to obtain amino acid sequences homologous to a reference polypeptide. The present invention may also encompass TCR ?- or ?-chains having amino acid sequences including conservative amino acid substitutions. Such substitutions are well known in the art.
(66) According to another aspect, the present invention provides at least one isolated polynucleotide comprising at least one sequence encoding at least one ?-chain and/or at least one sequence encoding at least one ?-chain wherein, the encoded ?-chain and ?-chain may be part of at least one HBV epitope-reactive TCR.
(67) In particular, the sequence encoding the ?-chain comprises at least one sequence selected from SEQ ID NO:1 and SEQ ID NO:5, at least one sequence selected from SEQ ID NO:2 and SEQ ID NO:6 and at least one sequence selected from SEQ ID NO:3 and SEQ ID NO:7 and/or the sequence encoding the ?-chain comprises at least one sequence selected from SEQ ID NO:13 and SEQ ID NO:17, at least one sequence selected from SEQ ID NO:14 and SEQ ID NO:18 and at least one sequence selected from SEQ ID NO:15 and SEQ ID NO:19. More in particular, the sequence encoding the ?-chain may comprise SEQ ID NO:5, SEQ ID NO:6 and SEQ ID NO:7 and/or the sequence encoding the ?-chain may comprise SEQ ID NO:17, SEQ ID NO:18 and SEQ ID NO:19.
(68) In particular, the sequence encoding the ?-chain of the HBc-18-27 epitope-reactive TCR may have at least 80% sequence identity to SEQ ID NO:4 or SEQ ID NO:8 and/or the sequence encoding the ?-chain of the HBc-18-27 epitope-reactive exogenous TCR may have at least 80% sequence identity to SEQ ID NO:16 or SEQ ID NO:20. In particular, the sequence(s) encoding the ?-chain and ?-chain may be at least about 85%, at least about 90%, or at least about 95% identical to SEQ ID NO:4 or SEQ ID NO:8 and SEQ ID NO:16 or SEQ ID NO:20 respectively. More in particular, the sequence encoding the ?-chain may be selected from the group consisting of SEQ ID NO:4 and SEQ ID NO:8, and/or the sequence encoding the ?-chain may be selected from the group consisting of SEQ ID NO:16 and SEQ ID NO:20. The HBc-18-27 epitope-reactive exogenous TCR may comprise two ?-chains encoded by the sequence SEQ ID NO:8 and two ?-chains encoded by SEQ ID NO:20. More in particular, the ?-chain and ?-chain may be encoded by nucleotide sequences that comprise the consecutive sequence shown in SEQ ID NO:4 or SEQ ID NO:8 and SEQ ID NO:16 or SEQ ID NO:20 respectively.
(69) Even more in particular, the exogenous TCR may consists essentially of at least one ?-chain encoded by SEQ ID NO:4 or SEQ ID NO:8 and at least one ?-chain encoded by SEQ ID NO:16 or SEQ ID NO:20. The exogenous TCR may consist of at least one ?-chain encoded by SEQ ID NO:4 or SEQ ID NO:8 and at least one ?-chain encoded by SEQ ID NO:16 or SEQ ID NO:20. In particular, the exogenous TCR may consist of two ?-chains encoded by SEQ ID NO:4 or SEQ ID NO:8 and two ?-chains encoded by SEQ ID NO:16 or SEQ ID NO:20.
(70) In particular, the sequence encoding the ?-chain comprises SEQ ID NO:40, SEQ ID NO:41 and SEQ ID NO:42 and/or the sequence encoding the ?-chain comprises SEQ ID NO:48, SEQ ID NO:49, and SEQ ID NO:50.
(71) More in particular, the sequence encoding the ?-chain of the HBs370-79 epitope-reactive exogenous TCR may have at least 80% sequence identity to SEQ ID NO:43 and the ?-chain of the HBs370-79 epitope-reactive exogenous T cell receptor has at least 80% sequence identity to SEQ ID NO:51. In particular, the sequence(s) encoding the ?-chain and ?-chain may be at least about 85%, at least about 90%, or at least about 95% identical to SEQ ID NO:43 and/or SEQ ID NO:51 respectively. More in particular, the sequence encoding the ?-chain may be SEQ ID NO:43 and SEQ ID NO:51, and/or the sequence encoding the ?-chain may be SEQ ID NO:51. The HBs370-79 epitope-reactive exogenous TCR may comprise two ?-chains encoded by the sequence SEQ ID NO:43 and two ?-chains encoded by SEQ ID NO:51. More in particular, the ?-chain and ?-chain may be encoded by nucleotide sequences that comprise the consecutive sequence shown in SEQ ID NO:43 and SEQ ID NO:51 respectively.
(72) According to another aspect, the present invention provides at least one isolated polypeptide encoded by the polynucleotides of the present invention.
(73) According to still another aspect, the present invention provides at least one isolated polypeptide comprising at least one amino acid sequence selected from the group consisting of SEQ ID NO:9, SEQ ID NO:10 and SEQ ID NO:11. In particular, the polypeptide may have at least 80% amino acid identity to SEQ ID NO:12. More in particular, the polypeptide may be at least about 85%, at least about 90%, or at least about 95% identical to SEQ ID NO:12.
(74) The present invention also provides at least one isolated polypeptide comprising at least one sequence selected from the group consisting of SEQ ID NO:44, SEQ ID NO:45 and SEQ ID NO:46. In particular, the polypeptide may have at least 80% amino acid identity to SEQ ID NO:47. More in particular, the polypeptide may be at least about 85%, at least about 90%, or at least about 95% identical to SEQ ID NO:47.
(75) The polypeptide may further comprise at least one sequence selected from the group consisting of SEQ ID NO:21, SEQ ID NO:22 and SEQ ID NO:23. In particular, the further sequence may have at least 80% amino acid identity to SEQ ID NO:24. More in particular, the further sequence may be at least about 85%, at least about 90%, or at least about 95% identical to SEQ ID NO:24. Even more in particular, the polypeptide may comprise the consecutive sequence of amino acids shown in SEQ ID NO:12 and SEQ ID NO:24 respectively.
(76) The polypeptide may further comprise at least one sequence selected from the group consisting of SEQ ID NO:52, SEQ ID NO:53 and SEQ ID NO:54. In particular, the further sequence may have at least 80% amino acid identity to SEQ ID NO:55. More in particular, the further sequence may be at least about 85%, at least about 90%, or at least about 95% identical to SEQ ID NO:55. Even more in particular, the polypeptide may comprise the consecutive sequence of amino acids shown in SEQ ID NO:47 and SEQ ID NO:55 respectively.
(77) The polypeptide according to the present invention may be at least one HBV epitope-reactive exogenous TCR. In particular, the polypeptide may be functionally equivalent to a specifically exemplified TCR sequence that may have been modified by single or multiple amino acid substitutions, by addition and/or deletion of amino acids, or where one or more amino acids have been chemically modified, but which nevertheless retains the binding specificity and high affinity binding activity of the TCR protein of the present invention to the HBV epitope. In particular, the HBV epitope may be HBc18-27, HBs370-79 or a mutant thereof. More in particular, the polypeptide may be at least one soluble TCR. Even more in particular, the soluble TCR protein may lack the portions of the native cell-bound TCR and may be stable in solution (i.e., it does not generally aggregate in solution when handled as described herein and under standard conditions for protein solutions).
(78) The soluble TCR may be prepared by any method known in the art. Examples of processes that may be used to prepare the soluble TCR may comprise but are not limited to constructing polymeric receptor chains in which an immunoglobulin heavy chain variable region from at least one phosphorylcholine-specific antibody may be substituted with TCR ? and ? variable regions, introducing translational termination codons upstream of the TCR transmembrane region or replacing the transmembrane domains of the TCR ? and ? chain cDNAs with a signal for glycosylphosphatidyl inositol (GPI) linkage from the carboxy terminus of the GPI linked protein Thy-1.
(79) The soluble TCR may be linked to at least one anti-viral drug. The anti-viral drug may target HBV. For example, anti-viral drugs may comprise, but are not limited to, adefovir dipivoxil, interferon alfa-2b, pegylated interferon alfa-2a, lamivudine, entecavir, telbivudine and the like.
(80) In particular, the soluble TCR may be linked to the anti-viral drugs to form soluble TCR-drug conjugates by any means known in the art. The link may be a chemical moiety comprising a covalent bond or a chain of atoms that covalently attaches a soluble TCR to a drug moiety. Linkers may comprise a divalent radical such as an alkylene, an arylene, a heteroarylene, moieties such as: (CR2)nO(CR2)n-; repeating units of alkyloxy (e.g. polyethylenoxy, PEG, polymethyleneoxy) and alkylamino (e.g. polyethyleneamino, Jeffamine?); and diacid ester and amides including succinate, succinamide, diglycolate, malonate, caproamide and the like.
