BIN1 EXPRESSION AS A MARKER OF CANCER
20180172693 ยท 2018-06-21
Assignee
Inventors
Cpc classification
A61P1/04
HUMAN NECESSITIES
G01N2800/52
PHYSICS
A61P43/00
HUMAN NECESSITIES
A61P1/18
HUMAN NECESSITIES
A61K31/405
HUMAN NECESSITIES
A61P15/00
HUMAN NECESSITIES
International classification
A61K31/405
HUMAN NECESSITIES
Abstract
Provided are methods for screening a subject for cancer. The methods involve obtaining a blood sample from the subject and determining a level of Bridging Integrator 1 (BIN1) isoforms comprising exon 12a in the sample. Optionally, the method involves determining a level of 12a+/13 BIN isoform (comprising exon 12a but lacking exon 13) in the sample. An elevated level of 12a+(e.g., 12a+/13) BIN1 isoforms in the blood sample indicates the subject has cancer. Also provided are methods for determining efficacy of a cancer therapy in a subject and methods of treating cancer. Isolated antibodies that selectively bind human 12a+ BIN1 are also provided as well as kits for determining 12a+/13 BIN1 isoforms.
Claims
1. A method of screening for cancer in a subject comprising: (a) obtaining a blood sample from the subject; (b) detecting a level of 12a+ Bridging Integrator 1 (BIN1) polypeptide in the sample; (c) detecting a level of 12a+/13+ BIN1 polypeptide in the sample; (d) comparing the detected level of step (b) to the detected level of step (c) to determine a 12a+/13 BIN1 value for the sample; (e) comparing the 12a+/13 BIN1 value from step (d) to one or more control values, wherein an elevated 12a+/13 BIN1 value indicates the subject has a cancer; and (f) obtaining a tissue sample from the subject identified in step (e).
2. The method of claim 1, wherein an elevated 12a+/13 BIN1 value is based on a threshold value determined by comparing a negative control value to one or more positive control values, wherein an 12a+/13 BIN1 value greater than the threshold value indicates the subject has a cancer.
3. The method of claim 2, wherein the threshold value is set at least one standard deviation above a mean negative control value.
4. The method of claim 2, wherein the threshold value is set at least two standard deviations above a mean negative control value.
5. The method of claim 2, wherein the threshold value shows no statistically significant difference as compared to a positive control value.
6. The method of claim 1, wherein the cancer is a carcinoma, sarcoma, or lymphoma.
7. The method of claim 6, wherein the cancer is selected from the group consisting of lung cancer, colorectal cancer, pancreatic cancer, ovarian cancer, thyroid cancer, lymphoma, melanoma, and sarcoma.
8. The method of claim 6, wherein the cancer is a lung cancer.
9. The method of claim 8, wherein the cancer is an adenocarcinoma, a squamous cell carcinoma, large cell carcinoma, or a small cell carcinoma.
10. The method of claim 1, wherein the subject is at risk of developing cancer.
11. The method of claim 10, wherein the subject is at risk of developing lung cancer.
12. The method of claim 11, wherein the subject at risk of developing lung cancer has a history of smoking, has been exposed to asbestos, has a personal or family history of lung cancer, or has a history of sustained exposure to passive smoke.
13. The method of claim 1, wherein the 12a+/13 BIN1 value and the one or more control values are normalized for the age of the subject.
14. The method of claim 1, wherein the subject is at least 50 years of age.
15. The method of claim 1, wherein 12a+ BIN1 polypeptides are detected using an 12a+ BIN1 specific antibody.
16. The method of claim 15, wherein the antibody selectively binds SEQ ID NO:1 but does not bind SEQ ID NO:3.
17. The method of claim 16, wherein the antibody is a monoclonal antibody or a recombinant antibody.
18. The method of claim 17, wherein the complementarity determining regions (CDRs) of the antibody heavy chain comprise the amino acid sequences SEQ ID NO:10, SEQ ID NO:11, and SEQ ID NO:12.
19. The method of claim 17, wherein the CDRs of the antibody light chain comprise the amino acid sequences SEQ ID NO:13, SEQ ID NO:14, and SEQ ID NO:15.
20. A method of determining efficacy of a cancer therapy in a subject, the method comprising: (a) obtaining a first blood sample from a subject with cancer prior to treatment with a first cancer therapy; (b) determining a first 12a+/13 BIN1 value in the first blood sample; (c) obtaining a second blood sample from a subject with cancer after at least one treatment with the first cancer therapy; (d) determining a second 12a+/13 BIN1 value in the second blood sample; (e) comparing the first 12a+/13 BIN1 value to the second 12a+/13 BIN1 value; and (e) selecting an second cancer therapy for the subject if the 12a+/13 BIN1 value increases or fails to decrease in the second blood sample as compared to the first blood sample or continuing to treat the subject with the first cancer therapy if the 12a+/13 BIN1 value decreases in the second blood sample as compared to the first blood sample.
21. The method of claim 20, wherein the cancer is a carcinoma, sarcoma, or lymphoma.
22. The method of claim 20, wherein the cancer is selected from the group consisting of a lung cancer, a colorectal cancer, a pancreatic cancer, an ovarian cancer, and a thyroid cancer.
23. The method of claim 22, wherein the cancer is a lung cancer.
24. The method of claim 23, wherein the cancer is an adenocarcinoma, a squamous cell carcinoma, large cell carcinoma, or a small cell carcinoma.
25. A method of treating cancer in a subject comprising (a) obtaining a blood sample from the subject; (b) detecting a level of 12a+ Bridging Integrator 1 (BIN1) polypeptide in the sample; (c) detecting a level of 12a+/13+ BIN1 polypeptide in the sample; (d) comparing the detected level of step (b) to the detected level of step (c) to determine an 12a+/13 BIN1 value for the sample; (e) comparing the 12a+/13 BIN1 value from step (d) to one or more control values; and (f) administering to the subject an inhibitor of indoleamine 2,3-dioxygenase (IDO) if an elevated 12a+/13 BIN1 value is determined.
26. The method of claim 25, wherein an elevated 12a+/13 BIN1 value is based on a threshold value determined by comparing a negative control value to one or more positive control values, wherein an 12a+/13 BIN1 value greater than the threshold value indicates the subject has a cancer.
27. The method of claim 26, wherein the threshold value is set at least one standard deviation above a mean negative control value.
28. The method of claim 26, wherein the threshold value is set at least two standard deviations above a mean negative control value.
29. The method of claim 26, wherein the threshold value shows no statistically significant difference as compared to a positive control value.
30. The method of claim 26, wherein the cancer is a carcinoma, sarcoma, or lymphoma.
31. The method of claim 26, wherein the cancer is selected from the group consisting of a lung cancer, a colorectal cancer, a pancreatic cancer, an ovarian cancer, and a thyroid cancer.
32. The method of claim 31, wherein the cancer is a lung cancer.
33. The method of claim 32, wherein the cancer is an adenocarcinoma, a squamous cell carcinoma, large cell carcinoma, or a small cell carcinoma.
34. The method of claim 25, wherein the level of exon 12a+ BIN1 polypeptide is determined using a 12a+ BIN1 specific antibody.
35. The method of claim 34, wherein the antibody selectively binds SEQ ID NO:1 but does not bind SEQ ID NO:3.
36. The method of claim 35, wherein the antibody is a monoclonal antibody or a recombinant antibody.
37. The method of claim 36, wherein the complementarity determining regions (CDRs) of the antibody heavy chain comprise the amino acid sequences SEQ ID NO:10, SEQ ID NO:11, and SEQ ID NO:12.
38. The method of claim 36, wherein the CDRs of the antibody light chain comprise the amino acid sequences SEQ ID NO:13, SEQ ID NO:14, and SEQ ID NO:15.
39. The method of claim 25, wherein the IDO inhibitor comprises 1-methyl-tryptophan or 1-methyl-D-tryptophan.
40-46. (canceled)
Description
DESCRIPTION OF DRAWINGS
[0010]
[0011]
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
DETAILED DESCRIPTION
[0021] Methods described herein are based on the finding that cancer can be detected in a subject by detecting in a blood sample from the subject elevated levels of a subset of BIN1 isoforms that contain the polypeptide encoded by exon 12a (12a+ BIN1). An elevated level of 12a+ BIN1 isoforms in a blood sample from the subject, as compared to a negative control level, indicates the subject has cancer. Accordingly, 12a+ BIN1 expression can be used as a marker to determine a diagnosis of cancer in the subject, determine the level of progression or metastatic potential of the cancer in the subject, and to follow the disease in the subject. Furthermore, 12a+ BIN1 expression can be used to determine the subtype of cancer in a subject as a means of selecting an effective therapy, including for example, an agent that affects the BIN1 pathway.
[0022] The Bridging integrator 1 (BIN1) gene encodes several isoforms of a nucleocytoplasmic protein through alternative splicing. Ten BIN1 isoforms have been identified to date with two isoforms being ubiquitously expressed while others are present only in specific tissues. Among different functions, BIN1 acts as a tumor suppressor through binding the oncogenic protein c-Myc. Accordingly, several studies have shown a decrease in BIN1 expression during cancer progression. Interestingly, there is increasing evidence that aberrant splicing of BIN1 and a consequently increase in the expression of specific isoform(s) correlates with cancer progression. Using public databases listed in Table 1, a study was performed to capture the sequence of the isoform 4 of BIN1 to identify germline and somatic mutations that can occur in the BIN1 sequence, and identifying correlations between alternate BIN1 splicing and expression during human disease progression.
