EXOSOMES AND THEIR USE AS VACCINE
20180161416 ยท 2018-06-14
Inventors
- Hernando Antonio Del Portillo Obando (Alella, ES)
- Francisco Enrique BORR?S SERRES (Barcelona, ES)
- Lorenzo Jos? FRAILE SAUCE (Lleida, ES)
- Sergio Roberto Montaner Tarbes (Barcelona, ES)
- Maria MONTOYA GONZ?LEZ (Madrid, ES)
Cpc classification
C12N2770/10034
CHEMISTRY; METALLURGY
A61K2039/64
HUMAN NECESSITIES
C12N2770/10051
CHEMISTRY; METALLURGY
A61K39/00
HUMAN NECESSITIES
C12N2770/36034
CHEMISTRY; METALLURGY
A61K2039/55555
HUMAN NECESSITIES
C12N2770/36051
CHEMISTRY; METALLURGY
A61K9/127
HUMAN NECESSITIES
International classification
A61K9/127
HUMAN NECESSITIES
Abstract
The present invention provides exosomes isolated from an animal, wherein the animal (a) has overcome a disease caused by a pathogen, and (b) it is free from the pathogen that causes the diseases. The invention also provides process for obtaining these exosomes and the use thereof in therapy.
Claims
1. A free pathogen pharmaceutical or veterinary composition comprising: immunogenic exosomes having immunogenic pathogenic peptides on its surface, the exosomes being isolated from an animal which (a) has overcome a disease caused by a pathogen, and (b) it is free from the pathogen that causes the disease; and one or more pharmaceutically or veterinary acceptable excipients or carriers.
2. The composition according to claim 1, wherein the animal has overcome a viral disease and it is free of the virus that causes the disease.
3. The composition according to claim 2, wherein the animal is a farm animal.
4. The composition according to claim 3, wherein the farm animal is a swine.
5. The composition according to claim 1, wherein the disease is a viral respiratory disease
6. The composition according to claim 1, wherein the animal is a non-viremic swine that has overcome a respiratory viral disease.
7. The composition according to claim 6, wherein the animal is a non-viremic swine that has overcome a respiratory disease caused by Porcine Reproductive and Respiratory syndrome virus (PRRSV).
8. The composition according to claim 1, wherein the vesicle comprises a peptide comprising a sequence selected from the group consisting of SEQ ID NO:1 to SEQ ID NO: 15, and a peptide with an identity sequence of at least 85% with any of the sequences SEQ ID NO: 1 to 15.
9. (canceled)
10. The composition according to claim 8, wherein the vesicle comprises one peptide of sequence SEQ ID NO: 16, 17, 18 or a sequence having at least 85% of identity with any of the sequences SEQ ID NO: 16 to 18.
11. A process for obtaining the composition as defined in claim 1 that comprises: (i) the isolation of the exosomes from a test sample of an animal that (a) has overcome a disease caused by a pathogen, and (b) it is free from the pathogen that causes the disease, as it is defined in any of the previous claims; and (ii) the mixture of the exosomes resulting from step (i) with one or more pharmaceutically or veterinary acceptable excipients or carriers.
12. The process according to claim 11, wherein the test sample is a serum sample.
13. The process according to claim 11, wherein the exosomes are separated using size exclusion chromatography.
14. (canceled)
15. The composition according to claim 1, which is a vaccine.
16. (canceled)
17. (canceled)
18. A method for the treatment or prevention of a viral, bacterial or parasitic disease, the method comprising administering a therapeutically effective amount of the composition as defined in claim 1, in a subject in need thereof.
19. A method for identifying a peptide candidate to be an immunogen, the method comprising the step of analyzing the protein composition of an exosome as defined in claim 1.
20. A method for differentiating animals vaccinated with the vesicle as defined in claim 1 from the animals infected with the same pathogen as the one referred in claim 1, the method comprising determining the antibody profile in an animal's test sample and compare it with a reference antibody profile from an already vaccinated animal or from an infected animal, wherein if the antibody profile from the test sample is substantially the same as the one from the vaccinated animal reference, this will be indicative that the test animal is vaccinated with the composition as defined in claim 1, and if the antibody profile from the test sample is substantially the same as the one from the infected animal reference, this will be indicative that the test animal is infected.
21. The composition according to claim 10, wherein the vesicle comprises a peptide of sequence SEQ ID NO: 16, 17 or 18.
22. The composition according to claim 10, wherein the vesicle comprises the peptides of sequence SEQ ID NO: 16, 17 and 18.
23. The process according to claim 10, wherein the test sample is serum and the exosomes are separated using size exclusion chromatography
Description
BRIEF DESCRIPTION OF DRAWINGS
[0085]
[0086]
[0087]
[0088]
[0089]
[0090]
[0091]
[0092]
[0093]
[0094] In both cases, fraction 8 represents the most enriched fraction in molecular markers associated to exosomes. CD63 and CD81 are used as guide for selecting fractions to be send to proteomic analyses.
EXAMPLES
1. Sample Collection.
[0095] Sera samples from farm animals in which there had been an episode of PRRSV were collected. To determine which samples belonged to animals that had overcome the disease, the Group Porcine Sanitation (GSPGrup de Sanejament Porc?) of Lleida conducted blind analyses of these samples by techniques: (i) RT-PCR which detects the active virus RNA indicating that serum belongs to a viremic animal (Taqman PRRSV reagents and controls), and (ii) ELISA to detect antibody titers using a commercial kit (IDEXX PRRS X3 Ab test). Notably, the GSP group is accredited in Catalonia for diagnosis of this pathogen (http://www.gsplleida.net/ca/content/laboratori).
[0096] In parallel, animal sera samples were collected in farms in Lleida where there had not been reported, until today, any PRRSV episode. These sera were evaluated using the same tests in the GSP. In this group, the samples that were negative both in RT-PCR (that means absence of the active virus) and in ELISA (which means, that there was no infection ongoing), were considered as negative controls.
[0097] From the results obtained, two samples of viremic animals (referred to hereinafter as 201406-2PS and 201406-4PS) and two non-viremic animals (201406-6PS and 201406-10PS) were selected.
Example 2. Serum-Derived Exosome Isolation
[0098] The exosomes have a characteristic particle size of 30-100 nm. Therefore, to collect these vesicles from different samples a separation process through size exclusion chromatography using sepharose CL2B as separation matrix, was used (de Menezes-Neto et al., Size exclusion chromatography as a stand-alone methodology identifies novel markers in mass spectrometry analyses of plasma-derived vesicles from healthy individuals, J. Extracell. Ves., 2015, 4: 27378). While there are other techniques for preparing exosomes, the sepharose technique allows a better purification of the exosomes. Briefly, frozen 3 mL aliquots of different sera samples were thawed on ice and centrifuged at 500 g for 10 minutes at room temperature to disregard cell debris. In parallel, sepharose CL-2B (Sigma-Aldrich, St. Louis, Mo., USA) were packed in 12 mL syringes until a final volume of 10 mL, and balanced with phosphate-buffered saline (PBS) 0.32% of sodium citrate (w/v). Later, 2 mL aliquots of each sample were added to individual sepharose CL-2B columns and 18-20 fractions of 0.5 mL aliquots were collected for each sample.
Example 3. Molecular Characterization of Exosomes
[0099] Once obtained the different exosome fractions, the presence of the vesicles was confirmed by the analysis of protein concentration using Bradford assay, and the analysis using molecular markers performed by flow cytometry.