(81) According to one aspect, the present invention provides at least one construct comprising the polynucleotide of the present invention operably connected to at least one promoter. The coding sequences for ?- and ?-chains of the TCR may be operably connected to at least one promoter functional in the isolated cell. Suitable promoters may be constitutive and inducible promoters, and the selection of an appropriate promoter may be well within the skill in the art. For example, suitable promoters may comprise, but are not limited to, the retroviral LTR, the SV40 promoter, the CMV promoter and cellular promoters (e.g., the ?-actin promoter).
(82) According to another aspect, the present invention provides at least one vector comprising the construct according to the present invention or the polynucleotide according to the present invention. In particular, the vectors may comprise, but not limited to, lentiviral vectors, retroviral vectors, adenoviral vectors, adeno-associated virus vectors and Herpes Simplex Virus vectors. More in particular, retroviral vectors may be used for delivery of the constructs either in vitro, ex vivo or in vivo, as described in the examples.
(83) According to still another aspect, the present invention provides at least one T cell comprising the vector, the construct or the polypeptide according to the present invention.
(84) According to one aspect, the present invention provides at least one method of preparing at least one T cell comprising at least one HBV epitope-reactive exogenous TCR for delivery to at least one subject comprising transducing at least one T cell isolated from the subject with the construct of and/or the vector of the present invention. Constructs and vectors according to the present invention may be delivered to cells in vitro, ex vivo or in vivo using any number of methods known to those of skill in the art. For example, if the cells are in vitro or ex vivo, they may be transformed or transduced according to standard protocols, e.g., those described in Molecular Cloning: A Laboratory Manual, 3d ed., Sambrook and Russell, CSHL Press (2001), incorporated herein by reference. Examples of methods may comprise but are not limited to, the CaCl.sub.2 chemical method, electroporation and the like. In particular, the constructs according to the present invention may be delivered into the cells in vivo. Suitable methods of delivery of polynucleotide constructs are known in the art, and may comprise but are not limited to, viral vectors, nanoparticles, gold particles, lipoplexes and/or polyplexes.
(85) According to another aspect, the present invention provides at least one method of preparing at least one HBV epitope-reactive exogenous TCR comprising: (a) isolating at least one HBV-epitope reactive T cell from at least one HBV-exposed individual that resolved HBV infection; (b) cloning at least one polynucleotide sequence encoding at least one ?- and/or ?-chain of at least one TCR from the HBV-epitope reactive T cell of step (a); (c) delivering the polynucleotide sequence of step (b) to at least one cell; and (d) incubating the cell under conditions suitable for expression of the HBV epitope-reactive exogenous T cell receptor by the cell.
(86) In particular, the HBV-epitope reactive T cell of step (a) mentioned above may be HBc18-27 epitope reactive and/or HBs370-79 reactive.
(87) According to one aspect, the present invention provides at least one cell, at least one vector and/or at least one polypeptide according to all aspects of the present invention, for use in the treatment of HBV infection and/or HBV-related hepatocellular carcinoma.
(88) According to another aspect, the present invention provides at least one method of treating HBV and/or inhibiting reactivation of HBV in at least one subject comprising administering to the subject at least one immunotherapeutically effective amount of cells, at least one vector and/or at least one polypeptide according to any aspect of the present invention.
(89) A further possible application of the HBV-TCR redirected approach is in patients with hepatocellular carcinoma (HCC). Chronic infection with HBV is the most important risk factor for the development of this liver tumour and integration of HBV-DNA into hepatocytes frequently occurs in tumour transformed cells. The therapy of HCC by conventional chemotherapy, radiation or surgical resection presents severe limitations. HBV-specific T cells have the potential to recognize and kill HCC cells expressing HBV antigens and adoptive transfer of HBV-TCR-redirected T cells may have the potential to obtain regression of HCC. Such results were obtained in nasopharyngeal carcinoma, a tumour expressing an Epstein-Barr Virus (EBV) protein, where infusion of EBV-specific CD8+ cells showed promising results. Vectors comprising polynucleotides encoding TCRs, and/or cells comprising at least one HBV-epitope reactive TCR may thus be useful in the treatment of HCC.
(90) Accordingly, the present invention provides at least one method of treating HBV-related hepatocellular carcinoma in at least one subject comprising administering to the subject at least one immunotherapeutically effective amount of cells, at least one vector and/or at least one polypeptide according to any aspect of the present invention.
(91) Vectors comprising polynucleotides encoding TCRs, and/or cells comprising at least one HBV-epitope reactive TCR prepared as described above, may be suitably administered to a subject to treat acute or chronic HBV infection or conditions (including, e.g., hepatocellular carcinoma) in the subject.
(92) The cells expressing HBV-epitope reactive TCRs, vectors comprising polynucleotides encoding HBV-epitope reactive TCR and/or the polypeptide encoding the HBV-epitope reactive TCR may be prophylactically administered to at least one subject to inhibit reactivation of HBV infection. In particular, vectors of the invention may be administered to cells from at least one subject ex vivo. More in particular, modes of administration of polynucleotide and/or viral vectors will be those that specifically and/or predominantly deliver the TCR coding sequences to T cells and/or hematopoietic stem cells. In the case of a retroviral vector, it may be anticipated that suitable dosages will range from about 0.1 ?g/10.sup.6 cells to about 10 ?g/10.sup.6 cells, such as in the range from about 1 ?g/10.sup.6 cells to about 5 ?g/10.sup.6 cells. More in particular, such dosages may prevent or reduce HBV-related symptoms at least 50% compared to pre-treatment symptoms or compared to a suitable control. Treatment with at least one retroviral vector according to the present invention may palliate or alleviate HBV infection and/or at least one associated condition, and/or may reduce incidence of progression to chronic HBV-associated conditions, without providing a cure. In particular, treatment may be used to cure or prevent an acute or chronic HBV infection or an associated condition, including hepatocellular carcinoma.
(93) In particular, the quantity of cells that make up the immunotherapeutically effective amount of cells to be administered depends on the subject to be treated. This may be dependent on but not limited to, the capacity of the individual's immune system to mount TCR-mediated immune response, the age, sex and weight of the patient and the severity of the condition being treated. The number of variables in regard to at least one individual's prophylactic or treatment regimen may be large, and a considerable range of doses may be expected. In particular, cells may be administered in at least one amount from 5?10.sup.5 cells/kg body weight to 1?10.sup.10 cells/kg body weight. More in particular, 5?10.sup.6 cells/kg body weight to 1?10.sup.8 cells/kg body weight may be administered. The maximal dosage of cells and/or viral vector to be administered to the subject may be the highest dosage that does not cause undesirable and/or intolerable side effects. Suitable regimens for initial administration and additional treatments may also be contemplated and may be determined according to conventional protocols.
(94) According to another aspect, the present invention provides at least one use of at least one cell, at least one vector according and/or at least one polypeptide according to any aspect of the present invention in the preparation of a medicament for treating HBV infection and/or HBV-related hepatocellular carcinoma.
(95) Suitable solid or liquid medicament preparation forms may be, for example, granules, powders, tablets, coated tablets, (micro) capsules, suppositories, syrups, emulsions, suspensions, creams, aerosols, drops or injectable solutions in ampule form and also preparations with protracted release of active compounds, in whose preparation excipients and additives and/or auxiliaries such as disintegrants, binders, coating agents, swelling agents, lubricants, flavourings, sweeteners or solubilizers are customarily used as described above. The medicaments may be suitable for use in a variety of drug delivery systems.
(96) According to one aspect, the present invention provides at least one in vitro method for diagnosing at least one subject that is able to resolve HBV infection, the method comprising: (a) providing at least one sample from at least one subject; (b) detecting the presence of at least one polynucleotide comprising, substantially consisting of or consisting of at least one nucleic acid sequence selected from SEQ ID NO: 4, SEQ ID NO: 8, SEQ ID NO: 16 and SEQ ID NO: 20, SEQ ID NO: 43, SEQ ID NO: 51, a homologue and/or a fragment thereof; and/or (c) detecting the presence of at least one polypeptide comprising, substantially consisting of or consisting of the amino acid sequence of SEQ ID NO: 12, SEQ ID NO: 24, SEQ ID NO: 47, SEQ ID NO: 55, a homologue and/or a fragment thereof;
(97) wherein the presence of the polynucleotide and/or the polypeptide is indicative of the subject being able to resolve the HBV infection.