TABLE-US-00001 TABLE 1 Databases used for BIN1 analysis ONIM (Online Mendelian Online Catalog of Human Genes and Genetic Disorders Inheritance in Man) HGMD (The Human Gene Resource providing comprehensive data on human inherited Mutation Database) disease mutations to genetics and genomic research. GWAS (Genome-wide Used to identify common genetic factors that influence health association studies) and disease. TCGA (The Cancer Genome Platform to search, download, and analyze data sets Atlas) COSMIC (Catalogue Of Store and display somatic mutation information and related Somatic Mutations In Cancer) details and contains information relating to human cancers HPRD (Human Protein Platform to visually depict and integrate information pertaining Reference Database) to domain architecture, post-translational modifications, interaction networks and disease association for each protein in the human proteome. Alamut Application that integrates genetic information from different sources in one, consistent and convenient environment to describe variants using HGVS nomenclature and help interpret. their pathogenic status. LOVD (Leiden Open Provide a flexible, freely available tool for Gene-centered Variation Database) collection and display of DNA variations. CancerGEM KB (Cancer An integrated, searchable knowledge base of cancer human Genomic Evidence-based genome epidemiology and genomic applications in cancer care Medicine Knowledge Base) and prevention DGV (Database of Genomic A curated catalogue of structural variation in the human genome Variants) GEO (Gene Expression Public functional genomics data repository supporting Omnibus) Minimum Information About a Microarray Experiment- compliant data submissions. KEGG (Kyoto Encyclopedia Bioinformatics resource for linking genomes to life and the of Genes and Genomes) environment. Others: NCBI, Ensembl, UnitProtKB, and GeneCards
[0023] The BIN1 gene is located on chromosome 2 (2q14) between 127,805,599 and 127,864,903 bps (source: NCBI), and comprises 20 exons which can be alternatively spliced to form at least ten different isoforms. The BIN1 protein contains distinct domains such as a BAR domain (BIN1-amphiphysin-Rvs167), a phosphoinositide-binding domain, a clathrin-associated protein-binding domain (CLAP), a Myc-binding domain (MBD), and a Src homology 3 domain (SH3) (Prendergast G C, et al., Biochim Biophys Acta. 2009 1795(1):25-36). The exon 12a encodes a part of the CLAP domain. Four isoforms of BIN1 contain the exon 12a including the longest isoform of BIN1 (variant 1: GenBank accession number AF004015) and BIN1+12a, also named transcript variant 4 (GenBank accession number AF068918, NM_139346, NP_647596). BIN1+12a lacks four in-frame exons and has an additional in-frame exon (exon 10) in the coding region, compared to BIN1 variant 1. A sequence alignment of BIN1 variant 1 and variant 4 is provided in
[0024] Several genetic mutations in the BIN1 gene have been associated with the muscle weakness disorder centronuclear myopathy. These mutations include a homozygous 105G-T transversion in the BIN1 gene, resulting in a lys35-to-asn (K35N) substitution, and a homozygous 451G-A transition resulting in an asp151-to-asn (D151N) substitution. In addition, a mutation which generates a prematurely terminated BIN1 protein was also identified with a homozygous 1723A-T transversion in the BIN1 gene, resulting in a lys575-to-ter (K575X) substitution. Finally, a homozygous 461G-A transition in exon 6 of the BIN1 gene, resulting in an arg154-to-gin (R154Q) substitution was also identified in a patient with autosomal recessive centronuclear myopathy. The isoform 8 of BIN1 (GenBank accession number AF068918), a variant which lacks five in-frame exons including exon 12a and has an additional in-frame exon (exon 10) in the coding region compared to BIN1 variant 1, is specifically expressed in skeletal muscle. Alternative splicing of this isoform 8, leading to the exclusion of exon 10 (phosphoinositide-binding domain) is associated with muscle weakness in Myotonic dystrophy. Finally, several single nucleotide polymorphisms (SNPs) have been described in the BIN1 gene, including two in exon 12a. No phenotypes have been identified with these two SNPs.
[0025] BIN1 acts as a tumor suppressor through binding to c-Myc and subsequently repressing its transcriptional activity. Accordingly, attenuated expression of BIN1 is observed in many cases of breast, prostate, lung, brain, and colon cancers. Interestingly, cancer-specific variants of the ubiquitous isoforms 9 and 10 present an aberrant inclusion of the CNS-specific exon 12a. 12a+ BIN1 isoforms are observed in many tumor cells and tumor cell lines, and represent a common missplicing events occurring in human cancer (Prendergast G C, et al., Biochim Biophys Acta. 2009 1795(1):25-36). For example, these 12a+ BIN1 isoforms are aberrantly expressed in melanoma and this alternative splicing abolishes the tumor suppressor activity of BIN1 allowing c-Myc overexpression without induction of programmed cell death (Ge K, et al., Proc. Natl. Acad. Sci. U.S.A 1999 96(17):9689-94; Xu Q, et al., Nucleic Acids Res. 2003 31(19):5635-43).
[0026] Somatic mutations in the BIN1 gene, both missense and synonymous, have also been reported in several cases of cancer including skin (in 3 out of 8 samples), brain (2/469), lung (1/11), ovary (3/3), large intestine (2/14), and prostate (3/4) cancers.
[0027] In addition, increases in BIN1 levels have been observed in different types of cancer or during cancer progression. Gene array analysis of the SW480 colon carcinoma cell line, and their relative lymph node metastatic SW620 cells showed statistically significant increase in BIN1 transcript level in the metastatic cells SW620 compared to the SW480 cells isolated from the primary tumor. In another study in which 22 primary human advanced gastric cancer tissues and 8 noncancerous gastric tissues were analyzed by high-density oligonucleotide, the level of BIN1 transcript was higher in 40% of patient cancer tissues compare to normal gastric tissues. Other studies measured the expression of the BIN1 protein in tissues of patients with different cancers using antibodies against the N-terminal or the C-terminal domain of BIN1. The results showed strong expression of BIN1 in malignant lymphoma (in 75% of cases), in malignant glioma (48%), and in testis cancer (43%). In addition, a moderate to strong staining was observed in cancer tissues of patients with colorectal (in 73% of cases), prostate (100%), ovarian (62%), skin (66%), renal (75%), and lung (46%) cancers. (source: HPRD).
[0028] Thus, the bridging integrator 1 (BIN1) gene encodes a nucleocytosolic protein that was initially identified as a Myc-interacting protein with features of a tumor suppressor. BIN1 is also known as amphiphysin II, amphiphysin-like, and box dependent MYC interacting protein 1. Alternative splicing of the BIN1 pre-mRNA transcript results in at least eleven transcript variants encoding different isoforms. Some isoforms of BIN1 are expressed ubiquitously, while others show a tissue specific expression. BIN1 isoforms 1-7 are expressed in neurons. Isoform 8 is skeletal muscle specific, while isoforms 9 and 10 are ubiquitous. Isoforms that are expressed in the central nervous system may be involved in synaptic vesicle endocytosis and may interact with dynamin, synaptojanin, endophilin, and clathrin. Aberrant splice variants expressed in tumor cell lines have also been described, which include isoforms that include exon 12a that is normally spliced into BIN1 mRNA with other exons (exons 12b-12d) in the central nervous system. Exon 12a can have the following nucleotide sequence: 5-CTCCGGAAAG GCCCACCAGT CCCTCCGCCT CCCAAACACA CCCCGTCCAA GGAAGTCAAG CAGGAGCAGA TCCTCAGCCT GTTTGAGGAC ACGTTTGTCC CTGAGATCAG CGTGACCACC CCCTCCCAG-3 (SEQ ID NO:2). Alternatively, the nucleotide sequence shows at least 85, 90, or 95 percent identity to SEQ ID NO:2 and such variations may or may not result in amino acid changes in the expressed protein.
[0029] BIN1 is generally considered a tumor suppressor. However BIN1 protein isoforms containing 12a act as a tumor-promotor. Without exon 12a, BIN1 is a tumor suppressor by sequestering myc through its myc-binding domain, which is encoded by exons 13 and 14. However, on malignant transformation, 12a+ BIN1 does not sequester the Myc oncogene, freeing Myc to drive the cells into proliferation. Thus an assay specific for 12a+ BIN1 can detect a physiological state in which cancer BIN1 predominates and/or is active.
[0030] There are at least five isoforms of BIN1 that contain the polypeptide encoded by exon 12a (12a+ BIN1): isoforms 1, 4, 5, 6 (also referred to herein as Ca-1), and the isoform referred to herein as Ca-2. As disclosed herein, presence of the Ca-1 and/or Ca-2 isoforms are particularly indicative of cancer. The disclosed method can therefore involve determining the level of a subset of BIN1 isoforms, including the levels of Ca-1, Ca-2, or a combination thereof. Therefore, the disclosed method can involve determining the Ca-1 and/or Ca-2 isoform level in the blood sample.
[0031] Isoform Ca-2 differs from isoforms 1, 4, 5, and 6 by the absence of the polypeptide encoded by exon 13. Therefore, the disclosed method can further involve detecting a blood level of BIN1 isoforms that contain a polypeptide encoded by at least both exon 12a and exon 13 (i.e., 12a+/13+ BIN1), thereby excluding the Ca-2 isoform. The ratio or the difference of all 12a+ BIN1 isoforms to that of the 12a+/13+ subset determines the level of the Ca-2 (i.e., 12a+/13 BIN1) isoform. Ca-1 levels can likewise be specifically determined by, for example, detecting a polypeptide encoded by at least exons 10 and 12a of BIN1.
[0032] Reference therefore to determination of Ca-1 and/or Ca-2 isoform levels as used throughout includes the detection of 12a+ BIN1 (i.e., polypeptides encoded by exon 12a) and optional detection of 13+ BIN (i.e., polypeptides encoded by exon 13a) and/or 10+ BIN1 (i.e., polypeptides encoded by exon 10) to isolate and determine levels of Ca-1 (10+/12a+ BIN1) and/or Ca-2 (12a+/13 BIN1) isoforms.
[0033] Provided herein are methods of diagnosing cancer in a subject. The methods comprise obtaining a blood sample from the subject and detecting a level of Ca-1 and/or Ca-2 isoforms in the sample. An elevated level of Ca-1 and/or Ca-2 isoforms, particularly levels of the Ca-2 isoform, above a control level indicates that the subject has cancer. Therefore, if the subject has an elevated level of Ca-1 and/or Ca-2 isoforms, the method can further comprise obtaining a tissue sample (biopsy) from the subject, e.g., for histological examination, or other analysis for the purpose of confirming and further defining the cancer. Other steps of diagnosis are known to those of skill in the art and include additional laboratory tests (e.g., additional blood tests, urine tests, or tissue analysis using the same BIN1 markers or other markers), imaging, and the like. Blood tests that can be used concurrently or subsequent to the BIN1 analysis include analysis of prostate-specific antigen (PSA), cancer antigen 125 (CA125), calcitonin, alpha fetoprotein (AFP), human chorionic gonadotropin (HCG), and others. In addition, if the subject has elevated level of Ca-1 and/or Ca-2 isoforms, the method can further comprises imaging the subject to confirm the presence of cancer. Diagnostic imaging techniques for cancer include X-ray, CT, PET. MRI, and ultrasound.