3.1. Bradford Analysis.
[0100] Protein concentration was obtained using a colorimetric assay with Bradford technique (Bradford M. M. A rapid and sensitive method for the quantitation of microgram quantities of protein utilizing the principle of protein-dye binding, 1976, Analytical biochemistry, vol. 7(72), p?ginas 248-254)
3.2. Flow Cytometry.
[0101] In parallel, fractions were also analyzed by flow cytometry to detect the presence of the antigens CD9, CD63 or CD81, two tetraspanins that are particular exosome markers (Raposo G. et al., Extracellular vesicles: exosomes, microvesicles, and friends, 2013, The Journal of cell biology, vol. 18(200), page 373-383). Each aliquot was subjected to the following protocol: 4 microns of latex beads (aldehyde-sulfate) (Invitrogen Cat? A37304) were added to each aliquot, and the mix was left for 15 minutes in resting conditions before adding 1 mL of BCB buffer (PBS?1, 0.1% bovine serum albumin, 0.01% of sodium azide). The resulting mix was incubated overnight at room temperature in rotation before the incubation with primary antibodies (anti-CD63 and anti-CD81, kindly provided by Dr. Francisco Sanchez-Madrid) for 30 minutes at 4? C. Both antibodies were used in 1:10 dilution. After two wash steps with 150 ?L of PBS-BSA buffer (Phosphate-buffered saline/bovine serum albumin 0.1%), and centrifugation at 2000 g for 10 minutes, secondary antibodies conjugated to FITC (1:100 dilution) or alexa 488 (1:1000 dillution) (Southern Biotec cat? 1032-02) were added and the mix was incubated for 30 minutes at 4? C. After two additional wash steps with 150 ?L of PBS-BSA buffer at 0.1% at 2000 g for 10 minutes, the latex beads were resuspended in 100 ?L of PBS-BSA 0.1%.
[0102] Resulting samples were analyzed by flow cytometry using LRSFortessa flow cytometer (BD Biosciences) and adjusting counting threshold at 10000 events. Using FlowJo analysis software, FCS files corresponding to each sample processed were added to the worklist, the area (forward and side scatter) where latex beads population was concentrated was selected, and the fluorescence for FITC related to this area was measured. A table was made with the median intensity fluorescence (MFI) data and bead counts obtained in the gated area for each sample analyzed. 20000 individual latex beads were examined per sample and the MFI was used for comparison between fractions.
[0103] Following both protocols, as shown in
Example 4. Exosome Protein Profile Analysis
4.1. Analysis of the Distribution and Size of the Exosomes Using Nanoparticle Tracking Analysis (NTA).
[0104] The use of NTA for quantification, distribution and size of exosomes, has become one of the most used techniques in the extracellular vesicles field. (http://www.malvern.com/en/products/technoloy/nanoarticle-tracking-analysis/). Therefore, after the confirmation of the presence of the markers associated to these vesicles in the fractions, the inventors decided to quantify the number and the size of the vesicles population present in the analyzed samples. In order to do so, each analyzed sample was diluted in PBS until the NTA chamber (Malvern Instruments Ltd) detected a value between 20-100 particles per field. Once reached this ideal concentration and dilution, 400 ?L were injected into the NTA chamber and microscope capture level was manually adjusted. The digital thermometer was activated and the focalization of the particles with less refraction was started using the micrometer of the microscope in the area closest to the laser beam circumferences. Automatic acquisition of videos was started, and the analysis of the obtained videos was done using the software developed by the equipment's supplier. Thus, it was confirmed that the majority of samples had a vesicle concentration in order of magnitude of 10.sup.10 particles per milliliter. In addition, mode size was measured and ranged between 40-150 nm.
4.2. Protein Electrophoresis.
[0105] In order to detect the presence of exosomal and eluted proteins in the exosome-enriched fractions and determine their molecular weight range, all selected fractions were analyzed using electrophoresis in reducing conditions and silver staining process. In order to do this, two aliquots of 10 ?L of each fraction collected in example 1 were taken, and 10 ?L of cracking buffer (Bio-Rad) were added to each one. Then, each sample was loaded into a pre-cast 10% SDS-PAGE gel (Bio-Rad).
Example 5. Proteomic Analysis Using Liquid Chromatography And Mass Spectrometry
[0106] Liquid chromatography (nanoLCULTRA-EKSIGENT) followed by mass spectrometry (LC-MS/MS) was carried out in an LTQ Orbitrap Velos equipment (Thermo Fisher). Exosome samples in PBS, were reduced with 10 mM DTT (Dithiothreitol), alkylated with 55 mM of iodoacetamide, and precipitated with 10% trichloroacetic acid (TCA), washed with 100% acetone and reconstituted in 2 mL of 8M urea. Before overnight digestion with trypsin, samples were resuspended in 1.6M urea solution. Reaction was stopped with 1% formic acid (v/v) and trypsinized samples were passed through a precolumn (C18PepMap-100-Thermoscientific-5 mm-ID300 um-5 um-100A), before their injection in an analytical column (AcclaimPepMap100-Thermoscientific-15 cm-ID75 um-3 um-100A-C18). Samples eluted at 400 nL/minute with a mobile phase gradient: 0-40% of dissolvent B in dissolvent A for the first 80-90 minutes and then 40-100% of dissolvent B in dissolvent A until experiment ending at 100-110 minutes (A: 3% acetonitrile, 0.1% formic acid in water, B: 97% acetonitrile, 0.1% formic acid in water). The Eluate was applied to the nano-spray source of the spectrometer Orbitrap and all full-scan mass spectra acquired in the Orbitrap over a mass range of 400-1500 m/z with a resolution of 30,000 and a maximum injection time of 500 ms were analyzed. The MS/MS was done in the LTQ and the 20 more intense peptides were isolated and fragmented using a low collision energy 35% CID. Maxquant v1.5 software was used to analyze the raw data, using the label-free-quantification (LFQ) mode. Moreover, for the final identification we used the sequence search engine, Andromeda (module included in Maxquant v1.5 software), adding a sequence dataset created from the sequences obtained from the UniProtKB website, including all PRRSV proteins sequences that had been sequenced until that moment (approximately 14000 sequences).
[0107] From this analysis, a variety of viral proteins was identified in all samples. Surprisingly, as it is shown in the Venn diagram of
Example 6. Isolation of Exosomes from Human Reticulocyte Cells
[0108] For reticulocyte isolation, anticoagulated blood extracted from healthy human donors at sufficient volume to ensure a high yield for this technique was used. Blood was transferred to 50 mL tubes and centrifuged 15 minutes at 1000 g, ACC 8/DEC 3 to separate plasma (liquid) from cells (solid). Plasma was discarded and globular package (cells) was diluted at 50% hematocrit with RPMI 1640 media and centrifuged for 10 minutes at 600 g, ACC 8/DEC 3, the supernatant was discarded and cells were resuspended again in RPMI 1640 to achieve a 50% hematocrit. An aliquot was taken to evaluate the initial cell concentration of the sample (reticulocyte represent approximately 2% of total cell count).
[0109] To eliminate white cell population (leukocytes) from the dilution, the globular package at 50% hematocrit was passed through a CF11 column (Whatman, 4021050) so that leukocytes were retained in the matrix due to their size, and red cells (group where reticulocytes can be found) passed through the matrix, and were collected in 15 mL falcon tubes.
[0110] Collected volume (eluted from the CF11 column) including all red cells was examined by direct vision to detect blood clots and, if found, sample was passed through a nylon filter. Then, the sample was centrifuged 10 minutes at 600 g, ACC8/DEC 3, the supernatant was discarded, and the pellet was resuspended until a 50% hematocrit.
[0111] For reticulocyte enrichment, it was used a Percoll separation. To do so, addition of Percoll (GE Healthcare, 17-0891-02), prepared (Percoll Stock: 9 parts of pure Percoll and 1 part of 1.5M sodium chloride-Percoll separation solution: 70% Percoll stock and 30% sodium chloride 0.15M), to 15 mL falcon tubes was done and, afterwards, the sample was shed onto the walls of the tube, so that the reticulocytes were applied at the upper part of the tube. Another centrifugation step was done at 1200 g/15 min/ACC 4/DEC 0, thus, reticulocytes were separated by density from the mature red blood cells, and formed a ring in the middle of the tube. Finally, reticulocyte rings were collected directly from the percoll gradient tubes, transferred to 15 mL falcon tubes, and washed two-three times by addition of RPMI 1640 media up to the maximum volume (15 mL) to eliminate percoll traces with centrifugations for 7 minutes at 500 g between each media wash step. Blood smears were done both with Brilliant cresyl blue (Sigma) and giemsa stain (Sigma) from the samples obtained with this method in the initial point (direct sample), posterior to leukocyte depletion with CF11 (Sigma) and after percoll enrichment. This guaranteed the correct performance of all processes and that the reproducibility criteria followed the quality controls.