(98) According to yet another aspect, the present invention provides at least one in vitro method for diagnosing at least one subject as having or as being at risk of having HBV infections and/or HBV related hepatocellular carcinoma, the method comprising: (a) providing at least one sample from at least one subject; (b) detecting the presence of at least one polynucleotide comprising, substantially consisting of or consisting of at least one nucleic acid sequence selected from SEQ ID NO: 4, SEQ ID NO: 8, SEQ ID NO: 16 and SEQ ID NO: 20, SEQ ID NO: 43, SEQ ID NO: 51, a homologue and/or a fragment thereof; and/or (c) detecting the presence of at least one polypeptide comprising, substantially consisting of or consisting of the amino acid sequence of SEQ ID NO: 12, SEQ ID NO: 24, SEQ ID NO: 47, SEQ ID NO: 55, a homologue and/or a fragment thereof;
(99) wherein the absence of the polynucleotide and/or the polypeptide correlates with the likelihood of the subject as having or as being at risk for having HBV-infection and/or HBV-related hepatocellular carcinoma.
(100) In particular, the test sample may be urine, blood, serum, sweat, and/or oral fluid samples. More in particular, the presence of at least one polynucleotide and/or polypeptide of the present invention may be determined using several methods known in the art. Some of the methods may comprise, but are not limited to, real time PCR, flow cytometry, PCR and/or geometric mean fluorescence intensity (MFI).
(101) According to still another aspect, the present invention provides at least one kit for detecting and/or treatment of HBV infection and/or HBV-related hepatocellular carcinoma, the kit comprising at least one cell, at least one vector and/or at least one polypeptide according to any aspect of the present invention. In particular, the kit may comprise at least one manual providing instruction on how to use the kit.
(102) TABLE-US-00001 TABLE1 SequencesofHBVeptiopereactiveexogenousTCRalpha3andbeta8 chainsandnaturallyoccurringHBc18-27epitopemutantpeptides. SEQID Name Sequence NO: CDR1alpha3(WT) AAAACTAGTATAAACAATTTA 1 CDR2alpha3(WT) TTAATACGTTCAAATGAAAGAGAG 2 CDR3alpha3(WT) TGTGCTACGTGGCTCTCTGGTTCTGCAAGGCAAC 3 TGACCTTT TCRalpha3(WT) ATGGAAACTCTCCTGGGAGTGTCTTTGGTGATTCT 4 ATGGCTTCAACTGGCTAGGGTGAACAGTCAACAG GGAGAAGAGGATCCTCAGGCCTTGAGCATCCAG GAGGGTGAAAATGCCACCATGAACTGCAGTTACA AAACTAGTATAAACAATTTACAGTGGTATAGACAA AATTCAGGTAGAGGCCTTGTCCACCTAATTTTAAT ACGTTCAAATGAAAGAGAGAAACACAGTGGAAGA TTAAGAGTCACGCTTGACACTTCCAAGAAAAGCA GTTCCTTGTTGATCACGGCTTCCCGGGCAGCAGA CACTGCTTCTTACTTCTGTGCTACGTGGCTCTCTG GTTCTGCAAGGCAACTGACCTTTGGATCTGGGAC ACAATTGACTGTTTTACCTGATATCCAGAACCCTG ACCCTGCCGTGTACCAGCTGAGAGACTCTAAATC CAGTGACAAGTCTGTCTGCCTATTCACCGATTTTG ATTCTCAAACAAATGTGTCACAAAGTAAGGATTCT GATGTGTATATCACAGACAAAACTGTGCTAGACAT GAGGTCTATGGACTTCAAGAGCAACAGTGCTGTG GCCTGGAGCAACAAATCTGACTTTGCATGTGCAA ACGCCTTCAACAACAGCATTATTCCAGAAGACACC TTCTTCCCCAGCCCAGAAAGTTCCTGTGATGTCAA GCTGGTCGAGAAAAGCTTTGAAACAGATACGAAC CTAAACTTTCAAAACCTGTCAGTGATTGGGTTCCG AATCCTCCTCCTGAAAGTGGCCGGGTTTAATCTG CTCATGACGCTGCGGCTGTGGTCCAGCTGA CDR1alpha3(OPT) AAGACATCAATCAACAACTTG 5 CDR2alpha3(OPT) CTGATTCGGAGTAATGAGCGGGAA 6 CDR3alpha3(OPT) TGTGCTACATGGCTGAGTGGCAGCGCACGGCAAT 7 TGACTTTT TCRalpha3(OPT) ATGGAGACCCTTCTGGGAGTGTCCCTCGTGATTC 8 TGTGGCTGCAGCTTGCTCGGGTGAATTCTCAGCA GGGCGAGGAAGACCCGCAGGCCCTTAGCATTCA GGAAGGGGAGAACGCTACCATGAATTGCTCATAC AAGACATCAATCAACAACTTGCAGTGGTACCGTCA GAACTCTGGGAGAGGACTCGTGCACCTGATCCTG ATTCGGAGTAATGAGCGGGAAAAACACTCTGGAA GGCTGAGGGTGACCCTCGATACCTCTAAAAAATC CTCCTCCCTGCTGATAACCGCCAGCAGGGCCGC CGACACCGCTTCCTACTTCTGTGCTACATGGCTG AGTGGCAGCGCACGGCAATTGACTTTTGGGAGTG GCACTCAGCTGACAGTGCTGCCCGACATCCAGAA TCCAGATCCCGCAGTGTATCAGCTGAGAGACTCA AAGTCAAGTGACAAGAGTGTGTGCCTGTTCACTG ATTTTGACTCTCAGACCAACGTCTCTCAGTCTAAG GACAGCGACGTTTACATCACTGACAAAACTGTGC TGGACATGCGCAGTATGGACTTTAAATCAAATTCC GCCGTGGCTTGGAGCAATAAGTCTGACTTCGCCT GTGCTAATGCTTTTAATAACTCCATCATTCCGGAG GATACATTTTTCCCTAGCCCCGAGTCATCCTGCGA CGTGAAGCTGGTGGAGAAGTCATTCGAGACCGAC ACCAATCTTAACTTTCAGAACCTGTCCGTTATCGG GTTTAGAATCCTGCTGCTGAAGGTTGCCGGATTC AACCTGCTTATGACGTTGCGCCTGTGGTCCAGCT GA CDR1alpha3 KTSINNL 9 CDR2alpha3 LIRSNERE 10 CDR3alpha3 CATWLSGSARQLTF 11 TCRalpha3 METLLGVSLVILWLQLARVNSQQGEEDPQALSIQEG 12 ENATMNCSYKTSINNLQWYRQNSGRGLVHLILIRSN EREKHSGRLRVTLDTSKKSSSLLITASRAADTASYFC ATWLSGSARQLTFGSGTQLTVLPDIQNPDPAVYQLR DSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTV LDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPE DTFFPSPESSCDVKLVEKSFETDTNLNFQNLSVIGF RILLLKVAGFNLLMTLRLWSS. CDR1beta8(WT) ATTTCAGGACACGACTACCTT 13 CDR2beta8(WT) TACTTTAACAACAACGTTCCGATA 14 CDR3beta8(WT) TGTGCCAGCAGCAATCGGGCGAGCTCCTAC 15 AATGAGCAGTTCTTC TCRbeta8(WT) ATGGACTCCTGGACCCTCTGCTGTGTGTCCCTTT 16 GCATCCTGGTAGCAAAGCACACAGATGCTGGAGT TATCCAATCACCCCGGCACGAGGTGACAGAGATG GGACAAGAAGTGACTCTGAGATGTAAACCAATTTC AGGACACGACTACCTTTTCTGGTACAGACAGACC ATGATGCGGGGACTGGAGTTGCTCATTTACTTTAA CAACAACGTTCCGATAGATGATTCAGGGATGCCC GAGGATCGATTCTCAGCTAAGATGCCTAATGCAT CATTCTCCACTCTGAAGATCCAGCCCTCAGAACC CAGGGACTCAGCTGTGTACTTCTGTGCCAGCAGC AATCGGGCGAGCTCCTACAATGAGCAGTTCTTCG GGCCAGGGACACGGCTCACCGTGCTAGAGGACC TGAAAAACGTGTTCCCACCCGAGGTCGCTGTGTT TGAGCCATCAGAAGCAGAGATCTCCCACACCCAA AAGGCCACACTGGTGTGCCTGGCCACAGGCTTCT ACCCCGACCACGTGGAGCTGAGCTGGTGGGTGA ATGGGAAGGAGGTGCACAGTGGGGTCAGCACAG ACCCGCAGCCCCTCAAGGAGCAGCCCGCCCTCA ATGACTCCAGATACTGCCTGAGCAGCCGCCTGAG GGTCTCGGCCACCTTCTGGCAGAACCCCCGCAAC CACTTCCGCTGTCAAGTCCAGTTCTACGGGCTCT CGGAGAATGACGAGTGGACCCAGGATAGGGCCA AACCTGTCACCCAGATCGTCAGCGCCGAGGCCTG GGGTAGAGCAGACTGTGGCTTCACCTCCGAGTCT