[0034] The disclosed method can involve detecting the level of a subset of the 12a+ BIN1 isoforms, including the levels of Ca-1, Ca-2, or a combination thereof. Therefore, the disclosed method can comprise detecting a level of 12a+/13 (Ca-2) BIN1 isoform in the sample and comparing it to a control level. Therefore, the method can comprise obtaining a blood sample from the subject, detecting a level of 12a+ BIN1 isoforms in the sample, detecting a level of 12a+/13a+ BIN1 isoforms in the sample, comparing the detected level of 12a+ BIN1 isoforms to the detected level of 12a+/13a+ BIN1 isoforms to determine an 12a+/13 BIN1 (Ca-2) value for the sample, and comparing the 12a+/13 BIN1 (Ca-2) value to one or more control values. In these methods, an elevated 12a+/13 BIN1 (Ca-2) value indicates the subject has a cancer or a likelihood of cancer such that the subject requires additional testing. Therefore, if the subject has an elevated 12a+/13 BIN1 (Ca-2) value, the method can further comprise obtaining a tissue sample from the subject, e.g., for histological examination, or other analysis for the purpose of confirming and further defining the cancer as described above.
[0035] Control levels can be used to establish a threshold value. e.g., such that a Ca-1 and/or Ca-2 value greater than the threshold value indicates the subject has cancer. This threshold value can be determined empirically by comparing positive controls (samples from subjects with cancer or a particular type or stage of cancer) and negative controls (samples of subjects without cancer or who have been successfully treated for cancer). Such controls are optionally age matched or matched according to cancer type or stage. In order to distinguish elevated Ca-1 and/or Ca-2 values, the threshold value can be set at least 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, or 5 standard deviations above the mean negative control value. Other statistical methods can be used to set a threshold value that is within the desired predictive power needed for the assay. For example, the threshold value can be set such that there is no statistically significant difference between the threshold value and the positive control values using routine statistical analysis.
[0036] As used herein, a negative control level can be determined from a different subject(s) without cancer, or the same subject(s) prior to the diagnosis of cancer. Likewise, a positive control value can be determined from one or more subjects with cancer. Alternatively, the positive control can be based on one or more samples containing known concentrations of BIN1 isoform(s), such as recombinant BIN1, as in a standard control.
[0037] Optionally, the 12a+ BIN1 polypeptide sequence comprises the amino acid sequence LRKGPPVPPP PKHTPSKEVK QEQILSLFED TFVPEISVTT PSQ (SEQ ID NO:1). Alternatively, the amino acid sequence can be at least 85, 90, or 95 percent identical to SEQ ID NO:1. Variations in the sequence can include amino acid insertions, deletions, or substitutions (including, for example, 1-5 conservative amino acid substitutions).
[0038] Optionally, the cancer is a solid tumor (e.g., a carcinoma, melanoma, sarcoma, lymphoma, or neuroblastoma) or a blood-based cancer (e.g., leukemia or lymphoma). The cancer can, for example, be a primary cancer or a metastatic cancer. The cancer can be selected from the group consisting of a lymphosarcoma, a lymphosarcoma, an oral Sarcoma, a soft tissue sarcoma, or a mast cell tumor. The cancer can be selected from the group consisting of a melanoma, a lymphoma, a myoma, a myosarcoma, a round cell tumor, an adenocarcinoma, a fibrosarcoma, or an adenosarcoma. The cancer can be selected from the group consisting of a myelolipoma, osteosarcoma, hemangiosarcoma, sebaceous cancer, hepatic adenoma, and fibrosarcoma. The cancer can be selected from the group consisting of a lung cancer, breast cancer, brain cancer, liver cancer, prostate cancer, colon cancer, gastric cancer, pancreatic cancer, bone cancer, ovarian cancer, uterine cancer, cervical cancer, testicular cancer, bladder cancer, renal cancer, thyroid cancer, and leukemia. For example, the cancer can be a lung cancer, colorectal cancer, pancreatic cancer, ovarian cancer, or a thyroid cancer. The lung cancer can be an adenocarcinoma, a squamous cell carcinoma, large cell carcinoma, or a small cell carcinoma. The lung cancer can also be a mesothelioma.
[0039] The blood sample can be, for example, whole blood, plasma, or serum. A blood sample can be obtained by peripheral vein puncture (venipuncture) or other methods known in the art. The blood sample can be obtained from a subject with cancer, or alternatively, from a subject at risk of developing cancer. For example, the subject can be at risk of developing lung cancer. Risks associated with lung cancer include smoking exposure to asbestos, personal or family history of lung cancer, or sustained passive exposure to smoke.
[0040] Optionally, the cancer is stage 0, stage I, stage II, stage Ill, or stage IV cancer. Classifying a cancer by stage uses numerals 0, 1, II, III, and IV to describe the progression of cancer. The stage of a cancer indicates how much the cancer has spread and may take into account size and metastasis of the tumor to distant organs. Stages 0, I, and II cancers are considered early stage tumors. Stages III and IV are considered late stage cancers. Stage 0 indicates carcinoma in situ, i.e., an early form of a carcinoma defined by the absence of invasion of surrounding tissues. Stage I cancers are localized to one part of the body. Stage II cancers are locally advanced, as are stage III cancers. Whether a cancer is designated as stage II or stage II therefore differs according to diagnosis. Stage IV cancers have metastasized or spread to other organs or throughout the body. The provided methods can be used to diagnose early stage cancers (stages 0, I, and II) as well as late stage (stages III and IV) cancers.
[0041] The provided methods can also be used to differentiate early stage (stage 0, I, or II) from late stage (Ill or IV) cancer, or to monitor cancer progression. Specifically, blood levels of Ca-1 and/or Ca-2 increases in some late stage cancers as compared to early stage or control. Therefore, blood levels of eCa-1 and/or Ca-2 in some 0, I, and II stage cancers is lower than the blood level of Ca-1 and/or Ca-2 in the corresponding stage III or IV cancers. Blood levels of eCa-1 and/or Ca-2 can increase in certain cancers with increased metastasis or with an increased tumor size. Thus, provided are methods of determining a stage of progression of a cancer in a subject. The methods comprise selecting a subject with cancer, obtaining a blood sample from the subject, and determining a blood level of Ca-1 and/or Ca-2 isoforms, or a calculated value thereof, in the sample. The blood level of Ca-1 and/or Ca-2 isoforms can be compared to a known value or reference sample or with a previous blood sample from the subject.
[0042] The blood level of Ca-1 and/or Ca-2 isoforms or a calculated value thereof can, for example, be compared to a previous blood sample from the subject. A previous blood sample can be a sample from the same subject isolated at a time prior to the isolation of the most recent blood sample. A higher level of expression as compared to a previous blood sample indicates progression or metastasis of the cancer. Progression or metastasis generally indicates the need for additional testing, a change in treatment dosage or frequency, or a more aggressive treatment (i.e., a new treatment agent). A lower level of expression as compared to previous blood sample indicates improvement in the cancer. Generally, such an improvement indicates the success of the treatment. In such case, the treatment can be continued or even discontinued if the level or calculated value thereof for Ca-1 and/or Ca-2 isoforms is sufficiently low.
[0043] The blood level of Ca-1 and/or Ca-2 isoforms or calculated value thereof can, for example, be compared to a known value or a reference sample(s). A lower blood level of Ca-1 and/or Ca-2 isoforms or calculated value thereof as compared to a known value or a reference sample for a stage III or IV cancer can indicate the subject has stage 0, I, or II cancer. A higher level of Ca-1 and/or Ca-2 isoforms or calculated value thereof as compared to a known value or a reference sample for a stage 0, I, or II cancer can indicate the subject has stage III or IV cancer. Comparable levels of Ca-1 and/or Ca-2 isoforms or calculated value thereof to a known value or reference sample for a stage 0, I, II, III, or IV cancer can indicate the subject has a stage 0, I, II, III, or IV cancer, respectively.
[0044] As used herein, a known value refers to a value (e.g., blood level of Ca-1 and/or Ca-2 isoforms) obtained from a nondiseased sample, a diseased sample, or a group of samples, which can represent, for example, an untreated sample, a sample from the same subject at various stages and/or treatment conditions, or a sample from a different subject (treated or untreated). A known value can, for example, be a value obtained from a blood sample from the same subject prior to the treatment of the cancer, wherein the cancer has been assigned a designated stage (e.g., a stage I cancer). A known value can, for example, be a value obtained from a blood sample from the same subject after treatment of the cancer. A reference sample can, for example, include an untreated subject with stage 0, I, II, III, or IV cancer. By way of another example, a reference sample can include a treated subject with stage 0, I, II, III, or IV cancer. By way of another example, a reference sample can be the baseline level of expression in a subject with a stage 0, I, II, III, or IV cancer. Reference samples or value can include a known value or can be positive or negative control samples (optionally, matched for age, stage of cancer, or type of cancer with the experimental sample(s)) run in parallel with the experimental sample.
[0045] Ca-1 and/or Ca-2 isoform levels are in some cases higher in younger subjects than in older subjects. Therefore, in some cases, the subject of the disclosed methods is at least 35, 40, 45, 50, or 55 years of age. Optionally, the blood level of Ca-1 and/or Ca-2 isoforms and positive and negative control values are normalized for the age of the subject.
[0046] Also provided is a method of determining efficacy of a cancer therapy in a subject based on a change or changes in the Ca-1 and/or Ca-2 blood levels or calculated value thereof. The method comprises obtaining a first blood sample from a subject with cancer prior to treatment with a first cancer therapy, determining a first Ca-1 and/or Ca-2 value in the first blood sample (i.e., as a baseline measurement), obtaining a second blood sample from a subject with cancer after at least one treatment with the first cancer therapy, determining a second Ca-1 and/or Ca-2 value in the second blood sample (i.e., as a means of assessing the treatment effect), and comparing the first value to the second value. In this method, a decrease in Ca-1 and/or Ca-2 from the first to the second blood sample is an indication of effective cancer therapy that can be continued, e.g., until blood levels reach negative control levels or reduced to a maintenance dosing regimen. However, minimal decrease or an increase in Ca-1 and/or Ca-2 isoform levels from the first to the second blood sample is an indication that the cancer therapy is insufficiently effective and that a second cancer therapy or an increase in dosing regimen (increased dosage or frequency using the current treatment agent) for the subject should be selected. A second cancer therapy can also include administration of multiple chemotherapeutics in combination, surgery, and/or radiation therapy. One of skill in the art can determine the proper dosages or change in treatment regimen.