[0112] In addition, reticulocyte cell suspension was cultured in cell culture flasks with RPMI 1640 culture media without supplementation for 36 hours. Exosomes were isolated from the cell culture supernatant following the protocols described in example 2.
Example 7. Immunogenicity of Viral Proteins Associated to Exosomes
7.1. ELISA Protocol for Antibody Titration.
[0113] Indirect ELISA protocol was used for sera titration obtained from swine that had overcome PRRSV infection (PCR (?); Ab (+), NV), those with detectable viremic state (PCR (+); Ab (+/?), V) and those that never had been in contact with the virus (PCR (?); Anb (?), CN). General protocol for indirect ELISA was described by Abcam Company. Briefly, a coating with the antigen of interest corresponding to attenuated PRRSV vaccine available in the market (Porcilis PRRS Vaccine intervet lot. A200ED03) was done onto flat bottom microtiter polyvinylchloride (PVC) plate. Stock dilution of the antigen was done using carbonate/bicarbonate buffer (Na.sub.2CO.sub.3 0.015M/NaHCO.sub.3 0.035M) at pH 9.6 until reaching normal dose concentration for vaccination in swine. In each well 50 ?L of the dilution of the antigen was loaded and incubated overnight at 4? C. with a plastic cover to avoid evaporation. At the end of the antigen incubation step, the remaining volume in the wells was discarded by inversion and 4 plate washes were done with 200 ?L PBS 1?/Tween 20 0.2%. Once the plate was washed, a blocking step was carried out, to fill the empty spaces where the antigen had not bind to in order to avoid unspecific results of the assay, by the addition of PBS 1?/5% non-fat dry milk. After blocking, the plate was washed four times with PBS 1?/Tween 20 0.2%, and the different sera groups were incubated (NV, V and CN, diluted from 1/5 to 1/5000) for 1 hour at room temperature, followed by four washes with PBS 1?/0.2% Tween 20. Finally, the plate was incubated with secondary antibody goat anti-pig (Fc): HRP (AbSerotec, AAI41P) in dilutions from 1/100 to 1/100000 for 1 hour at room temperature and light protected. Four posterior washes with PBS 1?/0.2% Tween 20 were done.
[0114] ELISA reaction development was carried out using TMB substrate (3,3,5,5-Tetramethilbenzidine) from Abcam (Ab142042) following manufacturer instructions (15-20 minutes of development), and reaction was stopped adding 2M sulfuric acid. The ELISA results were read with Varioskan from Thermo-Scientific at 450 nm. The same protocol was followed in posterior examples to determine the optic density of the fraction in each well.
[0115] As seen in the results obtained from different sera groups and antibodies in the above mentioned assay, it was concluded that best sera dilutions to see differences between experimental groups (NV, V and CN) were between 1/50 to 1/100 combined with a secondary antibody dilution of 1/10000. This combination of factors was taken as standard for later assays where antigen recognition capacity by the sera from the different experimental groups had to be evaluated.
7.2. Recognition of Exosome Associated Viral Proteins Derived from Swine that had Overcome the Infection.
[0116] The coating with the antigen of interest corresponding to attenuated viral vaccine available in the market for PRRSV (Porcilis PRRS Vaccine intervet lot. A200ED03) was done onto a part of a flat bottom microtiter PVC plate, the other part of the plate was coated with a 1/10 dilution of the antibody mouse anti-human CD63 clone TEA 3/18 (kindly provided by Dr. Francisco Sanchez-Madrid). Antigen stock was diluted in carbonate/bicarbonate buffer (Na.sub.2CO.sub.3 0.015M/NaHCO.sub.3 0.035M) pH 9.6 until reaching vaccination dose, and 1/10 for capture antibody. In each well of the ELISA plate, 50 ?L of the dilution of antigen/capture antibody was loaded and incubated overnight at 4? C. covered with an adhesive plastic cover to avoid evaporation. At the end of the antigen incubation step (coating), the remaining volume in the wells was discarded by inversion and 4 plate washes were done with 200 ?L PBS 1?/Tween 20 0.2%. Once the plate was washed, a blocking step was done to block empty spaces where the antigen had not bind to in order to avoid unspecific results of the assay, by the addition of 100 ?L PBS 1?/5% non-fat dry milk. After blocking, the plate was washed four times with PBS 1?/Tween 20 0.2%, and the capture wells were incubated for 90 minutes at 37.sup.aC with 100 ?L of extracellular vesicles obtained from animals that overcome the PRRSV infection (isolated by polyethylene glycol (Sigma-Aldrich Cat? 81260-1 KG)), and, as a specificity control, with exosomes derived from human reticulocytes, as PRRS is a pathogen specific for swine, these were obtained according to example 6. All exosomes were obtained by size exclusion chromatography using CL-2B sepharose matrix (Sigma-Aldrich cat? CL2B300-100ML).
[0117] Those wells in which commercial vaccine was added (used as positive control), were covered with 100 ?L PBS 1? to maintain a minimal volume in the well to avoid protein damage due to desiccation. Then, each well was washed four times with 200 ?L of PBS 1?/tween 20 0.2%. Afterwards, the plate was incubated with the different sera (NV, V and CN, diluted 1/25 to 1/100) for 1 hour at room temperature, followed by four washes with PBS 1?/Tween 20 0.2% (v/v). Finally, the plate was incubated with the secondary antibody goat anti-pig (Fc): HRP (AbSerotec, AAI41P) at 1/10000 dilution for 1 hour at room temperature and light protected with four posterior washes with PBS 1?/0.2% tween 20. ELISA reaction development was carried out using TMB substrate (3,3,5,5-Tetramethilbenzidine) from Abcam (Ab142042) following manufacturer instructions (15-20 minutes of development), and reaction was stopped adding 2M sulfuric acid (H.sub.2SO.sub.4). Plate was read in Varioskan (Thermo-Scientific) at 450 nm.
[0118] The results obtained in the sandwich ELISA, indicated that the optical densities obtained from the vesicles derived from animals that had overcome PRRSV infection were significantly (p=0.02) higher than those derived from animals that had not been in contact with the virus (negative control), and those derived from human reticulocytes (specificity control).
[0119] By comparing these two controls with the experimental group, it can be observed a trend of antigen-antibody recognition specificity comparing Nv sera and Pigex Nv, that is not present in the two controls (NC, negative control and REX, specificity).
Example 8. Scalability Process and Production of Exosomes Derived from Swine that has Overcome PRRSV Infection
[0120] First, the total volume of sera obtained by separation through centrifugation of total blood samples, collected directly on the farm, from animals that had overcome PRRSV infection (identified in example 1) was measured. Once total volume of sera was quantified, concentration was achieved by addition of polyethylene glycol PEG (Sigma-Aldrich cat 81260) at 8.5% (w/v and sodium chloride (Sigma-Aldrich cat? S5150-1 L) up to a final concentration of 0.4M. The mix was incubated overnight in a cold chamber (4? C.) under agitation. After this incubation, the mix was centrifuged using a high-speed centrifuge at 7000 g for 10 minutes and 4? C. Supernatant was discarded and the pellet was resuspended in PBS 1?.
[0121] The resulting suspension was aliquoted in 1.5 mL Eppendorf tubes and stored at ?80? C. until use. A 2 mL aliquot was used to proceed with the exosome separation by size exclusion chromatography (SEC).