TACCAGCAAGGGGTCCTGTCTGCCACCATCCTCT ATGAGATCTTGCTAGGGAAGGCCACCTTGTATGC CGTGCTGGTCAGTGCCCTCGTGCTGATGGCCATG GTCAAGAGAAAGGATTCCAGAGGCTAG CDR1beta8(OPT) ATCTCTGGGCACGACTACCTG 17 CDR2beta8(OPT) TATTTTAATAACAATGTGCCTATC 18 CDR3beta8(OPT) TGTGCCTCCTCCAACCGGGCCTCCTCTTAT 19 AACGAGCAGTTCTTC TCRbeta8(OPT) ATGGACAGCTGGACACTGTGCTGCGTGAGCCTGT 20 GCATTCTGGTGGCCAAGCACACCGACGCCGGCG TGATCCAGAGCCCTCGCCACGAGGTGACCGAAAT GGGCCAGGAGGTGACACTGCGCTGCAAGCCAAT CTCTGGGCACGACTACCTGTTCTGGTACAGGCAG ACCATGATGAGGGGCCTGGAACTGCTGATCTATT TTAATAACAATGTGCCTATCGATGACTCTGGCATG CCCGAGGACAGGTTCTCCGCCAAGATGCCCAAC GCCAGCTTCTCCACCCTGAAGATCCAGCCCTCCG AACCTAGGGACTCCGCCGTGTACTTCTGTGCCTC CTCCAACCGGGCCTCCTCTTATAACGAGCAGTTC TTCGGCCCTGGAACCCGCCTGACCGTGCTGGAG GACCTGAAAAATGTGTTTCCCCCCGAGGTGGCCG TGTTTGAACCAAGCGAGGCCGAGATCAGCCACAC ACAGAAGGCCACCCTGGTGTGTCTGGCCACCGG ATTCTATCCCGATCACGTGGAGCTGAGCTGGTGG GTGAACGGGAAGGAGGTGCACTCTGGCGTGAGC ACCGACCCTCAGCCACTGAAAGAGCAGCCCGCC CTGAATGATTCTCGGTACTGCCTGTCCAGCCGCC TGCGCGTGTCTGCCACCTTCTGGCAGAACCCCAG AAATCACTTCAGGTGCCAGGTGCAGTTCTATGGG CTGAGCGAGAACGACGAATGGACCCAGGACAGA GCCAAGCCTGTGACACAGATCGTGTCTGCCGAAG CCTGGGGCAGAGCCGACTGCGGCTTTACCAGCG AGAGCTACCAGCAGGGCGTGCTGTCCGCCACAAT TCTGTACGAGATCCTGCTGGGAAAGGCCACACTG TACGCCGTGCTGGTGAGCGCCCTGGTGCTGATG GCCATGGTGAAGCGGAAAGACTCCCGGGGCTGA CDR1beta8 ISGHDYL 21 CDR2beta8 YFNNNVPI 22 CDR3beta8 CASSNRASSYNEQFF 23 TCRbeta8 MDSVVTLCCVSLCILVAKHTDAGVIQSPRHEVTEMG 24 QEVTLRCKPISGHDYLFWYRQTMMRGLELLIYFNNN VPIDDSGMPEDRFSAKMPNASFSTLKIQPSEPRDSA VYFCASSNRASSYNEQFFGPGTRLTVLEDLKNVFPP EVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSW WVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRL RVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRA KPVTQIVSAEAWGRADCGFTSESYQQGVLSATILYE ILLGKATLYAVLVSALVLMAMVKRKDSRG HBc18-27peptide FLPSDFFPSV 25 (HBVgenotypeA/D/E/F) (WTC18-27) HBc18-27peptide FLPSDFFPSI 26 (HBVgenotypeB/C)(27I) NaturalVariant1 FLPNDFFPSV 27 NaturalVariant2 FLPNDFFPSA 28 NaturalVariant3 FLPADFFPSI 29 NaturalVariant4 FLPVDFFPSI 30 NaturalVariant5 FLPTDYFPSV 31 NaturalVariant6 FLPSDFYPPV 32 NaturalVariant7(26G) FLPSDFFPGV 33 NaturalVariant8(25M, FLPSDFFMGV 34 26G) NaturalVariant9(23Y) FLPSDYFPSV 35 NaturalVariant10(24L) FLPSDFLPSV 36 NaturalVariant11(21P) FLPPDFFPSV 37 NaturalVariant12(27A) FLPSDFFPSA 38 NaturalVariant13(24Y) FLPSDFYPSV 39
(103) TABLE-US-00002 TABLE2 SequencesofHBVeptiopereactiveexogenousTCRalpha12andbeta 7.8chainsandnaturallyoccurringHBe370-79epitopemutantpeptides. SEQID Name Sequence NO: CDR1alpha12(WT) GACCGAGGTTCCCAGTCC 40 CDR2alpha12(WT) ATATACTCCAATGGT 41 CDR3alpha12(WT) TGTGCCGTGAACCTCTATGCAGGCAAC 42 ATGCTCACCTTT TCRalpha12(WT) ATGATGAAATCCTTGAGAGTTTTACTAGTGATCCT 43 GTGGCTTCAGTTGAGCTGGGTTTGGAGCCAACAG AAGGAGGTGGAGCAGAATTCTGGACCCCTCAGTG TTCCAGAGGGAGCCATTGCCTCTCTCAACTGCAC TTACAGTGACCGAGGTTCCCAGTCCTTCTTCTGGT ACAGACAATATTCTGGGAAAAGCCCTGAGTTGATA ATGTTCATATACTCCAATGGTGACAAAGAAGATGG AAGGTTTACAGCACAGCTCAATAAAGCCAGCCAG TATGTTTCTCTGCTCATCAGAGACTCCCAGCCCAG TGATTCAGCCACCTACCTCTGTGCCGTGAACCTC TATGCAGGCAACATGCTCACCTTTGGAGGGGGAA CAAGGTTAATGGTCAAACCCCATATCCAGAACCCT GACCCTGCCGTGTACCAGCTGAGAGACTCTAAAT CCAGTGACAAGTCTGTCTGCCTATTCACCGATTTT GATTCTCAAACAAATGTGTCACAAAGTAAGGATTC TGATGTGTATATCACAGACAAAACTGTGCTAGACA TGAGGTCTATGGACTTCAAGAGCAACAGTGCTGT GGCCTGGAGCAACAAATCTGACTTTGCATGTGCA AACGCCTTCAACAACAGCATTATTCCAGAAGACAC CTTCTTCCCCAGCCCAGAAAGTTCCTGTGATGTCA AGCTGGTCGAGAAAAGCTTTGAAACAGATACGAA CCTAAACTTTCAAAACCTGTCAGTGATTGGGTTCC GAATCCTCCTCCTGAAAGTGGCCGGGTTTAATCT GCTCATGACGCTGCGGCTGTGGTCCAGCTGA CDR1alpha12 DRGSQS 44 CDR2alpha12 IYSNG 45 CDR3alpha12 CAVNLYAGNMLTF 46 TCRalpha12 MMKSLRVLLVILWLQLSWVWSQQKEVEQNSGPLSV 47 PEGAIASLNCTYSDRGSQSFFWYRQYSGKSPELIMF IYSNGDKEDGRFTAQLNKASQYVSLLIRDSQPSDSA TYLCAVNLYAGNMLTFGGGTRLMVKPHIQNPDPAV YQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYIT DKTVLDMRSMDFKSNSAVAWSNKSDFACANAFNN SIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLS VIGFRILLLKVAGFNLLMTLRLWSS CDR1beta7.8(WT) TCGGGTCATGTATCC 48 CDR2beta7.8(WT) TTCCAGAATGAAGCTCAA 49 CDR3beta7.8(WT) TGTGCCAGCAGCTCGGACTTTGGCAAT 50 CAGCCCCAGCATTTT TCRbeta7.8(WT) ATGGGCACCAGGCTCCTCTGCTGGGTGGTCCTG 51 GGTTTCCTAGGGACAGATCACACAGGTGCTGGAG TCTCCCAGTCCCCTAGGTACAAAGTCGCAAAGAG AGGACAGGATGTAGCTCTCAGGTGTGATCCAATT TCGGGTCATGTATCCCTTTTTTGGTACCAACAGGC CCTGGGGCAGGGGCCAGAGTTTCTGACTTATTTC CAGAATGAAGCTCAACTAGACAAATCGGGGCTGC CCAGTGATCGCTTCTTTGCAGAAAGGCCTGAGGG ATCCGTCTCCACTCTGAAGATCCAGCGCACACAG CAGGAGGACTCCGCCGTGTATCTCTGTGCCAGCA GCTCGGACTTTGGCAATCAGCCCCAGCATTTTGG TGATGGGACTCGACTCTCCATCCTAGAGGACCTG AACAAGGTGTTCCCACCCGAGGTCGCTGTGTTTG AGCCATCAGAAGCAGAGATCTCCCACACCCAAAA GGCCACACTGGTGTGCCTGGCCACAGGCTTCTTC CCTGACCACGTGGAGCTGAGCTGGTGGGTGAAT GGGAAGGAGGTGCACAGTGGGGTCAGCACGGAC CCGCAGCCCCTCAAGGAGCAGCCCGCCCTCAAT GACTCCAGATACTGCCTGAGCAGCCGCCTGAGG GTCTCGGCCACCTTCTGGCAGAACCCCCGCAACC ACTTCCGCTGTCAAGTCCAGTTCTACGGGCTCTC GGAGAATGACGAGTGGACCCAGGATAGGGCCAA ACCCGTCACCCAGATCGTCAGCGCCGAGGCCTG GGGTAGAGCAGACTGTGGCTTTACCTCGGTGTCC TACCAGCAAGGGGTCCTGTCTGCCACCATCCTCT ATGAGATCCTGCTAGGGAAGGCCACCCTGTATGC TGTGCTGGTCAGCGCCCTTGTGTTGATGGCCATG GTCAAGAGAAAGGATTTCTGA CDR1beta7.8 SGHVS 52 CDR2beta7.8 FQNEAQ 53 CDR3beta7.8 CASSSDFGNQPQHF 54 TCRbeta7.8 MGTRLLCWVVLGFLGTDHTGAGVSQSPRYKVAKR 55 GQDVALRCDPISGHVSLFWYQQALGQGPEFLTYFQ NEAQLDKSGLPSDRFFAERPEGSVSTLKIQRTQQED SAVYLCASSSDFGNQPQHFGDGTRLSILEDLNKVFP PEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELS WWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSS RLRVSATFWQNPRNHFRCQVQFYGLSENDEVVTQD RAKPVTQIVSAEAWGRADCGFTSVSYQQGVLSATIL YEILLGKATLYAVLVSALVLMAMVKRKDF HBs370-79peptide SIVSPFIPLL 56 (HBVgenotypeA/D) HBs370-79peptide NILSPFMPLL 57 (HBVgenotypeB) HBs370-79peptide NILNPFLPLL 58 (HBVgenotypeC)