[0047] BIN1 isoforms without the polypeptide encoded by exon 12a function as tumor suppressors, and this activity may be related to the suppression of indoleamine 2,3-dioxygenase (IDO) (Muller A J, et al., Nature Medicine 2005 11(3):312-319). IDO has been shown to be active in particular forms of cancer, including lung cancer (Smith C, et al., Cancer Discovery 2012 2(8):723-735). Cancer therapeutics are being developed that mimic BIN1 suppression of IDO (Novitskiy S V and Moses H L. Cancer Discovery 2012 2(8):673-5). The disclosed methods may therefore by used to detect the physiological state in which IDO is active. Because IDO blocking agents are being developed as cancer therapeutics, the disclosed methods may be used to identify that particular subset of cancer patients who will respond to IDO blocking therapeutics. Among the current clinical trials registered using IDO antagonists, lung cancer is being targeted, and a significant portion of lung cancers are shown herein to have a high blood levels of BIN1 cancer isoform signal.
[0048] Therefore, also provided are methods of treating cancer in a subject that comprise administering an inhibitor of IDO to the subject having an elevated Ca-1 and/or Ca-2 value. The method involves obtaining a blood sample from the subject, determining a blood level of Ca-1 and/or Ca-2 isoforms or a calculated value thereof, and comparing these levels to one or more control levels or values. In these methods, determination of elevated blood levels of Ca-1 and/or Ca-2 isoforms or a calculated value thereof is an indication that the subject has a subset of cancers that should be treated with an inhibitor of IDO. Examples of IDO inhibitors include 1-methyl-tryptophan (1-MT), 1-methyl-D-tryptophan, and INCB024360 (InCyte, Wilmington, Del.).
[0049] Ca-1 and/or Ca-2 may also be a more specific marker in disease states that correspond to an elevated blood level of IDO such as tuberculosis. Therefore, also disclosed are methods of using Ca-1 and/or Ca-2 as a diagnostic and as an assay for evaluating the treatment effectiveness of IDO-related diseases.
[0050] Also provided are methods of detecting the recurrence of cancer in a subject. The methods comprise selecting a subject with a cancer in remission, obtaining a blood sample from the subject, and determining a level of Ca-1 and/or Ca-2 isoforms or a calculated value thereof in the blood sample. An elevated level of Ca-1 and/or Ca-2 isoforms or calculated value thereof as compared to a negative control level or value indicates that the subject has a recurrence of cancer or is at risk for a recurrence of cancer. If recurrence or the risk of recurrence is detected, additional tests or therapy can be performed. Such tests and therapy are described herein and are within the skill in the art.
[0051] The level of Ca-1 and/or Ca-2 isoforms can, for example, be determined by detecting 12a+ BIN1 polypeptide in the biological sample. Optionally, the level of 12a+ BIN1 polypeptide is determined using an antibody that is specific for the polypeptide encoded by exon 12a of BIN1 (12a+ BIN1) specific antibody. For example, the antibody can optionally selectively bind SEQ ID NO:1 (polypeptide encoded by exon 12a) but does not bind isoform 2, which lacks exon 12a. Human BIN1 isoform 2 can have the following amino acid sequence:
TABLE-US-00002 (SEQ ID NO: 3, Accession No. NP_647594.1). MAEMGSKGVT AGKIASNVQK KLTRAQEKVL QKLGKADETK DEQFEQCVQN FNKQLTEGTR LQKDLRTYLA SVKAMHEASK KLNECLQEVY EPDWPGRDEA NKIAENNDLL WMDYHQKLVD QALLTMDTYL GQFPDIKSRI AKRGRKLVDY DSARHHYESL QTAKKKDEAK IAKPVSLLEK AAPQWCQGKL QAHLVAQTNL LRNQAEEELI KAQKVFEEMN VDLQEELPSL WNSRVGFYVN TFQSIAGLEE NFHKEMSKLN QNLNDVLVGL EKQHGSNTFT VKAQPSDNAP AKGNKSPSPP DGSPAATPEI RVNHEPEPAG GATPGATLPK SPSQFEAPGP FSEQASLLDL DFDPLPPVTS PVKAPTPSGQ SIPWDLWEPT ESPAGSLPSG EPSAAEGTFA VSWPSQTAEP GPAQPAEASE VAGGTQPAAG AQEPGETAAS EAASSSLPAV VVETFPATVN GTVEGGSGAG RLDLPPGFMF KVQAQHDYTA TDTDELQLKA GDVVLVIPFQ NPEEQDEGWL MGVKESDWNQ HKELEKCRGV FPENFTERVP
[0052] Therefore, an isolated antibody is disclosed that can selectively bind SEQ ID NO:1 but not bind SEQ ID NO:3. The antibody can be a monoclonal antibody or a recombinant antibody. A monoclonal antibody (9D7 1C1) that specifically binds exon 12a is disclosed and described in Example 3. The complementarity determining regions (CDRs) of the 9D7 1C1 antibody's heavy chain comprises the amino acid sequences SEQ ID NO:10, SEQ ID NO: 11, and SEQ ID NO:12. The CDRs of the 9D7 1C1 antibody's light chain comprise the amino acid sequences SEQ ID NO: 13, SEQ ID NO: 14, and SEQ ID NO: 15. Therefore, the disclosed monoclonal or recombinant antibody that selectively binds the 12a+ BIN1 polypeptide comprises at least these CDRs, or CDRs having at least 95% to 99% identity with SEQ ID NO:10. SEQ ID NO: 11, SEQ ID NO:12, SEQ ID NO:13, SEQ ID NO:14, and SEQ ID NO:15.
[0053] Examples of analytical techniques useful in determining the expression of 12a+ BIN1 polypeptide include immunohistochemistry, Western blot, enzyme-linked immunosorbent assay (ELISA), enzyme immunoassay (EIA), radioimmunoassay (RIA), protein array, or fluorescent activated cell sorting (FACS). Using a specific antibody against exon 12a BIN1 polypeptide, FACS can be used to detect cells expressing exon 12a+ BIN1 circulating in blood and/or microparticles and/or tumor cells and/or apoptotic cell fragments expressing 12a+ BIN1 circulating in plasma or serum. These techniques are known by one of skill in the art. See, e.g., Sambrook et al., Molecular Cloning: A Laboratory Manual, 3.sup.rd Ed., Cold Spring Harbor Press, Cold Spring Harbor, N.Y. (2001).
[0054] Immunohistochemical methods may also be used for detecting the expression levels of 12a+ BIN1 polypeptide. Thus, antibodies or antisera, such as, polyclonal antisera and monoclonal antibodies specific for 12a+ BIN1 polypeptides may be used to assess 12a+ BIN1 polypeptide expression. The antibodies can be detected by direct labeling of the BIN1 antibodies themselves, for example, with radioactive labels, fluorescent labels, hapten labels such as biotin, or an enzyme such as horse radish peroxidase or alkaline phosphatase. Alternatively, unlabeled primary antibody is used in conjunction with a labeled secondary antibody, comprising antisera, polyclonal antisera or a monoclonal antibody that binds the primary antibody. Labeled tertiary antibodies can be used similarly. Optionally, 12a+ BIN1 polypeptide expression in a blood sample from a patient may be compared to 12a+ BIN1 expression in a blood sample of a normal subject or the same subject before or after cancer.
[0055] In certain cases, the level of 12a+ BIN1 isoforms present in a blood sample may be determined by a Western blot. For example, polypeptides present in the whole cell lysate from a blood sample may be separated by SDS-PAGE; the separated polypeptides transferred to a nitrocellulose membrane: 12a+ BIN1 polypeptide detected by using an antibody or antiserum specific for BIN1 or a specific isoform of 12a+ BIN1. At least one normalizing polypeptide, for example, CaV 1.2 or a housekeeping polypeptide such as GAPDH can be detected simultaneously or in parallel and used to normalize the BIN polypeptide expression levels. BIN1 expression level may be determined by performing a BIN1 immunoprecipitation using an excess of anti-BIN1 antibody (e.g., an antibody specific for 12a+ BIN1 polypeptide). The immunoprecipitation is followed by separation of the immunoprecipitate by SDS-PAGE; the separated polypeptides are transferred to a nitrocellulose membrane; and detected by staining the gel. e.g., by Coomassic Blue or silver staining. Immunoprecipitation of a control protein such as GAPDH or ubiquitin may also be carried out either simultaneously or in parallel. Optionally, the same procedure may be carried out on corresponding normal tissue or from a sample from a normal subject.
[0056] In certain cases, the level of 12a+ BIN1 isoforms in cells or microparticles within human blood can be determined by FACS analysis. FACS is an established method used to detect cells as well as circulating microparticles. Microparticle analysis by FACS has been successfully used for thrombotic disease diagnosis and prognosis. In cancer, in particular metastasized cancer, tumor cells expressing 12a+ BIN1 can be potentially released into circulation. These cells may release microparticles carrying 12a+ BIN1. Human blood samples can be fixed in paraformaldehyde (PFA) followed by labeling the cells and/or microparticles with antibody specifically against 12a+ BIN1 polypeptide. The antibodies can be detected by direct labeling of the BIN1 antibodies with fluorescent labels or unlabeled primary antibody used in conjunction with a labeled secondary antibody, comprising antisera, polyclonal antisera, or a monoclonal antibody specific for the primary antibody. Fluorescently labeled 12a+ BIN1 positive cells and/or microparticles can be sorted out by FACS analysis. Optionally, 12a+ BIN1 polypeptide expression in a blood sample from a patient may be compared to 12a+ BIN1 polypeptide expression in a blood sample in a normal subject or the same subject before or after cancer. Similarly, a mobile sold support like fluorescent beads with bound antibody (e.g., antibody selective for 12a+ BIN1) can be used in FACS analysis, wherein beads of differing fluorescence are used to correlate with different bound antibodies.