[0122] The column to perform the separation by the above-mentioned method was done using a 10 mL syringe (BD? disposable syringe cat? BD302188), in which the tip was filled with a nylon cap to avoid sepharose matrix elution while compacting, and an opening/close valve to control the flux of eluate being filtered through the column. Once the opening/closing system was prepared, CL-2B sepharose matrix (Sigma-aldrich CL2B300-100ML) was loaded into the column until 10 mL of compacted sepharose matrix was reached. When the column preparation was finished, it was exposed to ultraviolet light for 10 minutes in a laminar flow hood. Meanwhile, 1.5 mL Eppendorf collection tubes for fraction collection were prepared and labeled with sample code, processing date and fraction number. Then, the 2 mL sample obtained by PEG concentration was loaded into the column and separation was done by the collection of approximately 0.5 mL fractions and supplementing the column with PBS 1?/0.32% sodium citrate to avoid matrix desiccation. After the collection of the 20 fractions of 0.5 mL, the valve was closed and fractions were analyzed by Bradford assay to quantify the protein concentration in each fraction.
[0123] After protein quantification by Bradford, a protein concentration profile was obtained. This profile had a detectable and quantifiable protein peak in those fractions were vesicles were enriched (a light increase in fractions 6 to 10), decreased after those fractions, and increased in a second peak corresponding to soluble protein elution fractions. Soluble proteins are smaller than vesicles, and thus, they have a delayed elution time in the size exclusion chromatography. This Bradford profile allows the determination of the vaccine dose unit that could be used in clinical trials and the expression of it with quantification Bradford units (mg/mL).
Example 9. Scalability Process (Using Differential Centrifugation Enrichment) and Production of Exosomes Derived from Swine that has Naturally Cured from PRRSV
[0124] First, blood samples obtained from animals that naturally cured from PRRSV infection were centrifuged at 1800 rpm/15 minutes (Beckman Coulter Allegra X-12R centrifuge), sera was collected (identified in example 1) and volume measured. Extracellular vesicles were separated from cell debris by centrifugation at 500 g for 15 minutes in 50 mL falcon tubes. Supernatant was kept and pellet discarded. A second centrifugation in Beckman Coulter Optima XL-100K Ultracentrige (Rotor SW-28, class CDFGH, Ser. 5E 1427) for microvesicles and apoptotic bodies elimination at 15000 g for 45 minutes was carried out in polypropylene tubes (Beckman Coulter Ref. 326823Lot. Z51002SCA). Supernatant was kept and pellet was discarded. Finally, to precipitate extracellular vesicles and soluble protein was necessary a ultracentrifugation step (Beckman Coulter Optima XL-100K Ultracentrige and Rotor SW-28, class CDFGH, Ser. 5E 1427) at 100000 g for 2 hours in polypropylene tubes, in this case, supernatant was discarded and pellet was resuspended in PBS 1?.
[0125] The resulting suspension was aliquoted in 1.5 mL Eppendorf tubes and stored at ?80? C. until use. For size exclusion chromatography separation, 2 mL of the previous suspension was thawed and loaded into the separation column. The size exclusion column was done using a 10 mL syringe (BD? disposable syringe cat? BD302188), in which the tip was filled with a nylon cap to avoid matrix elution while packaging and also an opening/close valve to control the flux of eluate through the column. Once prepared the opening/closing system, added CL-2B sepharose matrix (Sigma-Aldrich CL2B300-100ML) until 10 mL of packaged sepharose matrix was loaded into the column. When packaging process was finished, the column was moved into a laminar flow hood and exposed to ultraviolet light for 10 minutes in the meantime while 1.5 mL Eppendorf collection tubes for fractions were prepared and labeled with sample code, processing date and fraction number. Then, 2 mL of concentrated sample obtained from differential centrifugation method was loaded into the column and separation procedure started collecting 0.5 mL fractions approximately and loading PBS 1?/0.32% sodium citrate to avoid matrix desiccation. After 20-fraction collection, the opening/close valve was closed and fractions were analyzed by Bradford assay to quantify concentration of proteins within each fraction.
[0126] After protein quantification by Bradford, a protein concentration profile was obtained for each sample. This profile had a detectable and quantifiable protein peak in those fractions were vesicles were enriched (a light increase in fractions 6 to 10), decreased after those fractions, and increased in a second peak corresponding to soluble protein elution fractions. Soluble proteins are smaller than vesicles, and thus, they have a delayed elution time in the size exclusion chromatography. This Bradford profile allows determining the vaccine dose unit that could be used in clinical trials and express it as the quantification Bradford unit (mg/mL).
Example 10
10.1. Animals Used for Exosome Isolation, Characterization and Vaccine Production.
[0127] Sera samples for exosome isolation, molecular characterization and vaccine production were obtained from animals that had overcome PRRSV infection as judged (i) by RT-PCR (TaqMan? NA and EU PRRSV Reagents and Controls) to detect circulating viral particles in blood and (ii) by antibody detection post-infection (IDEXX PRRS X3 Ab test). An independent diagnostics laboratory for porcine diseases in Lleida, Grup de Sanejament Porci of Lleida (GSP), performed these analyses following their own standard operational procedures. Among all the animals evaluated and registered under test result number UP1570743, three were selected for further analyses and vaccine production (Table 1).
TABLE-US-00003 TABLE 1 ANIMAL SERA INFORMATION FOR VACCINE PREPARATION. ID ID from Antibody number Farm Aptitude RT-PCR titer 201506-1PS 1 Male 2.5 201506-6PS 6 Male 2 201506-9PS 9 Male 2.1
10.2. Proteomic Analysis Using Liquid Chromatography and Mass Spectrometry.
[0128] Liquid chromatography (nanoLCULTRA-EKSIGENT) followed by mass spectrometry (LC-MS/MS) was carried out in a LTQ Orbitrap Velos equipment (Thermo Fisher). Exosome samples in PBS 1? were reduced with 10 mM DTT (Dithiothreitol), alkylated with 55 mM of iodoacetamide and precipitated with 10% trichloroacetic acid (TCA), washed with 100% acetone and reconstituted in 2 mL of 8M urea. Before overnight digestion with trypsin, samples were resuspended in 1.6M urea solution. After complete overnight digestion, reaction was stopped with 1% formic acid (v/v) and trypsinized samples were passed through a precolumn (C18PepMap-100-Thermoscientific-5 mm-ID300 um-5 um-100A) before injection in an analytical column (AcclaimPepMap100-Thermoscientific-15 cm-ID75 um-3 um-100A-C18). Samples eluted at 400 nL/minute with a mobile phase gradient: 0-40% of dissolvent B in dissolvent A for the first 80-90 minutes and then 40-100% of dissolvent B in dissolvent A until experiment ending at 100-110 minutes (A: 3% acetonitrile, 0.1% formic acid in water, B: 97% acetonitrile, 0.1% formic acid in water). Eluate was applied to the nano-spray source of the spectrometer Orbitrap, and all full-scan mass spectra acquired in the Orbitrap over a mass range of 400-1500 m/z with a resolution of 30,000 and a maximum injection time of 500 ms were analyzed.
[0129] The MS/MS was done in the LTQ and the 20 more intense peptides were isolated and fragmented using a low collision energy 35% CID. Maxquant v1.5 software was used to analyze the raw data, using the label-free-quantification (LFQ) mode. Moreover, for the final identification we used the sequence search engine, Andromeda (module included in Maxquant v1.5 software), adding a sequence dataset created from the sequences obtained from the UniProtKB website, including all PRRSV proteins sequences that had been sequenced until that moment (approximately 14000 sequences). Contaminants were filtered out and peptides were considered true-positives if they fulfill the following criteria: (i) False-discovery-rate (FDR)=1%, (ii) more than two peptides from the same protein were identified in individual samples or a unique peptide was identified, (iii) it had to be present in exosomes from at least two different animals.