(104) Having now generally described the invention, the same will be more readily understood through reference to the following examples which are provided by way of illustration, and are not intended to be limiting of the present invention.
EXAMPLES
(105) Standard molecular biology techniques known in the art and not specifically described were generally followed as described in Sambrook and Russel, Molecular Cloning: A Laboratory Manual, Cold Springs Harbor Laboratory, New York (2001).
(106) The following examples are provided to assist in a further understanding of the invention. The particular materials and conditions employed are intended to be further illustrative of the invention and are not limiting upon the reasonable scope of the appended claims.
Example 1
(107) Cloning Hepatitis B Virus Specific T Cell Specific for HBV Core 18-27 Epitope (HBc18-27)
(108) Peripheral blood lymphocytes (PBL) were isolated from fresh blood obtained from a HBV patient who was able to resolve the disease and who was of HLA haplotype HLA-A0201 herein referred to as a resolved HLA-A201 HBV patient. The blood was first heparinised and PBL were isolated using Ficoll-Paque density gradient centrifugation. PBL were then washed three times in Hanks Balanced Salt Solution (HBSS) (Invitrogen, Carlsbad, Calif.), resuspended in Aim-V medium, 2% human AB serum (Invitrogen, Carlsbad, Calif.), stimulated with 1 ?M of HBV core 18-27 epitope (HBc18-27 peptide; FLPSDFFPSV; SEQ ID NO: 25; Primm SRL, Milano, Italy) plus 20 U/ml interleukin-2- (R&D systems, Minneapolis, Minn.) and plated in a 24-well plate at 4?10.sup.6 cells/well for 10 days.
(109) The HBc18-27-specific CD8+ T cells prepared as above were then labelled with phycoerythrin (PE)-conjugated HLA-A2 class I pentamers herein referred to as HBc18-27-HLA-A201 pentamers and/or HLA-A2 pentamer (Proimmune, Oxford, United Kingdom) bearing the HBc18-27 epitope for 30 min at 37? C. and purified via magnetic cell sorting using anti-PE microbeads (Miltenyi Biotech, Surrey, United Kingdom). Following isolation, cells were labelled with Cy-chrome-conjugated anti-CD8+(BD Pharmingen, San Diego, Calif.) and the percentage of stained T cells were determined by Fluorescence-activated cell sorting (FACS) analysis using a FACScan flow cytometer (BD Biosciences, SanDiego, Calif.) and analyzed using CellQuest software (BD Biosciences). The flow cytometry method used is further described in Gehring et al. incorporated herein by reference. The results are shown in
(110) The CD8+ and HBc18-HLA-A201 pentamer positive T cells as mentioned above, were then cloned using the limiting dilution assay as described in Current Protocols in Immunology Copyright ? 2007 by John Wiley and Sons, Inc., and expanded in Aim-V 2% AB serum (Invitrogen, Carlsbad, Calif.), 20 U/ml IL-2, 10 ng/ml IL-7, and 10 ng/ml IL-15 (R&D systems, Minneapolis, Minn.) with 1.5 ?g/ml phytohemagglutinin (Sigma-Aldrich, Dorset, United Kingdom) using allogeneic irradiated PBL as feeder cells. Cells were plated at 1 cell/well on 96 well plates and wells positive for T cell growth were tested for HBc18-27 reactivity by intracellular cytokine staining for IFN-? according to the protocol provided in Gehring et al. incorporated herein by reference.
(111) Highly positive wells for peptide reactivity were then screened using the specific HBc18-27 HLA-A201 pentamer (Proimmune, Oxford, United Kingdom) and a T cell clone, referred to herein as C183 was selected for further study. The results, depicted in
(112) C183 thus was shown to be a clonal, CD8+, HBc18-27 specific cytotoxic T cell clone and was grown and maintained in Aim-V, 2% AB serum, 20 U/ml IL-2, 10 ng/ml IL-7, and 10 ng/ml IL-15 (R&D Systems, Abingdon, United Kingdom) in a 5% CO.sub.2 humidified incubator at 37? C.
Example 2
(113) Recognition of Tumor Cells and Primary Human Hepatocytes by C183 T Cell Clone
(114) HepG2 is a HLA-A2+, hepatocyte-like tumor cell line isolated from a primary hepatocellular carcinoma tumor (HCC). HepG2 cells (American Type Culture Collection, Rockford, Md.) were grown and maintained in RPMI 1640 supplemented with 10% heat-inactivated fetal bovine serum (FBS), 20 mM HEPES, 0.5 mM sodium pyruvate, 100 U/mI penicillin, 100 ?g/mI streptomycin, MeM amino acids, L-glutamine, MeM nonessential amino acids (Invitrogen, Carlsbad, Calif.), and 5 ?g/mI Plasmocin (InvivoGen, San Diego, Calif.) to prevent mycoplasma contamination. A derivative of this line, HepG2.105 (Kindly provided by Michael Nassal at the University of Freiberg) was engineered to express the entire HBV genome under the control of a doxycycline dependent regulator, which permits viral antigen to be expressed at various levels as described in Sun and Nassal, 2006. A vector control parental cell line, HepG2TA2-7 (Kindly provided by Michael Nassal at the University of Freiberg) was stably transfected with the doxycycline dependent regulator but not the HBV genome. Both cell lines HepG2.105 and HepG2TA2-7, were grown in Dulbecco's modified Eagle's medium supplemented with 10% tetracycline-approved FBS (BD Biosciences, San Diego, Calif.), 20 mM HEPES, 0.5 mM sodium pyruvate, 100 U/ml penicillin, 100 ?g/ml streptomycin, MeM nonessential amino acids (Invitrogen), 200 ?g/ml G418 sulfate, 80 ?g/ml Hygromycin B (AutogenBioclear, Wiltshire, United Kingdom). Doxycycline (0.1 to 100 ng/ml, BD Biosciences) was added to cultures to regulate HBV expression.