[0057] Optionally, the level of 12a+ BIN1 expression can be determined by detecting a BIN1 nucleic acid comprising exon 12a (e.g., exon 12a+ BIN1 mRNA), or fragment thereof, in the sample. Examples of analytical techniques useful in determining the expression of exon 12a+ BIN1 mRNA include reverse transcription-polymerase chain reaction (RT-PCR), quantitative real time-PCR (qRT-PCR), one step PCR, RNase protection assay, primer extension assay, microarray analysis, gene chip, in situ hybridization, and Northern blot.
[0058] When RT-PCR is used to determine exon 12a+ BIN1 mRNA expression, mRNA can be isolated from the sample. Optionally, RNA is isolated from blood or plasma of the subject. Normal blood or plasma of another subject can be a control. A normal blood or plasma sample from the same subject before cancer or after cancer is successfully treated can be a control.
[0059] General methods for mRNA extraction are well known in the art and are disclosed in standard textbooks of molecular biology, including Ausubel et al., Current Protocols of Molecular Biology, John Wiley and Sons (1997). Methods for RNA extraction from paraffin embedded tissues are disclosed, for example, in Rupp and Locker, Lab Invest. 56:A67 (1987), and De Andres et al., BioTechniques 18:42044 (1995). Optionally, RNA isolation can be performed using a purification kit, buffer set and protease from commercial manufacturers according to the manufacturer's instructions. For example, total RNA can be isolated using Qiagen RNeasy mini-columns (Hilden, Del.). Other commercially available RNA isolation kits include MasterPure Complete DNA and RNA Purification Kit (EPICENTRE, Madison, Wis.), and Paraffin Block RNA Isolation Kit (Ambion, Inc., Austin, Tex.). Total RNA from tissue samples can be isolated using RNA Stat-60 (Tel-Test, Friendswood, Tex.). RNA prepared from a biological sample can be isolated, for example, by cesium chloride density gradient centrifugation.
[0060] The RNA template can be transcribed into cDNA, followed by its exponential amplification in a PCR reaction. One or more of a number of reverse transcriptases may be used, including, but not limited to, Avian Myeloblastosis Virus Reverse Transcriptase (AMV-RT), Moloney Murine Leukemia Virus Reverse Transcriptase (MMLV-RT), reverse transcriptase from human T-cell leukemia virus type I (HTLV-I), bovine leukemia virus (BLV), Rous sarcoma virus (RSV), human immunodeficiency virus (HIV) and Thermus thermophilus (Tth). The reverse transcription step is typically primed using specific primers, random hexamers, or oligo-dT primers, depending on the circumstances and the goal of RT-PCR. For example, extracted RNA can be reverse-transcribed using a GeneAmp RNA PCR kit (Perkin Elmer; Waltham, Mass.), following the manufacturer's instructions. The derived cDNA can then be used as a template in the subsequent PCR reaction.
[0061] Although the PCR step can use a variety of thermostable DNA-dependent DNA polymerases, typically employed is the Taq DNA polymerase, which has a 5-3 nuclease activity but lacks a 3-5 proofreading endonuclease activity. Thus, TaqMan PCR typically utilizes the 5-nuclease activity of Taq or Tth polymerase to hydrolyze a hybridization probe bound to its target amplicon, but any enzyme with equivalent 5 nuclease activity can be used. Two oligonucleotide primers are used to generate an amplicon typical of a PCR reaction. A third oligonucleotide, or probe, is designed to detect nucleotide sequence located between the two PCR primers. The probe is non-extendible by Taq DNA polymerase enzyme and is labeled with a reporter fluorescent dye and a quencher fluorescent dye. Any laser-induced emission from the reporter dye is quenched by the quenching dye when the two dyes are located close together as they are on the probe. During the amplification reaction, the Taq DNA polymerase enzyme cleaves the probe in a template-dependent manner. The resultant probe fragments disassociate in solution, and signal from the released reporter dye is free from the quenching effect of the second fluorophore. One molecule of reporter dye is liberated for each new molecule synthesized, and detection of the unquenched reporter dye provides the basis for quantitative interpretation of the data.
[0062] RT-PCR can be performed using commercially available equipment, such as, for example, ABI PRISM 7700 Sequence Detection System (Perkin-Elmer-Applied Biosystems; Foster City, Calif.), or Lightcycler (Roche Molecular Biochemicals; Mannheim, Del.). Optionally, the 5 nuclease procedure is run on a real-time quantitative PCR device. Such a system can comprise a thermocycler, laser, charge-coupled device (CCD), camera and computer. The system amplifies samples in a 96-well format on a thermocycler. During amplification, laser-induced fluorescent signal is collected in real-time through fiber optics cables for all 96 wells, and detected at the CCD. The system includes software for running the instrument and for analyzing the data.
[0063] 5-Nuclease assay data are initially expressed as a threshold cycle (Ct). Fluorescence values are recorded during every cycle and represent the amount of product amplified to that point in the amplification reaction. The point when the fluorescent signal is first recorded as statistically significant is the threshold cycle (Ct).
[0064] To minimize errors and the effect of sample-to-sample variation, RT-PCR is optionally performed using an internal standard. The ideal internal standard is expressed at a constant level among different tissues, and is unaffected by the experimental treatment. RNAs most frequently used to normalize patterns of gene expression are mRNAs for the housekeeping genes glyceraldehyde-3-phosphate-dehydrogenase (GAPDH) and -actin.
[0065] A variation of the RT-PCR technique is the real time quantitative PCR, which measures PCR product accumulation through a dual-labeled fluorogenic probe. Real time PCR is compatible both with quantitative competitive PCR, where internal competitor for each target sequence is used for normalization, and with quantitative comparative PCR using a normalization gene contained within the sample, or a housekeeping gene for RT-PCR.
[0066] To correct for (normalize away) both differences in the amount of RNA assayed and variability in the quality of the RNA used the assay can optionally incorporate analysis of the expression of certain reference genes (or normalizing genes), including well known housekeeping genes, such as GAPDH, HPRT1, ubiquitin, etc.
[0067] Alternatively, normalization can be based on the mean or median signal of all of the assayed genes or a large subset thereof (often referred to as a global normalization approach). On a gene-by-gene basis, measured normalized amount of a subject tissue mRNA may be compared to the amount found in a corresponding normal tissue.
[0068] For example, primers and probes (e.g., for use in PCR amplification-based methods) can be designed based upon an exon sequence to be amplified. Accordingly, the primer/probe design can include determining a target exon sequence within the gene of interest (e.g., exon 12a of BIN1). This can be done by publicly available software, such as the DNA BLAST software developed by Kent, W. J., Genome Res. 12(4):656-64 (2002), or by the BLAST software including its variations. Subsequent steps follow well established methods of PCR primer and probe design.
[0069] In order to avoid non-specific signals, repetitive sequences within the target sequence of the gene can be optionally masked when designing the primers and probes. The masked sequences can then be used to design primer and probe sequences using any commercially or otherwise publicly available primer/probe design packages, such as Primer Express (Applied Biosystems; Carlsbad, Calif.): MGB assay-by-design (Applied Biosystems; Carlsbad, Calif.).
[0070] Factors to be considered in PCR primer design can include primer length, melting temperature (Tm), G/C content, specificity, complementary primer sequences, and 3-end sequence. PCR primers can optionally be 17-30 bases in length, and contain about 20-80% G+C bases, (e.g., about 50-60% G+C bases). Tms are between 50 C. and 80 C., e.g. about 50 C. to 65 C.
[0071] Microarray technology may be used to detect differential expression of exon 12a+ BIN1 in a subject's blood sample and normal or control blood sample. In this method, polynucleotide sequences of interest (including cDNAs and oligonucleotides) are plated, or arrayed, on a microchip substrate. The arrayed sequences are then hybridized with specific DNA probes from blood samples of interest. Similar to the RT-PCR method, the source of mRNA is optionally total RNA isolated from subject's blood sample, and optionally corresponding normal or control blood sample.
[0072] Fluorescently labeled cDNA probes can be generated through incorporation of fluorescent nucleotides by reverse transcription of RNA extracted from tissues of interest. Labeled cDNA probes applied to the chip hybridize with specificity to each spot of DNA on the array. After stringent washing to remove non-specifically bound probes, the chip is scanned by confocal laser microscopy or by another detection method, such as a CCD camera. Quantitation of hybridization of each arrayed element can be used for assessment of corresponding mRNA abundance.
[0073] With dual color fluorescence, separately labeled cDNA probes generated from two sources of RNA are hybridized pair wise to the array. The relative abundance of the transcripts from the two sources corresponding to each specified gene is thus determined simultaneously. Microarray methods have been shown to have the sensitivity to detect rare transcripts, which are expressed at a few copies per cell, and to reproducibly detect at least approximately two-fold differences in the expression levels (Schena et al., Proc. Natl. Acad. Sci. USA 93(2):106-149 (1996)).
[0074] The arrayed oligonucleotides may include oligonucleotides which hybridize to a specific region of the exon 12a+ BIN1 nucleic acid. In certain embodiments, multiple copies of a first oligonucleotide which specifically hybridizes to a first region of the exon 12a+ BIN1 nucleic acid are arrayed. In certain embodiments, multiple copies of first and a second oligonucleotide which specifically hybridize to a first and a second region of the exon 12a+ BIN1 nucleic acid, respectively, are arrayed, and so on. In certain embodiments, the exon 12a+ BIN1 nucleic acid expression level is determined by mean values of the signal from each of these oligonucleotides. The array may also include oligonucleotides which specifically hybridize to nucleic acid of a normalizing gene, such as a housekeeping gene or other genes known not to be significantly differentially expressed in diseased versus normal tissue, for example, CaV 1.2.
[0075] Optionally, the BIN1 polypeptide, nucleic acid, or fragments of said polypeptides or nucleic acids detected is human. Optionally, BIN1 polypeptide, nucleic acid, or fragments of said polypeptides or nucleic acids detected is non-human mammal (e.g., rodent, porcine, bovine, equine, canine, or feline).
[0076] There are a variety of BIN1 sequences that are disclosed on Genbank, and these sequences and others are herein incorporated by reference in their entireties as are individual subsequences or fragments contained therein. As used herein, BIN1 includes homologs, variants, and isoforms thereof.