TABLE-US-00004 TABLE2 SEQUENCESIDENTIFIEDBYLC-MS/MSANDSELECTEDBY ANTIGENICITY. SEQID NO:1 Peptides(LC-MS/MS) Protein 1 VEVEGHLMTSK Envelope protein 2 QAKKHEVAGANK ORF1a polyprotein 3 AGKKQSQK Nucleocapsid protein 4 NIAPMGNGQSVNQLCQLLGTMMK Nucleocapsid protein 5 MAGRNQRQK Nucleocapsid Protein
10.3. Epitope Prediction and Mapping
[0130] Protein sequences were evaluated using Bepipred 2.0 (http://www.iedb.org/). Bepipred 2.0 predicts the location of linear B-cell epitopes using a combination of a hidden Markov model and a propensity scale method. The residues with scores above the threshold (default 0.35) are predicted to be part of an epitope and colored gray in the graph (where Y-axes depicts residue scores and X-axes residue positions in the sequence). The values of the scores are not affected by the selected threshold. Peptides identified by MS/MS (Table 2) were then localized to determine whether they mapped in predicted B-cell epitope regions.
TABLE-US-00005 TABLE3 PREDICTEDEPITOPESEQUENCESFROMBEPIPRED2.0 SEQIDNO: 16 LDAKGRLYRWRSPVIIEKGGKVEVEGHLMTSKELC 17 QAKKHEVAGANKAEHLKHYSPPAEGNCGWHCISAI 18 MAGRNQSQKKKKNIAPMGNGQSVNQLCQLLGTMMK
10.4. Synthetic Peptides
[0131] After signing a confidentiality agreement with the Peptide synthesis facility of the Department of Experimental and Health Sciences at University Pompeu Fabra (BarcelonaSpain), peptides were synthesized using Fmoc chemistry Merrifield R. B. Solid phase synthesis. I. The synthesis of a tetrapeptide, J. Am Chem Soc., 1963, vol. 85, p. 2149-2154). Thus, peptide chains were assembled stepwise, one amino acid at a time, while attached to an insoluble resin support. This allowed the reaction by-products to be removed at each step by simple washing. Amino acids were protected at their amino terminus by the Fmoc (9-fluorenylmethoxycarbonyl) group and coupled to the growing chain after activation of the carboxylic acid terminus. The Fmoc group was removed by piperidine treatment and the process repeated. After the peptide was assembled, it was removed from the resin by treatment with trifluoroacetic acid (TFA). At the same time, protecting groups on amino acid side chains were also removed yielding the crude linear peptide. One-step purification by reverse-phase HPLC sufficed to obtain peptide with >95% purity.
[0132] Characterization of each synthetic peptide was done using an A-HPLC with a Column Luna C18 (4.6?50 mm, 3 um; Phenomenex), a Gradient: Linear B (0.036% TFA in MeCN) into A (0.045% TFA in H.sub.2O) over 15 minutes with a flow rate of 1 mL/min and detection at 220 nm. All peptides were resuspended in ultrapure H.sub.2O (MiliQ water), aliquoted and stored at ?20? C. until use.
10.5. Farm Vaccination Trial
[0133] To determine the immunogenicity of these peptides as well as of exosomes containing them, a porcine vaccine trial was performed at the experimental farm animal facilities of the University of Lleida (
[0134] Table 4 shows the experimental groups tested in the vaccination trial. All the animals used in the vaccination trial were in the same environment.
TABLE-US-00006 TABLE 4 ANIMAL DISTRIBUTION IN FARM AND VACCINATION TREATMENT IN FARM TRIAL. Left ear number Experimental group 87 1 mg Exosomes NV + Montanide 90 1 mg Exosomes NV + Montanide 86 1 mg each peptide + montanide 85 1 mg each peptide + montanide 81 1 mg each peptide + montanide each peptide means peptide of sequence SEQ ID NO: 16, 17, and 18
[0135] The adjuvant used for the vaccination trial was Montanide ISA 206 VG (SEPPICLot. 36022E/U42131). MONTANIDE? ISA 206 VG is a mineral oil based adjuvant, which has been developed for the manufacture of Water-in-Oil-in-Water (W/O/W) emulsions. It comprises a high-grade injectable mineral oil and an extremely refined emulsifier obtained from mannitol and purified oleic acid of vegetable origin. MONTANIDE? ISA 206 VG is free of animal origin ingredients. Vaccine formulations with it induces short and long-term immunity.
[0136] Compared to traditional oil emulsions, MONTANIDE? ISA 206 VG emulsions are stable, with low viscosity and easy to inject. It has been demonstrated that it is an excellent adjuvant to stimulate humoral and cellular responses. This product is recommended for bacterial, mycoplasma, viral or parasite antigens. Montanide? adjuvants and their components have been considered as safe by the Committee for Veterinary Medical Products (CVMP) for use in immunological products and are included as authorized substances in the annex of the European Council Regulation n? 470/2009 (previously 2377/90/EC) needing no further MRL studies, or included in already registered veterinary commercial products. The recommended ratio for vaccine dose is 1:1 Montanide/vaccine antigen (weight/weight).
10.6. Immunogenicity of Peptides and Exosomes
[0137] Indirect ELISA was used to determine the immunogenicity of the different vaccine formulations. Briefly, flat bottom microtiter polyvinylchloride (PVC) plates were coated with 50 ?L of the attenuated PRRSV vaccine (Porcilis PRRS Vaccine intervet lot. A200ED03) or peptides, a final concentration of 5 ?g/mL in carbonate/bicarbonate buffer was prepared (Na.sub.2CO.sub.3 0.015M/NaHCO.sub.3 0.035M), as coating antigens. Vaccines samples were diluted in carbonate/bicarbonate buffer to an approximate concentration corresponding to a normal vaccine dose indicated on the vaccine protocol (10.sup.4 to 10.sup.6 TCID.sub.50 for Porcilis PRRSV).
[0138] Stock dilutions of the antigens were done using carbonate/bicarbonate buffer (Na.sub.2CO.sub.3 0.015M/NaHCO.sub.3 0.035M) at pH 9.6. In each well 50 ?L of the dilution, either of Porcilis or peptides, were loaded and incubated overnight at 40? C. with a plastic cover to avoid evaporation. Then, coating solutions were discarded and plates were washed 4 times with 200 ?L PBS 1?/0.2% Tween 20. After washing, a blocking step with PBS 1?/5% non-fat dry milk was necessary to cover all empty spaces without antigen in well surfaces to avoid unspecific binding. Four washing steps with PBS 1?/0.2% Tween 20 were carried out and incubation with different sera groups diluted 1/50 in PBS 1?/0.2% Tween 20 (from the immunization assay) for 1 hour at room temperature, followed by four washing steps with PBS 1?/0.2% Tween 20. Secondary antibody goat anti-pig (Fc): HRP (AbSerotec, AAI41P) was used as detection antibody at dilution 1/10000 for 1 hour at room temperature and light protected after which four washing steps with PBS 1?/0.2% Tween 20 were applied. ELISA development was carried out using TMB substrate (3,3,5,5-Tetramethilbenzidine) from Abcam (Ab142042) following manufacturer instructions (15-20 minutes of development), and reaction was stopped adding 2M sulfuric acid (H.sub.2SO.sub.4). Plate was read in Varioskan (Thermo-Scientific) at 450 nm.
[0139] Threshold of positivity was defined as the mean plus three times standard deviation (95% confidence) of the negative control. Threshold for positivity of plates coated with Porcilis was 0.3, and with peptides was 0.13 (
[0140] Currently, there is a growing demand to consider regional elimination of PRRSV, but that requires reliable vaccines, i.e., those that cannot revert to virulence and spread to nonvaccinates and persist within the swine herds long term. Ideally, the next generation of PRRSV vaccines should also include markers to both differentiate infected from vaccinated animals (DIVA). Remarkably, no antibodies were detected post-vaccination using the IDEXX PRRS X3 Ab test by routine analysis performed in the GSP in any of the animals of this study. This finding reveals that this exosome-based vaccination approach is capable of differentiating infected from vaccinated animals (DIVA).