(115) The standard HepG2 cells were labeled with 0.75 ?M carboxyfluorescein succinimidyl ester (CFSE; Invitrogen) for 10 min at 37? C. Cells were washed, and CFSE-labelled targets were pulsed with 10.sup.?8 M HBc18-27 peptide (Primm SRL, Milano, Italy) for 1 h on ice. Unlabelled (0 M HBc18-27 peptide) and CFSE-labelled (plus HBc18-27 peptide) HepG2 cells were mixed together in a 1:1 ratio, 2?10.sup.5 cells of each HepG2 cell line, in 24-well plates and incubated overnight to permit HepG2 adherence. To determine if C183 was capable of killing HCC tumor cells, C183 clones obtained from Example 1 were co-cultured with the HepG2 cells that were adhered to the wells (targets). A total of 4?10.sup.5 of C183 clones were added to the targets and incubated for 5 h at 37? C. The resultant effector (C183):target (unlabelled+CFSE-labelled HepG2 cells) ratio was 1:1. After 5 h co-incubation, HepG2 cells were collected via trypsinization and cytotoxicity was determined by comparing ratio of peptide pulsed targets to unpulsed targets in wells+/?the addition of C183. The results shown in
(116) Further, to determine if C183 can recognize endogenously processed antigen presented by HCC cells, C183 was co-cultured with HepG2.105 or HepG2TA2-7 control line and then tested for cytokine production and cytotoxic degranulation (CD107a+ staining), an indirect measure of killing. 1?10.sup.5 cells of each HepG2.105 and HepG2TA2-7 cell line were seeded separately into 96-well plates and incubated overnight to permit HepG2 adherence. For cytotoxic degranulation assays, CD107a-PE antibody (BD Pharmingen, San Diego) was first added to all wells before a total of 1?10.sup.5 of C183 clones were added to each well with the adhered HepG2.105 or HepG2TA2-7 control line and incubated for 5 h at 37? C. The resultant effector (C183):target (HepG2.105 or HepG2TA2-7 control line) ratio was 1:1. Following the incubation, C183 T cells were harvested, washed and stained with Cy-chrome conjugated anti-CD8+ (BD Pharmingen, San Diego, Calif.) then permeabilized and fixed using Cytofix/Cytoperm (BD Pharmingen, San Diego) according to the manufacturer's instructions. Cells were washed and incubated with PE-conjugated anti-human IFN-? antibody (R&D systems) for 30 min on ice then washed and analyzed by flow cytometry using the FACScan flow cytometer (BD Biosciences, SanDiego, Calif.) and analyzed using CellQuest software (BD Biosciences). The flow cytometry method used is further described in Gehring et al. incorporated herein by reference.
(117) As shown in
(118) In order to determine if C183 T cell clone can respond to naturally infected hepatocytes, primary hepatocytes were isolated from HLA-A2+ or HLA-A2-explanted chronic HBV livers and co-cultured with C183 according to the procedure described below.
(119) Liver tissue was obtained from both HLA-A2+ or HLA-A2? explanted chronic HBV patients under informed consent according to ethical and moral guidelines of the institution. Tissue sections were collected in William's E medium (Sigma-Aldrich, Dorset, United Kingdom) and maintained at 4? C. for a maximum of 2 h before cell isolation. Hepatocytes were isolated by enzyme perfusion described for use with human liver by Strain et al. (Strain, Ismail et al. 1991) with some modifications. Briefly, a section of liver of about 100 to 200 g was cut, and exposed vessels on a single surface were cannulated with 3-mm internal diameter tubing. The tissue was perfused sequentially at 50 ml/min with 500 ml PBS-HEPES wash solution to remove William's E medium, 500 ml PBS-HEPES-0.5 mM EGTA, and again with 500 ml PBS-HEPES wash solution (The solutions were obtained from Invitrogen Ltd.). Finally, 300 ml enzyme solution (0.05% collagenase (Roche, Indianapolis, Ind.), 0.012% hyaluronidase (Sigma, Dorset, United Kingdom), 0.025% Dispase II (Roche), 0.005% DNase (Roche) containing 5 mM CaC1.sub.2), maintained at 41? C., was perfused with recirculation, and enzymatic digestion continued for 10 to 20 min until the liver was judged to be substantially softened. Tissue was mechanically dissociated in 200 ml Hanks' balanced salt solution (Invitrogen Ltd.) containing 10% FBS, 5 mM CaCl.sub.2. The cell suspension was filtered through a 60-?m cell strainer and pelleted at 37?g for 10 min at 4? C. Cells were washed three times in Hanks' balanced salt solution, after which viability and yield were assessed. Purified hepatocytes were used immediately after isolation. 100,000 primary hepatocytes/well were added to 96 well plates and 75,000 C183 clones were added to respective wells for 5 h with anti-CD107a-PE antibody (BD Pharmingen, San Diego) for degranulation plus 10 ?g/ml brefeldin A (Sigma-Aldrich). Following the incubation, T cells were harvested, washed and stained with Cy-chrome conjugated anti-CD8+ (BD Pharmingen, San Diego, Calif.) then permeabilized and fixed using Cytofix/Cytoperm (BD Pharmingen, San Diego) according to the manufacturer's instructions. Cells were washed and incubated with FITC-conjugated anti-human IFN-? antibody (R&D systems, Abingdon, UK) for 30 min on ice then washed and analyzed by flow cytometry using the FACScan flow cytometer (BD Biosciences, SanDiego, Calif.) and analyzed using CellQuest software (BD Biosciences). The flow cytometry method used is further described in Gehring et al. incorporated herein by reference.
(120) The results in
Example 3
(121) Recognition of Additional HLA-A2 Subtypes and Variant Peptides
(122) Chronic HBV infection is predominantly an Asian problem and it is thus important to know if the HBc18-27 specific TCR can recognize HLA-A2 subtypes that dominate in the Asian population. HBV has a total of five genotypes (A, B, C, D and G). The HBc18-27 epitope expressed by HBV genotypes B and C (FLPSDFFPSI; SEQ ID NO:26) are the most prevalent in Asia. Genotypes A and D, most prevalent in Europe and United states, (FLPSDFFPSV; SEQ ID NO:25) are characterized by a valine at position 27 whereas genotypes B and C are characterized by an isoleucine at position 27. This can have a profound impact on the ability of HBV patients to present the HBc18-27 epitope or it can affect TCR recognition of the epitope.
(123) The ability of C183 to recognize HBc18-27 epitope from genotypes B and C, and A and D presented by different subtypes of the HLA-A2 MHC class I family was determined using Epstein-Barr virus (EBV) transformed B cells with known subtypes of HLA-A2. (Kindly provided by Professor Chan Soh Ha at WHO Immunology and Training Research Centre, Singapore). EBV transformed B cells from any other source may be used in this procedure. The EBV transformed B cells (10.sup.5 cells/well) were loaded with increasing concentrations (1 pM-1000 pM) of HBc18-27 peptide from either HBV genotypes ND or HBV genotypes B/C for 1 h at 25? C. (HBV Genotype ND=FLPSDFFPSV (SEQ ID NO:25); Primm SRL; HBV genotype B/C=FLPSDFFPSI (SEQ ID NO:26), Genscript, Piscataway, N.J.) EBV B cells were washed with HBSS to remove excess peptide and co-cultured with 7.5?10.sup.4 C183 for 5 h in the presence of 10 ug/ml brefeldin A. IFN-? production was measured by intracellular cytokine staining to determine T cell activation as described in Gehring et al. incorporated herein by reference.
(124) The results are shown in
(125) To further show that the HBc-18-27 TCR transduced T cells recognize the HBc18-27 eptiope presented by multiple HLA-A2 subtypes and various mutants of the HBc18-27 epitope, EBV transformed B cells expressing HLA-A0201, -A0206 or -A0207 subtypes were loaded with increasing concentrations of HBV genotype ND HBc18-27 epitope (
(126)
Example 4
(127) Isolation of C183 T Cell Receptor Alpha and Beta Chain DNA
(128) Total RNA was isolated from 5?10.sup.6 C183 clones using TRIzol (Invitrogen). TCR alpha and beta chain cloning was performed on a contract basis by Primm SRL (Milano, Italy) and supplied in Topo blunt II cloning vector for downstream cloning.
(129) The sequence analysis revealed the presence of one TCR beta chain, V?8.2, and one TCR alpha chain, V?3 in C183. Further DNA sequence analysis using the Immunogenetics V-Quest algorithm (http://imgt.cines.fr/IMGT_vquest/share/textes/) identified 3 unique Complementarity Determining Region (CDR) in the V?3 chain (CDR1?: SEQ ID NO:9, CDR2?: SEQ ID NO:10, CDR3?: SEQ ID NO:11) and the three unique CDR in the V?8.2 chain (CDR1?: SEQ ID NO:21, CDR2?: SEQ ID NO:22, CDR3?: SEQ ID NO:23).