[0077] The nucleotide and amino acid sequences of BIN1 isoforms 1-10 can be found at GenBank Accession Nos. NM_139343.2 and NP 647593.1 for isoform 1; NM_139344.2 and NP_647594.1 for isoform 2; NM_139345.2 and NP_647595.1 for isoform 3; NM_139346.2 and NP_647596.1 for isoform 4; NM_139347.2 and NP_647597.1 for isoform 5; NM_139348.2 and NP_647598.1 for isoform 6; NM_139349.2 and NP_647599.1 for isoform 7; NM_004305.3 and NP_04296.1 for isoform 8; NM_139350.2 and NP_647600.1 for isoform 9; and NM_139351.2 and NP_647601.1 for isoform 10. Two other reported exon 12a+ BIN1 tumor isoforms include BIN1+12a found at GenBank Accession Nos. AF068918.1 and AAC23751.1 for nucleotide and amino acid sequences, respectively, and BIN110+12a found at GenBank Accession Nos. AF068917.1 and AAC23750.1 for nucleotide and amino acid sequence, respectively. The nucleotide and amino acid sequence of exon 12a is given by SEQ ID NO:2 and SEQ ID NO:1, respectively.
[0078] Thus, provided are the nucleotide sequences of BIN1 comprising exon 12a+(SEQ ID NO:2) comprising a nucleotide sequence at least about 70%, 75%, 80%/o, 85%, 90%, 95%, 98%, 99% or more identical to the nucleotide sequences of the aforementioned GenBank Accession Numbers. Also provided are amino acid sequences of the BIN1 polypeptide comprising the encoded amino acid sequence of exon 12a+(SEQ ID NO:1) comprising an amino acid sequence at least about 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99% or more identical to the sequences of the aforementioned GenBank Accession Numbers.
[0079] Antibodies that bind the polypeptides described above, including 12a+ BIN1, or polypeptide fragments thereof, can be used to detected 12a+ BIN1 isoforms in a biological sample. For example, the polypeptides described above can be used to produce antibodies to 12a+ BIN1.
[0080] As used herein, the term antibody encompasses, but is not limited to, whole immunoglobulin (i.e., an intact antibody) of any class. Chimeric antibodies and hybrid antibodies, with dual or multiple antigen or epitope specificities, and fragments, such as F(ab)2, Fab, Fab and the like, including hybrid fragments are useful herein. Thus, fragments of the antibodies that retain the ability to bind their specific antigens are provided and are useful in the methods taught here. For example, fragments of antibodies which maintain binding activity to 12a+ BIN1 expressed in cancers are included within the meaning of the term antibody or fragment thereof. Such antibodies and fragments can be made by techniques known in the art and can be screened for specificity and activity according to general methods for producing antibodies and screening antibodies for specificity and activity (See Harlow and Lane. Antibodies, A Laboratory Manual. Cold Spring Harbor Publications, New York (1988)).
[0081] Also useful in the methods herein are conjugates of antibody fragments and antigen binding proteins (single chain antibodies) as described, for example, in U.S. Pat. No. 4,704,692, the contents of which are hereby incorporated by reference in their entirety.
[0082] Optionally, the antibody is a monoclonal antibody. The term monoclonal antibody as used herein refers to an antibody from a substantially homogeneous population of antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts. Monoclonal antibodies may be prepared using hybridoma methods, such as those described by Kohler and Milstein, Nature, 256:495 (1975) or Harlow and Lane, Antibodies, A Laboratory Manual. Cold Spring Harbor Publications, New York (1988). In a hybridoma method, a mouse or other appropriate host animal is typically immunized with an immunizing agent to elicit lymphocytes that produce or are capable of producing antibodies that will specifically bind to the immunizing agent. Alternatively, the lymphocytes may be immunized in vitro. The immunizing agent can be 12a+ BIN1 expressed in cancer or an immunogenic fragment thereof.
[0083] The monoclonal antibodies may also be made by recombinant DNA methods, such as those described in U.S. Pat. No. 4,816,567. DNA encoding the monoclonal antibodies can be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of murine antibodies). The DNA also may be modified, for example, by substituting the coding sequence for human heavy and light chain constant domains in place of the homologous murine sequences or by covalently joining to the immunoglobulin coding sequence all or part of the coding sequence for a non-immunoglobulin polypeptide. Such a non-immunoglobulin polypeptide can be substituted for the constant domains of an antibody provided herein, or can be substituted for the variable domains of one antigen-combining site of an antibody to create a chimeric bivalent antibody comprising one antigen-combining site having specificity for 12a+ BIN1 expressed in cancer and another antigen-combining site having specificity for a different antigen.
[0084] In vitro methods are also suitable for preparing monovalent antibodies. Digestion of antibodies to produce fragments thereof, particularly, Fab fragments, can be accomplished using routine techniques known in the art. For instance, digestion can be performed using papain. Examples of papain digestion are described in WO 94/29348, U.S. Pat. No. 4,342,566, and Harlow and Lane, Antibodies, A Laboratory Manual, Cold Spring Harbor Publications, New York, (1988). Papain digestion of antibodies typically produces two identical antigen binding fragments, called Fab fragments, each with a single antigen binding site, and a residual Fc fragment. Pepsin treatment yields a fragment, called the F(ab)2 fragment that has two antigen combining sites and is still capable of cross-linking antigen.
[0085] The Fab fragments produced in the antibody digestion can also contain the constant domains of the light chain and the first constant domain of the heavy chain. Fab fragments differ from Fab fragments by the addition of a few residues at the carboxy terminus of the heavy chain domain including one or more cysteines from the antibody hinge region. The F(ab)2 fragment is a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region. Fab-SH is the designation herein for Fab in which the cysteine residue(s) of the constant domains bear a free thiol group.
[0086] Further provided herein is a humanized or human version of the antibody. Humanized and human antibodies can be made using methods known to a skilled artesian; for example, the human antibody can be produced using a germ-line mutant animal or by a phage display library.
[0087] Antibodies can also be generated in other species and humanized for administration to humans. Alternatively, fully human antibodies can also be made by immunizing a mouse or other species capable of making a fully human antibody (e.g., mice genetically modified to produce human antibodies) and screening clones that bind exon 12a+ BIN1 expressed in cancer. See, e.g., Lonberg and Huszar, Int. Rev. Immunol. 13:65-93, (1995), which is incorporated herein by reference in its entirety for methods of producing fully human antibodies. As used herein, the term humanized and human in relation to antibodies, relate to any antibody which is expected to elicit a therapeutically tolerable weak immunogenic response in a human subject. Thus, the terms include fully humanized or fully human as well as partially humanized or partially human.
[0088] Kits containing one or more of the disclosed antibodies are also provided for detecting Ca-1 and/or Ca-2 isoform levels. The kit can contain an assay system for detecting 12a+ BIN1 polypeptides and an assay system for detecting 12a+/13+ BIN1 polypeptides. For example, the kit can contain a first assay system for detecting 12a+ BIN1 isoforms that comprises an antibody that selectively binds 12a+ BIN1, and an antibody that selectively binds multiple human BIN1 isoforms. The assay may also be a sandwich assay, wherein one of these two antibodies is immobilized on a solid surface. The kit can contain a second assay system for detecting 12a+/13+ BIN polypeptides that comprises an antibody that selectively binds 13+ BIN1, and an antibody that selectively binds 12a+ of BIN1. The assay may also be a sandwich assay, wherein one of these two antibodies is immobilized on a solid surface. The solid support can include a plate, array, chip or bead. Optionally the antibodies of the kit are labeled. The kit optionally includes one or more secondary and/or tertiary antibodies (optionally labeled), containers for the antibodies, and/or regents for detection of the labels. The assay system optionally includes one or more solid supports with the selected antibody or antibodies bound thereto.
[0089] As used throughout, subject can be a vertebrate, more specifically a mammal (e.g., a human, horse, cat, dog, cow, pig, sheep, goat, mouse, rabbit, rat, and guinea pig), birds, reptiles, amphibians, fish, and any other animal. The term does not denote a particular age or sex. Thus, adult and newborn subjects, whether male or female, are intended to be covered. As used herein, patient or subject may be used interchangeably and can refer to a subject with a disease or disorder (e.g., cancer). The term patient or subject includes human and veterinary subjects.
[0090] As used herein the terms treatment, treat, or treating refers to a method of reducing the effects of a disease or condition or symptom of the disease or condition. Thus in the disclosed method, treatment can refer to a 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 100% reduction in the severity of an established disease or condition or symptom of the disease or condition. For example, a method for treating a disease is considered to be a treatment if there is a 10% reduction in one or more symptoms of the disease in a subject as compared to a control. Thus the reduction can be a 10%, 20%, 30%, 40%, 50%, 60%, 700%, 80%, 90%, 100%, or any percent reduction in between 10% and 100%/s as compared to native or control levels. It is understood that treatment does not necessarily refer to a cure or complete ablation of the disease, condition, or symptoms of the disease or condition.
[0091] Disclosed are materials, compositions, and components that can be used for, can be used in conjunction with, can be used in preparation for, or are products of the disclosed methods and compositions. These and other materials are disclosed herein, and it is understood that when combinations, subsets, interactions, groups, etc. of these materials are disclosed that while specific reference of each various individual and collective combinations and permutation of these compounds may not be explicitly disclosed, each is specifically contemplated and described herein. For example, if a method is disclosed and discussed and a number of modifications that can be made to a number of molecules including the method are discussed, each and every combination and permutation of the method, and the modifications that are possible are specifically contemplated unless specifically indicated to the contrary. Likewise, any subset or combination of these is also specifically contemplated and disclosed. This concept applies to all aspects of this disclosure including, but not limited to, steps in methods of using the disclosed compositions. Thus, if there are a variety of additional steps that can be performed it is understood that each of these additional steps can be performed with any specific method steps or combination of method steps of the disclosed methods, and that each such combination or subset of combinations is specifically contemplated and should be considered disclosed.
[0092] Publications cited herein and the material for which they are cited are hereby specifically incorporated by reference in their entireties.
EXAMPLES
Example 1: Canine Study of BIN1 in Blood Samples
Methods
[0093] Canine Selection and Serum Acquisition.