10.7. Interferon Gamma Production after Vacination.
[0141] Sterile white plates for ELISPOT assay (Millipore Cat? S2EM004M99. Lot. R4Ma77120) were activated using 20 ?L of 35% Ethanol for 30 seconds. After removing ethanol, plates were washed twice with PBS 1? and coated with 100 ?L of Anti-IFNg (BD bioscienceBD559961) at a 1/100 dilution and incubated overnight at 4? C. Coating solutions were discarded and plates were washed with 200 ?L of blocking buffer (BB: RPMI 1640 (Lonza, Cat?. BE12-167F)/10% Fetal bovine serum (Life technologies, Cat?. 10270106)/1% L-glutamine (Cultek, Cat?. H3BE17-605E/1% Penicillin/streptomycin (Cultek, cat?. H3DE17-603E). After discarding coating solutions, plates were incubated with BB for 2 hours at room temperature. For stimuli, attenuated viral particles (Pyrsvac-183, SYVA) were resuspended in complete media (CM: RPMI 1640 10% Fetal bovine serum FBS/1% L-glutamine/1% Penicillin/streptomycin) to a concentration until normal vaccine dosage in swine, one was loaded into the plate in native conformation and the other denatured by heat at 90? C. for 10 minutes. For peptides, a concentration of 1 ?g of each peptide per well (5 ?g/mL) diluted in CM was used. Positive control was set as PHA-M at 1/100 dilution and negative control was CM alone. 100 ?L of each stimuli were loaded into the plate by duplicate and incubated until cells addition.
[0142] Periferal blood mononuclear cells (PBMCs) isolation, whole blood collection was done in EDTA tubes (10 mL approx.BD Bioscience cat. 366643). Blood was diluted 1:1 with PBS 1? (final volume 20 mL) and loaded above 15 mL of Ficoll Histopaque?-1077 Hybri-Max? (Sigma, h8889-500ML) in 50 mL Falcon tubes, centrifuged at 1800 rpm/30 minutes at RT AC=9 Dac=3. Collected in 15 mL conical tubes the PBMCs ring at the center of the ficoll gradient with Pasteur pipettes and cells washed twice with PBS1? max volume and centrifuge at 400 g/5 minutes at RT. Cell count and viability was achieved using Flow cytometer and viability assay from BD Pharmigen (PE Annexin V Apoptosis Detection Kit I, Cat 559763) following their own protocol. In cytometer tubes, added 15 ?L of cell suspension, 2 ?L of 7AAD and 15 ?L of calibration beads for cell quantification. Alive cells were counted in a flow cytometer (BD FACSCanto? II system) and concentration was determined using the following calculations.
Cells/?L=#cells counted/#beads counted (aprox 2000)
Total cell count was determined as follows:
T.Math.Cells=cells/?L*2000 ?L.
[0143] Cell suspension was prepared to load 500000 cells/well and incubated at 37? C. and 5% CO.sub.2 for 48 hours. Once finished incubation with stimuli, cells were discarded and plate washed with 200 ?L of MiliQ water. Solution was discarded and plate washed three times with PBS 1?/0.05% Tween 20 (PBST). After, 100 ?L of Monoclonal antibody Anti-IFNg-Biotine (BD bioscienceBD559958) diluted 1/250 in PBS 1?/10% FBS (PBSS) and incubated for 2 hours at room temperature. Detection antibody solution was discarded and plate washed three times with PBST. 100 ?L conjugated Streptavidin-HRPO diluted 1/100 in PBSS was loaded into the plate and incubated for 1 hour at room temperature. Conjugated streptavidin-HRPO solution was discarded and plate washed four times with PBST. Detection was made adding 100 ?L of BD ELISPOT AEC substrate set (BD Bioscience Cat. 551951. Lot 4314987) according to manufacturers instructions. Revealing step was stopped using distilled water and then spots were counted (Table 5).
TABLE-US-00007 TABLE 5 ELISPOT RESULTS FOR IFN-g PRODUCTION BY PORCINE PBMCs STIMULATION WITH DIFFERENT ANTIGENS. Pyrsvac-183 (5 ? 10.sup.2-4) 1 ?g of each peptide Animal # TCID 50% SEQ ID NO: 16, 17 and 18/well 81 0 191 85 43 40 86 2 37 87 0 169.5 90 0 184.5
[0144] The Enzyme-Linked ImmunoSpot (ELISPOT) allows, at appropriate conditions, the visualization of the secretory products of individual activated or responding cells. Each spot that develops in the assay represents a single reactive cell. Thus, the ELISPOT assay provides both qualitative (regarding the specific cytokine or other secreted immune molecule) and quantitative (the frequency of responding cells within the test population) information.
[0145] In this particular case, quantification of Interferon gamma (IFN-g) producing cells from the animals vaccinated with peptides or exosomes (Table 4), after stimulation with vaccine antigens or peptides related to PRRSV, was obtained.
[0146] The importance of IFN gamma in the immune system stems in part from its ability to inhibit viral replication directly, and most importantly from its immunostimulatory and immunomodulatory effects. IFN gamma is produced predominantly by natural killer (NK) and natural killer T (NKT) cells as part of the innate immune response, and by CD4 Th1 and CD8 cytotoxic T lymphocyte (CTL) effector T cells once antigen-specific immunity develops.
[0147] As seen in these results (Table 5), PBMCs derived from animals 81, 85 and 86 vaccinated with the peptides of the invention are able to produce interferon gamma when these cells are subsequently stimulated with these antigens (peptides). Moreover, PBMCs derived from animals 85 (vaccinated with peptide of the invention) produced interferon gamma in the presence of the attenuated viral particle of PRRSV (Pyrsvac-183 vaccine), which was a different antigen than the one used for its vaccination (see Table 4). Most relevant, when animals vaccinated with exosomes from non-viremic animals (87,90) received a single boost with the peptides, these animals produced interfon gamma; thus proving unequivocally that these exosomes contained and exposed such peptides to the immune system of swine. This data shows the capacity of peptides vaccine to induce cellular immunity against PRRSV antigens.
Example 11
11.1. Sample Collection.
[0148] Sera samples from farm animals (swine) in which there had been an episode of Mycoplasma suis were collected. This farm suffer annual episodes of Mycoplasma infections. To determine if these animals were infected by this bacteria, blood samples were analyzed by routine laboratory tests (Zootecnia, Salamanca-Spain), and gave positive results for Mycoplasma suis by PCR and microscopy techniques (genus Mycoplasma) following their own standard operation procedures.
TABLE-US-00008 TABLE 6 ANIMAL SERA INFORMATION FOR VACCINE PREPARATION. ID from Farm Specie Mycoplasma genus q-PCR 200415-MS Swine Positive Positive 200415-RMS Swine Positive Positive
[0149] All these samples were grouped as cured animals due to the fact that samples received at Innovex Therapeutics were collected after the disease and clinical symptoms disappeared of the population.
11.2. Serum-Derived Exosome Isolation.
[0150] The exosomes have a characteristic particle size of 30-100 nm. Therefore, to collect these vesicles from different samples a separation process through size exclusion chromatography using sepharose CL2B as separation matrix, was used (Boing A. N. et al., Single-step isolation of extracellular vesicles by size-exclusion chromatography, 2014, J. Extracell Vesicles, 3). While there are other techniques for preparing exosomes, the sepharose technique allows a better purification of the exosomes. Briefly, frozen 3 mL aliquots of different sera samples were thawed on ice and centrifuged at 500 g for 10 minutes at room temperature to disrcard cell debris. In parallel, sepharose CL-2B (Sigma-Aldrich, St. Louis, Mo., USA) were packed in 12 mL syringes until a final volume of 10 mL, and balanced with phosphate-buffered saline (PBS) 0.32% of sodium citrate (w/v). Later, 2 mL aliquots of each sample were added to individual sepharose CL-2B columns and 18-20 fractions of 0.5 mL aliquots were collected for each sample.