Example 5
(130) Retroviral Constructs Containing HBc18-27 Specific TCR (HBc18-27 TCR) and Lymphocyte Transduction
(131) TCR V?3 and TCR V?8.2 cDNA prepared according to Example 4 above, were cloned individually into retroviral vector MP71 as described in Engels, Cam et al. 2003. (Kindly provided by Professor Hans Stauss, Royal Free and UCL Medical School, London, UK) using a 5 Not-1 site and 3 BsrG1 sites (New England Biolabs, Ipswich, Mass.). TCR V?3, V?8.2 and MP71 vector were digested for 1 h at 37? C. with 10 U of each enzyme. Digested products were isolated on 1% agarose gel by electrophoresis and purified using Qiagen gel extraction kit. TCR chains and MP71 vector were mixed in 1:1 ratio and ligated overnight at 4? C. with T4 DNA ligase (Promega) to form retroviral constructsMP71-TCR V?3 and MP71-TCR V?8.2. These constructs were then sequenced to confirm DNA insert was correct.
(132) To determine the expression and function of the cloned TCR, the constructs were used for preparation of retroviral supernatant which was further used for T cell transduction as explained below. Expression of inserted alpha and beta chains was driven by viral long terminal repeats (LTR) found in each construct.
(133) Retroviral supernatants were prepared using a transient transfection method which comprised using Phoenix amphotropic packaging cell line (Clontech Laboratories, US) that was first plated at 2?10.sup.6 cells/dish and allowed to adhere for 24 h in Iscove's Modified Dulbecco's Medium (IMDM), 10% FBS, 25 mM HEPES, Glutamax (Invitrogen) and 5 ug/ml Plasmocin (Invivogen). Cells were transiently co-transfected using the CaCl.sub.2 method for 24 h with 9 ?g each of MP71-TCR V?3, MP71-TCR V?8.2 together with 6 ?g of amphotropic envelope (kindly provided by Professor Hans Stauss, Royal Free and UCL Medical School, London, UK) IMDM was then replaced with Aim-V 2% human AB serum and phoenix cells were incubated for an additional 24 h before retroviral supernatants were collected for transduction.
(134) Healthy donor and chronic HBV patient peripheral blood lymphocytes (PBL) were used to test expression and functionality of the cloned HBc18-27 TCR. Peripheral blood mononuclear cells (PBMC) were isolated from volunteers under informed consent by ficoll density gradient centrifugation. PBMC were stimulated with 600 U/ml interleukin-2 (IL-2; R&D Systems) and 50 ng/ml anti-CD3 (OKT-3; eBioscience, San Diego, Calif.) for 48 h. Untreated 24 well tissue culture plates were coated with 30 ug/ml Retronectin (Takara Bio, Otsu Shiga, Japan) overnight at 4? C. Wells were then washed with HBSS and blocked with PBS 2% BSA for 30 min. Lymphocytes were harvested, washed, counted and 5?10.sup.5 cells plated into retronectin coated wells and mixed with the retroviral supernatants collected as described above. Mock transduced cells which were included as negative control, were cultured with the supernatant from Phoenix cells that were not transfected with retroviral vectors. IL-2 was added to wells to final concentration of 600 U/ml. The lymphocytes were incubated for 24 h in the retroviral supernatant, after which time the medium was replaced with Aim-V 2% human AB serum plus 100 U/ml IL-2. Transduced and mock transduced cells were grown for additional 3 days. After 3 days, the cell surface expression of the TCR was measured in both the TCR transduced and mock transduced cells by immunofluorescence staining. CD8-PE-Cy7 (BD Biosciences), V?8-PE expression (Beckman Coulter) and HLA-A201-HBc18-PE pentamer (Proimmune) staining were quantified by flow cytometry. Flow cytometry was performed on stained cells using a FACs Canto flow cytometer (BD Biosciences), and data were analyzed with the FACs Diva program (BD Biosciences).
(135) As shown in
(136) The HBc18-27 TCR transduction efficiency is confirmed in
Example 6
(137) Function of HBc18-27 TCR Transduced T Cells
(138) To confirm that the introduced HBc18-27 TCR was functional, HLA-A2 positive T2 cells (American Type Culture Collection (Rockford, Md.)) were used to stimulate HBc18-27 TCR transduced or mock transduced lymphocytes. T2 cells were cultured in RPMI 1640 supplemented with 10% heat-inactivated fetal bovine serum (FBS), 20 mM HEPES, 0.5 mM sodium pyruvate, 100 U/mI penicillin, 100 ?g/mI streptomycin, MeM amino acids, Glutamax, MeM nonessential amino acids (Invitrogen Ltd) and 5 ?g/mI Plasmocin (InvivoGen, San Diego, Calif.). The T2 cells were pulsed with 1 ?g/mI HBc18-27 peptide for 1 hr and then washed to remove excess peptide.
(139) In order to stimulate the HBc18-27 TCR transduced lymphocytes, referred to herein as HBc18-27 TCR transduced T cells, that were prepared according to Example 5, the HBc18-27 TCR transduced or mock transduced T cells were co-cultured overnight with the two different types of T2 cells (pulsed with HBc18-27 peptide and not pulsed) at 37? C. with 2 ug/ml brefeldin A. The HBc18-27 TCR transduced and mock transduced T cells were then washed and stained with anti-CD8-PE-Cy7 (BD Pharmingen, San Diego, Calif.) fixed and permeablized using cytofix/cytoperm (BD Biosciences) according to manufacturer's instructions. T cells were then stained for TNF-?-Alexa 488, IL-2-PE and IFN-?-APC (BD Biosciences) for 30 min on ice. Cells were washed and analyzed by flow cytometry using FACs Canto flow cytometer (BD Biosciences), and data were analyzed with the FACs Diva program (BD Biosciences).
(140) The results are shown in
(141)
Example 7
(142) Affinity of HBc18-27 TCR Transduced T Cells
(143) Due to the possible decreased level of expression of the introduced HBc18-27 TCR, it was possible that the engineered T cells may have a lower affinity for the actual viral epitope compared to the original T cell clone, C183. To test this hypothesis, HLA-A2 positive T2 cells (American Type Culture Collection, Rockford, Md.) were pulsed with HBc18-27 peptide at concentrations ranging from 1 fg/ml to 1 ?g/ml according to the protocol described in Example 6. Peptide loaded T2 cells were co-cultured with TCR transduced T cells from 5 healthy donors, 5 HBeAg+ chronic HBV patients (HBV DNA >10.sup.7 copies/ml), and 5 HBeAg? chronic HBV patients (HBV DNA <10.sup.6 copies/ml) and the original T cell clone C183 for 5 h. T cell activation was measured by intracellular cytokine staining for IFN-?. Results are displayed at percent of maximum IFN-? response because the frequency of HBc18-27 TCR transduced cells varied among patients while C183 was always 100% specific for the HBc18-27 epitope. The results showed that CD8+ HBc18-27 TCR transduced T cells displayed an affinity identical to C183 down to 1 pg/ml (
(144) The affinity of HBc18-27 TCR transduced CD4+ T cells was determined in the same assay. CD8? HBc18-27 specific cells were considered CD4+ T cells because they were capable of responding to the HBc18-27 epitope in an antigen specific, dose dependent fashion. CD4+ HBc18-27 TCR transduced T cells showed slightly lower affinity compared to C183. The difference in the affinity to the viral epitope between CD8+ and CD4+ T cells may likely be due to CD8+ co-receptor binding, which stabilizes TCR interaction with the HLA-A2 molecule. The CD8+ co-receptor is absent on CD4+ T cells and therefore affinity is slightly reduced but still highly sensitive.
Example 8
(145) Codon Optimization of HBc18-27 TCR DNA Sequence
(146) Due to the presence of redundancy in the genetic code, most amino acids can be coded for by multiple codons, which are used with different frequencies and efficiencies within organisms and can actually result in less efficient translation of proteins. Due to genetic variation and the recombination events that occur during T cell development, DNA encoding for the HBc18-27 TCR may be comprised of codons that are not optimally translated within humans. Therefore, codon optimization for both the V?8.2 and V?3 chains of the HBc18-TCR was done to result in a more efficient expression of HBc18-27 TCR and increased sensitivity and function (Service by Genscript, Piscataway, N.J.).