[0094] Venous blood samples were obtained from 31 dogs with a definite diagnosis of carcinoma and seven healthy dogs as controls. Two samples were excluded due to high muscle contaminant (creatinine kinase >1000 IU/L) and another two samples were excluded due to incomplete clinical data. The remaining 27 samples had their cancer staged (l-IV), according to standardized clinical (not biopsy based) staging guidelines for each respective cancer. The cancers were a mix between solid and blood-based tumors, including lymphoma, sarcoma, adenosarcoma, and undifferentiated tumor.
[0095] Each dog was restrained in a sternal recumbancy. 5 mls of venous blood was collected into a 7.0 ml glass EDTA tube from the jugular vein using a 12.0 ml syringe with a 21 gauge-1 inch needle. After mixed with EDTA, the blood was then centrifuged at 4,000 rpm for 20 minutes at 4 C. The supernatant serum was collected into a 1.7 ml Eppendorf tube and stored in 80 C. freezer for later analysis.
[0096] Detection of Serum BIN1 Protein by Capture ELISA.
[0097] Round bottomed 96-well plates were coated at 4 C. for 16 hours with mouse anti BIN1 (clone 99D, Sigma, 1/1000) (Sigma; St. Louis, Mo.) diluted in 0.1 M sodium carbonate buffer, pH 9.0. The plates were washed three times with tris-buffered saline tween-20 (TBST) to remove unbound antibody and blocked for 1 hour at room temperature with 1% bovine serum albumin (BSA) in TBST (blocking buffer). 100 l of each serum sample was added, in duplicate, and plates were incubated overnight at 4 C. with orbital rotation. The samples were then aspirated and plates were washed twice quickly, followed by three times for 5 minutes with TBST. Goat anti-BIN1 (1/1000 in blocking buffer) (Everest Biotech; Oxfordshire, United Kingdom) was then applied as a detection antibody, and the plates were incubated for 2 hours at room temperature with rotation. The detection antibody was then aspirated and the plates were washed twice quickly, followed by three times for 5 minutes with TBST. The plates were subsequently incubated for 1 hour at room temperature with HRP-conjugated donkey anti-goat IgG (1/2000 in blocking buffer) (Abcam; Cambridge, Mass.) before two quick washes and three 5 minute washes with TBST. TMB substrate was added and plates were incubated in the dark for 1 hour before reaction termination with 1 N hydrochloric acid (HCL). Following the reaction termination, the plates were read using the ELx800 BioTek microplate spectrophotometer (BioTek; Winooski, Vt.), and OD values were determined at 405 nm. All values were normalized to that of a two year old, 9 kilogram healthy dog.
Results
[0098] A canine study was undertaken to determine the correlation between serum BIN1 levels and clinically assessed cancer stage. For this study, twenty-seven dogs with a definite diagnosis of carcinoma were studied. Serum was obtained from the animals, and assayed for BIN1 content by ELISA. The capture antibody in the ELISA test was a commercially available monoclonal BIN1 antibody against the region encoded by BIN1 exon 13 (clone 99D, sigma). As indicated in
[0099] This proof of principle study is supportive of BIN1 as a blood available cancer diagnostic tool. Elevation of BIN1 in the serum fraction of venous blood significantly predicts stage III or IV status of carcinoma in canines. BIN1 could be a quantitative blood biomarker of metastatic cancer in human.
Example 2: Sequence Analysis of 9D7 1C1 Monoclonal Antibody
Materials and Methods
[0100] Total RNA Extraction.
[0101] Total RNA was extracted from hybridomas using Qiagen kit.
[0102] First-Round RT-PCR.
[0103] QIAGEN, OneStep RT-PCR Kit (Cat No. 210210) was used. RT-PCR was performed with primer sets specific for the heavy and light chains. For each RNA sample, 12 individual heavy chain and 11 light chain RT-PCR reactions were set up using degenerate forward primer mixtures covering the leader sequences of variable regions. Reverse primers are located in the constant regions of heavy and light chains. No restriction sites were engineered into the primers. The reaction setup contained 5.0 l 5 QIAGEN OneStep RT-PCR Buffer, 0.8 l dNTP Mix (containing 10 mM of each dNTP), 0.5 l Primer set, 0.8 l QIAGEN, OneStep RT-PCR Enzyme Mix, 2.0 l Template RNA, and RNase-free water to 20.0 l. The PCR conditions were 50 C., 30 min, 95 C., 15 min, 20 cycles of (94 C., 25 sec; 54 C., 30 sec; and 72 C., 30 see), followed by a final extension at 72 C., 10 min.
[0104] Second-Round Semi-Nested PCR.
[0105] The RT-PCR products from the first-round reactions were further amplified in the second-round PCR. 12 individual heavy chain and 11 light chain RT-PCR reactions were set up using semi-nested primer sets specific for antibody variable regions. The reaction setup contained 10 l 2PCR mix, 2 l primer set, and 8 l of the first round product. The PCR conditions were 95 C., 5 min. 25 cycles of (95 C., 25 sec; 57 C., 30 sec; and 68 C. 30 sec), followed by a final extension at 68 C., 10 min.
[0106] After PCR was finished, PCR reaction samples were run onto agarose gel to visualize DNA fragments amplified. The correct antibody variable region DNA fragments should have a size between 400-500 base pair.
[0107] PCR positive bands were TOPO cloned. The TOPO clones were PCR-amplified, followed by gel electrophoresis and recovery from agarose gel. Approximately 24 clones were then sequenced, and CDR analysis was performed using these sequence data.
Results
[0108] After sequencing cloned DNA fragments, several mouse antibody heavy and light chains were identified. Antibody CDR analysis identified one heavy chain and two light chains. A summary of the sequencing results is shown in Table 2.
TABLE-US-00003 TABLE 2 Summary of Antibody Sequence Results Type # Sequencing result summary Heavy chain H1 Heavy chain Heavy chain H8 Not an antibody gene Heavy chain H9 Not an antibody gene Light chain L2 Not an antibody gene Light chain L3 Not an antibody gene Light chain L4 Not an antibody gene Light chain L5 Not an antibody gene Light chain L6 Light chain Light chain L7 Light chain (distinct from L6) ---CDR1--><--CDR2-><--CDR3-- MHC299H1_1_M13R GFNIKDYY...._IDPENGNT.._VRGEDYGGYAMDY MHC299H1_2_M13R GFNIKDYY...._IDPENGNT.._VRGEDYGGYAMDY MHC299H1_4_M13R GFNIKDYY...._IDPENGNT.._VRGEDYGGYAMDY MHC299H1_5_M13R GFNIKDYY...._IDPENGNT.._VRGEDYGGYAMDY MHC299L6_1_M13R KSLLHSNGNTY._RMS......._MQHLEFPFT MHC299L6_2_M13R KSLLHSNGNTY._RMS......._MQHLEFPFT MHC299L6_3_M13R KSLLHSNGNTY._RMS......._MQHLEFPFT MHC299L6_5_M13R KSLLHSNGNTY._RMS......._MQHLEFPFT MHC299L7_2_M13R QDVSTA......_WAS......._QQHYSTPFT MHC299L7_3_M13R QDVSTA......_WAS......._QQHYSTPFT MHC299L7_4_M13R QDVSTA......_WAS......._QQHYSTPFT
[0109] The following are the sequences listed in Table 2: GFNIKDYY (SEQ ID NO: 10). IDPENGNT (SEQ ID NO: 11). VRGEDYGGYAMDY (SEQ ID NO: 12), KSLLHSNGNTY (SEQ ID NO:13), MQHLEFPFT (SEQ ID NO:14). QDVSTA (SEQ ID NO:15), and QQHYSTPFT (SEQ ID NO:16).
[0110] Variable VH Region Sequences
TABLE-US-00004 Amino Acid Sequence in FASTA format (MHC299H1.1\; M13R): (SEQ ID NO: 4) EVQLQQSGAELVRPGALVKLSCKASGFNIKDYYVYWVKQRPEQGLEWIG WIDPENGNTIYDPEFQAKASITADTSSNTAYLQLSSLTSEGTAVYYCVR GEDYGGYAMDYWGQGTSVTVSS. Nucleotide Sequence in FASTA format (MHC299H1.1\; M13R): (SEQ ID NO: 5) GAGGTCCAGCTGCAGCAGTCTGGGGCTGAGCTTGTGAGGCCAGGGGCCTT AGTCAAGTTGTCCTGCAAAGCTTCTGGCTTCAACATTAAAGACTACTATG TGTATTGGGTGAAGCAGAGGCCTGAACAGGGCCTGGAGTGGATTGGATGG ATTGATCCTGAGAATGGTAATACTATATATGACCCGGAGTTCCAGGCCAA GGCCAGTATAACAGCAGACACATCCTCCAACACAGCCTACCTGCAGCTCA GCAGCCTGACATCTGAGGGCACTGCCGTCTATTACTGTGTTAGAGGGGAG GATTACGGGGGCTATGCTATGGACTACTGGGGTCAAGGAACCTCAGTCAC CGTCTCCTCA.
[0111] Variable VL Region Sequences
TABLE-US-00005 Amino Acid Sequence in FASTA format (MHC299L6.3\; M13R): (SEQ ID NO: 6) DIVVTQAAPSVPVTPGESVSISCRSSKSLLHSNGNTYLSWFLQRPGQSPQ LLIYRMSNLASGVPDRFSGSGSGTAFTLRISRVEAEDVGVYYCMQHLEFP FTFGSGTKLEIK. Nucleotide Sequence in FASTA format (MHC299L6.3\; M13R): (SEQ ID NO: 7) GATATTGTGGTGACTCAGGCTGCACCCTCTGTACCTGTCACTCCTGGAGA GTCAGTTTCCATCTCCTGCAGGTCTAGTAAGAGTCTCCTGCATAGTAATG GCAACACTTACTTGTCTTGGTTCCTGCAGAGGCCAGGCCAGTCTCCTCAG CTCCTGATTTATCGGATGTCCAACCTTGCCTCAGGAGTCCCAGACAGGTT CAGTGGCAGTGGGTCAGGCACTGCTTTCACACTGAGAATCAGTAGAGTGG AGGCTGAGGATGTGGGTGTTTATTACTGTATGCAACATCTAGAATTTCCC TTCACGTTCGGCTCGGGGACAAAGTTGGAAATAAAAC.