11.3. Molecular Characterization of Exosomes.
[0151] Once obtained the different exosome fractions, the presence of the vesicles was confirmed by the analysis of protein concentration using Bradford assay, and the analysis using molecular markers performed by flow cytometry.
11.3.1. Bradford Analysis.
[0152] Protein concentration was obtained using a colorimetric assay with Bradford technique (Bradford M. M. A rapid and sensitive method for the quantitation of microgram quantities of protein utilizing the principle of protein-dye binding, 1976, Analytical biochemistry, vol. 7(72), p?ginas 248-254)
11.3.2. Flow Cytometry.
[0153] In parallel, fractions were also analyzed by flow cytometry to detect the presence of the antigens CD9, CD63 or CD81, three tetraspanins that are particular exosome markers (Raposo G. et al., Extracellular vesicles: exosomes, microvesicles, and friends, 2013, The Journal of cell biology, vol. 18(200), page 373-383). Each aliquot was subjected to the following protocol: 4 microns of latex beads (aldehyde-sulfate) (Invitrogen Cat? A37304) were added to each aliquot, and the mix was left for 15 minutes in resting conditions before adding 1 mL of BCB buffer (PBS 1?, 0.1% bovine serum albumin, 0.01% sodium azide). The resulting mix was incubated overnight at room temperature in rotation before the incubation with primary antibodies (anti-CD63, anti-CD9 and anti-CD81, kindly provided by Dr. Francisco Sanchez-Madrid) for 30 minutes at 4? C. Both antibodies were used in 1:10 dilution. After two wash steps with 150 ?L of PBS-BSA buffer (Phosphate-buffered saline/bovine serum albumin 0.1%), and centrifugation at 2000 g for 10 minutes, secondary antibodies conjugated to FITC (1:100 dilution) or alexa 488 (1:1000 dillution) (Southern Biotec cat? 1032-02) were added and the mix was incubated for 30 minutes at 4? C. After two additional wash steps with 150 ?L of PBS-BSA buffer at 0.1% at 2000 g for 10 minutes, the latex beads were resuspended in 100 ?L of PBS-BSA 0.1%.
[0154] Resulting samples were analyzed by flow cytometry using LRSFortessa flow cytometer (BD Biosciences) and adjusting counting threshold at 10000 events. Using FlowJo analysis software, FCS files corresponding to each sample processed were added to the worklist, the area (forward and side scatter) where latex beads population was concentrated, was selected, and the fluorescence for FITC related to this area was measured. A table was made with the median intensity fluorescence (MFI) data and bead counts obtained in the gated area for each sample analyzed. 20000 individual latex beads were examined per sample and the MFI was used for comparison between fractions.
[0155] Following both protocols, as shown in
11.4. Exosome Protein Profile Analysis.
11.4.1. Analysis of the Distribution and Size of the Exosomes Using Nanoparticle Tracking Analysis (NTA).
[0156] The use of NTA for quantification, distribution and size of microvesicles, particularly exosomes, has become one of the most used techniques in the extracellular vesicles field. (htt://www.malvern.com/en/products/technoloy/nanoparticle-tracking-analysis/). Therefore, after the confirmation of the presence of the markers associated to these vesicles in the fractions, we decided to quantify the number and the size of the microvesicles population present in the analyzed samples. In order to do so, each analyzed sample was diluted in PBS until the NTA chamber (Malvern Instruments Ltd) detected a value between 20-100 particles per field. Once reached this ideal concentration and dilution, 400 ?L were injected into the NTA chamber and microscope capture level was manually adjusted. The digital thermometer was activated and the focalization of the particles with less refraction was started using the micrometer of the microscope in the area closest to the laser beam circumferences. Automatic acquisition of videos was started, and the analysis of the obtained videos was done using the software developed by the equipment's supplier. Thus, it was confirmed that the majority of samples had a vesicle concentration in order of magnitude of 10.sup.10 particles per milliliter. In addition, mode size was measured and ranged between 40-150 nm.
11.5. Proteomic Analysis Using Liquid Chromatography and Mass Spectrometry.
[0157] Liquid chromatography (nanoLCULTRA-EKSIGENT) followed by mass spectrometry (LC-MS/MS) was carried out in an LTQ Orbitrap Velos equipment (Thermo Fisher). Exosome samples in PBS, were reduced with 10 mM DTT (Dithiothreitol), alkylated with 55 mM of iodoacetamide, and precipitated with 10% trichloroacetic acid (TCA), washed with 100% acetone and reconstituted in 2 mL of 8M urea. Before overnight digestion with trypsin, samples were resuspended in 1.6M urea solution. Reaction was stopped with 1% formic acid (v/v) and trypsinized samples were passed through a precolumn (C18PepMap-100-Thermoscientific-5 mm-ID300 um-5 um-100A), before their injection in an analytical column (AcclaimPepMap100-Thermoscientific-15 cm-ID75 um-3 um-100A-C18). Samples eluted at 400 nL/minute with a mobile phase gradient: 0-40% of dissolvent B in dissolvent A for the first 80-90 minutes and then 40-100% of dissolvent B in dissolvent A until experiment ending at 100-110 minutes (A: 3% acetonitrile, 0.1% formic acid in water, B: 97% acetonitrile, 0.1% formic acid in water). The Eluate was applied to the nano-spray source of the spectrometer Orbitrap and all full-scan mass spectra acquired in the Orbitrap over a mass range of 400-1500 m/z with a resolution of 30,000 and a maximum injection time of 500 ms were analyzed. The MS/MS was done in the LTQ and the 20 more intense peptides were isolated and fragmented using a low collision energy 35% CID. Maxquant v1.5 software was used to analyze the raw data, using the label-free-quantification (LFQ) mode. Moreover, for the final identification we used the sequence search engine, Andromeda (module included in Maxquant v1.5 software), adding a sequence dataset created from the sequences obtained from the UniProtKB website, including all Mycoplasma suis proteins sequences that had been sequenced until that moment (approximately 4566 sequences).
TABLE-US-00009 TABLE7 BACTERIALPROTEINSIDENTIFIEDBYLC-MS/MS. SEQ IDNO Sequence Protein 6 LEELFK ABCtransporterATP-binding protein 7 KGSIVDIENQK tRNA(5-methylaminomethyl-2- thiouridine)-methyltransferase
[0158] From this analysis, two bacterial proteins were identified and two of them with more than two unique peptides. Thus, it could be concluded that exosomes produced in an animal (Swine), which has overcome the disease (Mycoplasmosis), and that does not present traces of the pathogen, expresses the proteins shown in the table below. Importantly, all proteins identified by Maxquant v1.5 have an associated probability known as PEP or posterior error probability, which indicates the probability to misidentify one protein by comparison. All the proteins identified in this analysis presented a PEP<0.0001, reinforcing the validity of these results.
Example 12
12.1. Sample Collection.
[0159] Sera samples from farm animals (Frisona Bovine strain) in which there had been an episode of Theileriosis were collected. This farm suffer annual episodes of Theileriosis (endemic of Menorca Island). The episode occurred between October and December of 2015. To determine if these animals were infected by this parasite, blood samples were analyzed by routine laboratory tests (Menorca), and gave positive (moderate-high) results for Theileria sp. Most of the tested animals died after laboratory diagnosis and presented symptoms like high fever, jaundice, anorexy, prostration and loss of milk in lactating cows.
[0160] All these samples were grouped as cured animals due to the fact that survive the disease after treatment.