(147) Codon optimized V?3 and V?8.2 were cloned individually into MP71 vector using 5Not-1 and 3BsrG1 restriction enzyme sites as described above. In order to confirm that the codon optimized TCR, referred to herein as HBc18-Opt-TCR, was still capable of being expressed, PBL were transduced with the HBc18-Opt-V?3 and HBc18-Opt-V?8.2 TCR constructs as described above. For the HBc18-27 wild type TCR, referred to herein as HBc18-WT-TCR, PBL were also transduced with the HBc18-WT-V?8.2 (MP71-TCR V?8.2 from example 7) and HBc18-WT-V?3 (MP71-TCR V?3 from example 7) for comparison. HBc18-27 transduced PBL were analyzed for V?8 expression and the ability to bind HBc18-HLA-A201 pentamers (Proimmune, Oxford, United Kingdom) by flow cytometry 3 days after transduction. Results showed that the frequency of V?8+ T cells was similar between PBL transduced with HBc18-Opt-TCR (21.5%) compared to HBc18-WT-TCR (21.1%) transduced cells (
(148) The amount of V?8 expressed in the HBc18-Opt-TCR transduced lymphocytes and HBc18-WT-TCR transduced lymphocytes was measured by mean fluorescence intensity (MFI) using the FACs Diva software (BD Biosciences) (
(149) To determine the ability to bind HBc18-HLA-A201 pentamers, the HBc18-Opt-TCR transduced lymphocytes and HBc18-WT-TCR transduced lymphocytes were labelled with anti-CD8-PE-Cy7 (BD Pharmingen, San Diego, Calif.) and HBc18-HLA-A201 pentamers (Proimmune, Oxford, United Kingdom). The percentages of stained lymphocytes were determined by Fluorescence-activated cell sorting (FACS) analysis using a FACs Canto flow cytometer (BD Biosciences, SanDiego, Calif.) and analyzed using FACs Diva software (BD Biosciences). The results showed that the frequency of HBc18-HLA-A201 pentamer positive cells was two fold higher in cells transduced with HBc18-Opt-TCR than the HBc18-WT-TCR (
(150) Following confirmation that the HBc18-Opt-TCR was properly expressed in the transduced T cells, we tested functionality of the HBc18-Opt-TCR compared to the HBc18-WT-TCR. HBc18-Opt-TCR and HBc18-WT-TCR or mock transduced T cells were stimulated overnight with HLA-A2 positive T2 cells in the presence or absence of HBc18-27 peptide plus 2 ?g/ml brefeldin A according to the protocol described in Example 6. T cells were then labelled with anti-CD8 PE-Cy7 (BD Pharmingen, San Diego, Calif.) and fixed and permeablized using cytofix/cytoperm according to manufacturer's instructions (BD Biosciences). Cells were then stained with anti-IFN-?-APC (BD Biosciences) for 30 min on ice and T cell IFN-? production was analyzed by flow cytometry.
(151) The results show that there was nearly a two fold increase in the frequency of IFN-? positive T cells transduced with the HBc18-Opt-TCR compared to T cells transduced with the HBc18-WT-TCR (
Example 9
(152) HBc18-27 TCR Transduced T Cells Kill HCC Cell Lines which Endogenously Express HBV Proteins or are Loaded with the HBV 18-27 Peptide.
(153) HBc18-27 TCR transduced T cells from each patient group (healthy, HBeAg(?), HBeAg(+)) were co-cultured with DiOC labeled HepG2 cells expressing the entire HBV genome (HBV-HepG2) or the parental control cell line (Ctrl-HepG2) at Effector:Target ratio of 1:1 for 6 h in the presence of Propidium Iodide (PI). Dying target cells were DiOC+/PI+. T cells were excluded from the analysis by staining with anti-CD11a-APC (BD Bioscience). Results are representative of 3 experiments. Effector T cells were considered to be IFN-?+/CD8+ cells determined by intracellular cytokine staining after stimulation with peptide pulsed T2 cells. The results as shown in
(154) To determine if TCR transduced T cells could kill multiple HLA-A2+ HCC cell lines, DiOC labeled HCC cell lines (HepG2 were obtained from ATCC; SNU-387, SNU-368 were obtained from the Korean cell line bank) were loaded with increasing concentrations of HBc18-27 peptides and co-cultured with HBc-18-27 TCR transduced T cells at Effector to target ratio of 1:1 for 6 h in the presence of Propidium Iodide (PI). Dying target cells were DiOC+/PI+. T cells were excluded from the analysis by staining with anti-CD11a-APC (BD Bioscience). Results are representative of 3 experiments. Effector T cells were considered to be IFN-?+/CD8+ cells determined by intracellular cytokine staining after stimulation with peptide pulsed T2 cells. The results as shown in
Example 10
(155) Cloning Hepatitis B Virus Specific T Cell Specific for HBV Envelope 370-79 Eptitope (HBs370-79)
(156) Peripheral blood lymphocytes (PBL) were isolated and prepared according to the method of Example 1 and stimulated with 1 ?M of HBV envelope 370-79 epitope (HBs370-79 peptide; SIVSPFIPLL; SEQ ID NO: 56; Primm SRL, Milano, Italy) plus 20 U/ml interleukin-2- (R&D systems, Minneapolis, Minn.) and plated in a 24-well plate at 4?10.sup.6 cells/well for 10 days.
(157) The HBs370-79-specific CD8+ T cells were enriched using IFN-? capture assay according to manufacturer's instructions. (Miltenyi Biotech, Surrey, United Kingdom).
(158) The IFN-?+ HBs370-79-specific T cells were then cloned using the limiting dilution assay as described in Current Protocols in Immunology Copyright ? 2007 by John Wiley and Sons, Inc., and expanded in Aim-V 2% AB serum (Invitrogen, Carlsbad, Calif.), 20 U/ml IL-2, 10 ng/ml IL-7, and 10 ng/ml IL-15 (R&D systems, Minneapolis, Minn.) with 1.5 ?g/ml phytohemagglutinin (Sigma-Aldrich, Dorset, United Kingdom) using allogeneic irradiated PBL as feeder cells. Cells were plated at 1 cell/well on 96 well plates and wells positive for T cell growth were tested for HBs370-79 reactivity by intracellular cytokine staining for IFN-? according to the protocol provided in Gehring et al. incorporated herein by reference. T cell clone, referred to herein as E10-1D was selected for further study.
(159) E10-1D HBs370-79 specific cytotoxic T cell clone was grown and maintained in Aim-V, 2% AB serum, 20 U/ml IL-2, 10 ng/ml IL-7, and 10 ng/ml IL-15 (R&D Systems, Abingdon, United Kingdom) in a 5% CO.sub.2 humidified incubator at 37? C.
Example 11
(160) Affinity and Function of HBs370-79 Specific TCR Transduced T Cells and Recognition of Genotype Variant Peptides
(161) Experiments similar to that described in Example 6 were carried out with HBs370-79 specific TCR transduced T cells. The E10-1D T cell clone or HBs370-79 TCR transduced T cells, recognize HBs370-79 epitope loaded HLA-A2+T2 cells. T2 cells were loaded with increasing concentrations of HBs370-79 peptide and co-cultured with E10-1D or HBs370-79 TCR transduced T cells for 5 h and stained for IFN-?. Data presented as percent maximum response to normalize differing frequency of each line. The results as shown in
(162) Experiments similar to that described in Example 3 were also carried out with HBs370-79 specific TCR transduced T cells. HBs370-79 TCR transduced T cells recognize genotypic variants of the HBs370-79 epitope (The sequences of the genotypic variants are provided in Table 2). HBs370-79 TCR transduced T cells were co-cultured with HLA-A2+ T2 cells loaded with 1 ?g/ml peptide of each genotype for 5 h and activation was assessed by CD107a labeling and staining for IFN-?. Genotype A & D sequences are identical. The results as shown in
REFERENCES
(163) Engels, B., H. Cam, et al. (2003). Retroviral vectors for high-level transgene expression in T lymphocytes. Hum Gene Ther 14(12): 1155-68. Gehring A. J et al. (2007). The Level of Viral Antigen Presented by Hepatocytes Influences CD8 T-Cell Function. J Virol.; 81(6): 2940-2949. Karlin S. and Altschul S. F, (1990). Methods for assessing the statistical significance of molecular sequence features by using general scoring schemes. Proc Natl Acad Sci USA.; 87(6): 2264-2268. Maini, M. and Bertoletti A (2006) The effect of pathogens on the immune system: Viral hepatitis. In immunodominance: The choice of the Immune System, J. A. Frelinger, ed (Weinheim: Wiley-VCH). Molecular Cloning: A Laboratory Manual, 3d ed., Sambrook and Russell, CSHL Press (2001). Schumacher et. al., (2002), Nat Rev. Immunol, Vol 2: 512. Strain, A. J., et al. 1991. Native and recombinant human hepatocyte growth factors are highly potent promoters of DNA synthesis in both human and rat hepatocytes. J Clin Invest 87:1853-7. Sun, D. and M. Nassal (2006). Stable HepG2- and Huh7-based human hepatoma cell lines for efficient regulated expression of infectious hepatitis B virus. J Hepatol 45(5): 636-45.