[0112] Variable VL Region Sequences
TABLE-US-00006 Amino Acid Sequence in FASTA format (MHC299L7.2\; M13R): (SEQ ID NO: 8) DIVMTQSHKFMSTSVGDRVSITCKASQDVSTAVAWYQQKPGQSPKLLIYW ASTRHTGVPDRFTGSGSGTDYTLTISSVQAEDLALYYCQQHYSTPFTFGS GTKLEIK. Nucleotide Sequence in FASTA format (MHC299L7.2\; M13R): (SEQ ID NO: 9) GACATTGTGATGACCCAGTCTCACAAATTCATGTCCACATCAGTAGGAGA CAGGGTCAGCATCACCTGCAAGGCCAGTCAGGATGTGAGTACTGCTGTAG CCTGGTATCAACAAAAACCAGGGCAATCTCCTAAACTACTGATTTACTGG GCATCCACCCGGCACACTGGAGTCCCTGATCGCTTCACAGGCAGTGGATC TGGGACAGATTATACTCTCACCATCAGCAGTGTGCAGGCTGAAGACCTGG CACTTTATTACTGTCAGCAACATTATAGCACTCCATTCACGTTCGGCTCG GGGACAAAGTTGGAAATAAAAC.
Example 3: BIN1 Detection in Blood Samples from Human Cancer Patients
[0113] The Bridging integrator 1 (BIN1) gene encodes several isoforms of a nucleocytoplasmic protein. Twenty exons in the BIN1 gene are alternatively spliced to give rise to at least ten BIN1 isoforms (
[0114] This study aims at characterizing BIN1 cancer isoforms containing exon 12a as circulating cancer biomarkers, by employing combinations of antibodies of different specificities to indirectly measuring the level of these isoforms detectable in blood samples from normal and cancer in humans.
[0115] Antibody sandwich assay combinations (Table 3) were designed to detect isoforms that contain polypeptides encoded by both exon 12a and exon 13 (Assay #1) or detect isoforms containing polypeptides encoded by exon 12a and ubiquitously expressed exon 11 (Assay #2) which is designed to capture 12a+ BIN1 with and without exon 13. The existence of 12a+/13 BIN1 was detected in the context of the presence of the proto-oncogene splicing factor SF2/ASF (Karni R, et al., Nature Struct Mol Biology. 2007 14(3):185-193). This 12a+/13 BIN1 isoform is referred to herein as Ca-2 (
Materials and Methods
[0116] Antibodies.
[0117] To measure the levels of BIN1 cancer isoforms in blood samples, a set of four BIN1 antibodies was used in enzyme-linked immunosorbent assay (ELISA). The detection of all BIN1 isoforms was performed using an anti-BIN1 goat polyclonal antibody from Everest (cat# EB08724), named p11 in this study, which specifically recognizes the polypeptide encoded by exon 11, present in all BIN1 isoforms. The detection of the subset of BIN1 isoforms that contain the polypeptide encoded by exon 13 was performed using an anti-BIN1 mouse monoclonal antibody from Sigma (cat#B9428), named m13 in this study. For the detection of the subset of BIN1 isoforms that contain the polypeptide encoded by exon 12a, two custom-made antibodies were used: an anti-BIN1 rabbit polyclonal antibody (#A5299) named p12a in this study, and an anti-BIN1 mouse monoclonal antibody (#9D71C1), named m12a in this study.
[0118] Assays and Tests.
[0119] Detection of serum BIN1 protein by capture sandwich ELISA. Antibody combinations are listed in Table 3. Round bottomed 96-well plates were coated at 4 C. for 16 hours with capture antibody (approximately 5 pg/ml) diluted in 0.1 M sodium carbonate buffer, pH 9.0. The plates are washed three times with tris-buffered saline TWEEN-20 (TBST) to remove unbound antibody and blocked for 1 hour at room temperature with 1% bovine serum albumin (BSA) in TBST (blocking buffer). 50 l of standards (recombinant BIN1 proteins) and each serum sample was added, in duplicate, and plates were incubated overnight at 4 C. with rotation. The samples were then aspirated and plates were washed twice quickly and three times for 5 minutes with TBST. Primary detection antibody (5 g/ml in blocking buffer) was then applied as a detection antibody, and the plates were incubated for 1 hour at room temperature with rotation. The detection antibody was then aspirated and the plates were washed twice quickly, followed by three times for 5 minutes with TBST. The plates were subsequently incubated for 1 hour at room temperature with HRP-conjugated secondary antibody (1/2000 in blocking buffer) before two quick washes and three 5 minute washes with TBST. 3,3,5,5-Tetramethylbenzidine (TMB) substrate was added and plates were incubated in the dark for 1 hour before reaction termination with 1 N hydrochloric acid (HCL). Following the reaction termination, the plates were read using an ELx800 microplate spectrophotometer (BIOTEK, Winooski, Vt.) and optical density (OD) values were determined at 405 nm. A standard curve was generated from the OD values of the protein standards of known protein concentration. BIN1 concentrations of each sample were then derived from the standard curve.
[0120] Two different combinations of these antibodies were used and defined two distinct assays (Table 3). In Assay #1, m13 was used for capture and p12a was used for detection to measure the levels of four BIN1 isoforms including the cancer isoform Ca-1. In Assay #2, m12 was used for capture and p 11 was used for detection to measure the levels of five BIN1 isoforms including the two cancer isoforms Ca-1 and Ca-2.
TABLE-US-00007 TABLE 3 BIN1 antibodies used in different assays and BIN1 isoforms detected. (Ca-1 and Ca-2 represent BIN1 cancer isoforms) Capture Detection BIN1 isoforms detected Assay #1 m13 p12a 1, 4, 5, Ca-1 Assay #2 m12a p11 1, 4, 5, Ca-1, Ca-2
[0121] For Assay #2 the secondary HRP conjugated antibody was donkey anti-goat IgG (Abeam). For Assay #1 the secondary HRP conjugated antibody was goat anti-rabbit IgG (Abcam).
[0122] To evaluate the levels of BIN1 new cancer isoform Ca-2, the ratio Assay #2/Assay #1 was used and termed BIN1 Cancer Test #1.
[0123] Human Samples.
[0124] Commercial vendors with human clinical sample repositories, collected under IRB and including relevant clinical data were identified. Forty-two blood samples were obtained (Conversant, Asterand) from unique, clinically normal subjects ranging from 25 to 79. Fifty human blood samples; ten for each of lung, pancreas, colorectal, ovarian and thyroid cancer, were obtained (Innovative Research and Conversant). The ages of the cancer patients ranged from 18 to 84. Blood samples were obtained from lung cancer patients with stage I and IV disease, from pancreas cancer patients with cancer stage III and IV disease, from colorectal cancer patients with stage II, III and IV disease, and ovarian and thyroid cancer patients with all disease stages (I-IV).
Results
[0125] Standard Curves.
[0126] As a positive control for the ELISA assays used in this study, BIN1 recombinant protein (Ca-1) was overexpressed in human HEK-293 cells and the total lysate was analyzed using Assay #1 (m13-p12a) and Assay #2 (m12-p11). The two standard curves for Assay #1 and Assay #2 are represented in
[0127]
[0128] To evaluate the levels of BIN1 cancer isoform Ca-2, BIN1 Cancer Test #1 was used (ratio Assay#2/Assay#1).
[0129] In
[0130] The youngest cancer patient with a Test value above 10 in this small survey was 56 years old, whereas among the three normal subjects with elevated BIN1 test values, the oldest is 43 years old. Thus in the age groups in which one is most likely to consider a cancer screening test, the separation of the test results in the cancer samples and normals is very good at a level of 10: 20% of cancers are positive, and no normals are positive in persons >50 years old. Half of the lung cancer samples were positive suggesting the use of a BIN1 test to screen smokers, and others with a high risk of lung cancer. Interestingly, three of these lung cancers that were detected were Stage I, thus these patients may gain significant benefit from early detection and directed treatment.
[0131] Table 4 summarizes the human clinical results using BIN1 Cancer Test #1 and an increasing threshold of test signal. (* these normals are <=43 years old, these cancer subjects are >=56 years old).
TABLE-US-00008 TABLE 4 Percentage of detection of BIN1 cancer isoform in Normal and Cancer samples. BIN1 Cancer Test #1 % of Normal % of Cancer >1 9.5 28.0 >10 7.1* 20.0{circumflex over ()} >100 4.8 14.0 >1000 2.4 10.0 >1.00E+04 2.4 6.0 >1.00E+05 2.4 6.0 >1.00E+06 2.4 6.0 >1.00E+07 2.4 4.0 >1.00E+08 2.4 2.0 >1.00E+09 0.0 2.0 *these normals are 43 years old {circumflex over ()}these cancer subjects are 56 years old
[0132]
[0133] Thus, the BIN1 Cancer test detects a subset of cancer samples, in several cancers. These subsets may correspond to stage but do not necessarily correlate with stage. The BIN1 positive subsets may reflect tumor subtypes within these cancer diagnoses, i.e., subtypes that may have different biochemical pathways active or different host responses operating. This suggests that BIN1, by identifying subsets in lung, ovarian, thyroid, and pancreatic cancer, may be useful for treatment selection in these patients.
Example 4: BIN1 Detection in Blood Samples from Dogs Treated for Cancer
Materials and Methods
[0134] Dog Samples.
[0135] Fourteen blood samples from apparently healthy dogs (referred to as Normal) and forty three blood samples from dogs newly diagnosed with cancer (referred to as Cancer/Pre) were collected for this study. Several dogs underwent treatment, including surgical resection, and/or radiotherapy, and chemotherapy. A second blood sample was obtained from a subset of treated dogs one week and in some cases two weeks after treatment (Post1 and Post2, respectively).
Results
[0136] BIN1 Cancer Test #1 was used to analyze 57 dog samples (14 normals and 43 with new diagnosis) detect the levels of BIN1 cancer isoform in normal versus cancer dog samples, pre- and post-treatment. No detection of BIN1 cancer isoform was detected in normal samples (
[0137] Fourteen pretreatment cancer samples showed elevated BIN1 cancer test results, with levels greater than 1, compared to normal (all normals were zero). Following cancer treatment, the level of BIN1 cancer isoform was decreased in eight out of eleven samples (