TABLE-US-00010 TABLE 8 ANIMAL SERA INFORMATION FOR VACCINE PREPARATION. ID from Age Farm Specie Strain Location Affected in (yrs) Lactancy 7534 Bovine Frisona Menorca October- 2 N/A December 6888 Bovine Frisona Menorca October- 2 N/A December
12.2. Serum-Derived Exosome Isolation.
[0161] The exosomes have a characteristic particle size of 30-100 nm. Therefore, to collect these vesicles from different samples a separation process through size exclusion chromatography using sepharose CL2B as separation matrix, was used (Boing A. N. et al., Single-step isolation of extracellular vesicles by size-exclusion chromatography, 2014, J. Extracell Vesicles, 3). While there are other techniques for preparing exosomes, the sepharose technique allows a better purification of the exosomes. Briefly, frozen 3 mL aliquots of different sera samples were thawed on ice and centrifuged at 500 g for 10 minutes at room temperature to discard cell debris. In parallel, sepharose CL-2B (Sigma-Aldrich, St. Louis, Mo., USA) were packed in 12 mL syringes until a final volume of 10 mL, and balanced with phosphate-buffered saline (PBS) 0.32% of sodium citrate (w/v). Later, 2 mL aliquots of each sample were added to individual sepharose CL-2B columns and 18-20 fractions of 0.5 mL aliquots were collected for each sample.
12.3. Molecular Characterization of Exosomes.
[0162] Once obtained the different exosome fractions, the presence of the vesicles was confirmed by the analysis of protein concentration using Bradford assay, and the analysis using molecular markers performed by flow cytometry.
12.3.1. Bradford Analysis.
[0163] Protein concentration was obtained using a colorimetric assay with Bradford technique (Bradford M. M. A rapid and sensitive method for the quantitation of microgram quantities of protein utilizing the principle of protein-dye binding, 1976, Analytical biochemistry, vol. 7(72), p?ginas 248-254)
12.3.2. Flow Cytometry.
[0164] In parallel, fractions were also analyzed by flow cytometry to detect the presence of the antigens CD63 or CD81, two tetraspanins that are particular exosome markers (Raposo G. et al., Extracellular vesicles: exosomes, microvesicles, and friends, 2013, The Journal of cell biology, vol. 18(200), page 373-383). Each aliquot was subjected to the following protocol: 4 microns of latex beads (aldehyde-sulfate) (Invitrogen Cat? A37304) were added to each aliquot, and the mix was left for 15 minutes in resting conditions before adding 1 mL of BCB buffer (PBS 1?, 0.1% Bovine serum albumin, 0.01% Sodium azide). The resulting mix was incubated overnight at room temperature in rotation before the incubation with primary antibodies (anti-CD63 and anti-CD81, kindly provided by Dr. Francisco Sanchez-Madrid) for 30 minutes at 4? C. Both antibodies were used in 1:10 dilution. After two wash steps with 150 ?L of PBS-BSA buffer (Phosphate-buffered saline/bovine serum albumin 0.1%), and centrifugation at 2000 g for 10 minutes, secondary antibodies conjugated to FITC (1:100 dilution) or alexa 488 (1:1000 dillution) (Southern Biotec cat? 1032-02) were added and the mix was incubated for 30 minutes at 4? C. After two additional wash steps with 150 ?L of PBS-BSA buffer at 0.1% at 2000 g for 10 minutes, the latex beads were resuspended in 100 ?L of PBS-BSA 0.1%.
[0165] Resulting samples were analyzed by flow cytometry using LRSFortessa flow cytometer (BD Biosciences) and adjusting counting threshold at 10000 events. Using FlowJo analysis software, FCS files corresponding to each sample processed were added to the worklist, the area (forward and side scatter) where latex beads population was concentrated, was selected, and the fluorescence for FITC related to this area was measured. A table was made with the median intensity fluorescence (MFI) data and bead counts obtained in the gated area for each sample analyzed. 20000 individual latex beads were examined per sample and the MFI was used for comparison between fractions.
[0166] Following both protocols, as shown in
12.4. Exosome Protein Profile Analysis.
12.4.1. Analysis of the Distribution and Size of the Exosomes Using Nanoparticle Tracking Analysis (NTA).
[0167] The use of NTA for quantification, distribution and size of microvesicles, particularly exosomes, has become one of the most used techniques in the extracellular vesicles field. (http://www.malvern.com/en/products/technolov/nanoarticle-tracking-analysis/). Therefore, after the confirmation of the presence of the markers associated to these vesicles in the fractions, we decided to quantify the number and the size of the microvesicles population present in the analyzed samples. In order to do so, each analyzed sample was diluted in PBS until the NTA chamber (Malvern Instruments Ltd) detected a value between 20-100 particles per field. Once reached this ideal concentration and dilution, 400 ?L were injected into the NTA chamber and microscope capture level was manually adjusted. The digital thermometer was activated and the focalization of the particles with less refraction was started using the micrometer of the microscope in the area closest to the laser beam circumferences. Automatic acquisition of videos was started, and the analysis of the obtained videos was done using the software developed by the equipment's supplier. Thus, it was confirmed that the majority of samples had a vesicle concentration in order of magnitude of 10.sup.10 particles per milliliter. In addition, mode size was measured and ranged between 40-150 nm.
12.5. Proteomic Analysis Using Liquid Chromatography and Mass Spectrometry.
[0168] Liquid chromatography (nanoLCULTRA-EKSIGENT) followed by mass spectrometry (LC-MS/MS) was carried out in an LTQ Orbitrap Velos equipment (Thermo Fisher). Exosome samples in PBS, were reduced with 10 mM DTT (Dithiothreitol), alkylated with 55 mM of iodoacetamide, and precipitated with 10% trichloroacetic acid (TCA), washed with 100% acetone and reconstituted in 2 mL of 8M urea. Before overnight digestion with trypsin, samples were resuspended in 1.6M urea solution. Reaction was stopped with 1% formic acid (v/v) and trypsinized samples were passed through a precolumn (C18PepMap-100-Thermoscientific-5 mm-ID300 um-5 um-100A), before their injection in an analytical column (AcclaimPepMap100-Thermoscientific-15 cm-ID75 um-3 um-100A-C18). Samples eluted at 400 nL/minute with a mobile phase gradient: 0-40% of dissolvent B in dissolvent A for the first 80-90 minutes and then 40-100% of dissolvent B in dissolvent A until experiment ending at 100-110 minutes (A: 3% acetonitrile, 0.1% formic acid in water, B: 97% acetonitrile, 0.1% formic acid in water). The Eluate was applied to the nano-spray source of the spectrometer Orbitrap and all full-scan mass spectra acquired in the Orbitrap over a mass range of 400-1500 m/z with a resolution of 30,000 and a maximum injection time of 500 ms were analyzed. The MS/MS was done in the LTQ and the 20 more intense peptides were isolated and fragmented using a low collision energy 35% CID. Maxquant v1.5 software was used to analyze the raw data, using the label-free-quantification (LFQ) mode. Moreover, for the final identification we used the sequence search engine, Andromeda (module included in Maxquant v1.5 software), adding a sequence dataset created from the sequences obtained from the UniProtKB website, including all Theileria sp. proteins sequences that had been sequenced until that moment (approximately 18779 sequences).
[0169] From this analysis, five parasite proteins were identified and two of them with more than two unique peptides. Thus, it could be concluded that exosomes produced in an animal (Bovine), which has overcome the disease (Theileriosis), and that does not present traces of the pathogen, expresses the proteins show in the table below. Importantly, all proteins identified by Maxquant v1.5 have an associated probability known as PEP or posterior error probability, which indicates the probability to misidentify one protein by comparison. All the proteins identified in this analysis presented a PEP<0.0001, reinforcing the validity of these results.
TABLE-US-00011 TABLE9 PARASITEPROTEINSIDENTIFIEDBYLC-MS/MS. SEQIDNo: Sequence 8 MQIFVK 9 TITLEVEPSDTIENVK 10 IENLSDTFLSNNGKPEYKR 11 AGFAGDDAPR 12 IWHHTFYNELR 13 YPIEHGIVTNWEDMEK 14 STELLIRK 15 EGDGVCTITAKMPKDEQK