SELECTIVE SURFACES FOR, AND METHODS OF, SELECTING A POPULATION OF STEM AND PROGENITOR CELLS, AND USES THEREOF
20180163173 ยท 2018-06-14
Inventors
Cpc classification
A61K2239/26
HUMAN NECESSITIES
A61K39/4611
HUMAN NECESSITIES
A61K2035/124
HUMAN NECESSITIES
C12N5/0087
CHEMISTRY; METALLURGY
A61K39/46433
HUMAN NECESSITIES
A61K2239/38
HUMAN NECESSITIES
International classification
C12N5/00
CHEMISTRY; METALLURGY
Abstract
The present invention discloses selective surfaces, wherein said selective surfaces comprise a biocompatible polymer comprising maleic anhydride molecules and an apoptosis inducing ligand bound to the maleic anhydride molecules. The invention also encompasses devices and kits comprising the selective surface and methods for its production. The selective surfaces may be used for functional selection of cell populations suitable for transplantation into human subjects.
Claims
1-82. (canceled)
83. A selective surface, comprising: a biocompatible polymer comprising maleic anhydride molecules; and an apoptosis inducing ligand bound to the maleic anhydride molecules.
84. The selective surface of claim 83, wherein said selective surface is capable of selecting apoptosis-signaling resistant cells.
85. The selective surface of claim 83, wherein said selective surface is in the form of an inner surface of a container, a film, a disc or beads.
86. The selective surface of claim 83, wherein the biocompatible polymer is selected from the group consisting of polypropylene, polystyrene, silicone, polyvinyl chloride, polyethylene, polyurethane, ethylene vinyl acetate (EVA), fluorocarbon polymers, polyethylene glycol, polyethylene terephthalate (PET), Poly(2-hydroxyethyl methacrylate), Poly(N-2-hydroxypropyl methacrylamide), dimethacrylate, PEG-dMA, Poly(ethylene glycol) diacrylate (PEG-dA), pHEMA, pHPMA, and any combination thereof.
87. The selective surface of claim 85, wherein said beads are selected from the group consisting of magnetic beads, paramagnetic beads, and dextran beads.
88. The selective surface of claim 85, wherein said beads are agarose beads, polystyrene beads, sepharose beads or silica beads bound to N-hydroxysuccinimide (NHS), NHS-activated agarose beads or beads comprising aldehyde-activated agarose, azlactone-activated support, carbonyl diimidzaole agarose/Trisacryl, carboxyl groups, cyanogen bromide, polyethylene glycol (PEG), and any combination thereof.
89. The selective surface of claim 85, wherein said beads are uniformly composed, wherein said beads are non-uniformly composed, or a mixture of uniformly and non-uniformly composed beads.
90. The selective surface of claim 83, wherein the apoptosis-inducing ligand is TNF?, FasL, Trail, Tweak, or any combination thereof.
91. The selective surface of claim 90, wherein from about 0.01 to about 3 ng/cm.sup.2 of FasL or TNF? is bound to the selective surface.
92. A device comprising the selective surface of claim 83.
93. The device of claim 92, wherein said device is a container.
94. The device of claim 93, wherein the selective surface is the selective surface of a plurality of beads contained within the container.
95. A method of preparing a device having a selective surface, said method comprising: (i) obtaining a selective surface comprising a biocompatible polymer coated with or comprising maleic anhydride molecules (maleic anhydride-copolymer); (ii) incubating said selective surface with an immobilization buffer or coating buffer comprising at least one dissolved apoptosis inducing ligand; and (iii) removing the unbound at least one dissolved apoptosis inducing ligand from the selective surface, thereby obtaining a device having a selective surface comprising a biocompatible polymer coated with or comprising maleic anhydride molecules (maleic anhydride-copolymer), and wherein said surface further has an apoptosis inducing ligand immobilized thereon.
96. A cell selection kit, comprising: a. the selective surface of claim 83; and b. instructions for use in the selection of stem and progenitor cells which are resistant to receptor-mediated apoptosis.
97. A method of selecting apoptosis-signaling resistant cells or enriching a heterogeneous population of cells with apoptosis-signaling resistant cells, said method comprising: a. obtaining the selective surface of claim 83; b. contacting a sample comprising heterogeneous population of cells comprising apoptosis-signaling resistant cells and apoptosis-signaling sensitive cells with the surface or the device; c. incubating said heterogeneous population of cells with the surface or in the device thereby exposing the cells to the apoptosis inducing ligand immobilized on the selective surface; and d. retrieving the viable cells that have not undergone apoptosis, thereby selecting apoptosis-signaling resistant cells from the heterogeneous population or enriching the heterogeneous population of cells with apoptosis-signaling resistant cells.
98. A method for improving the clinical outcome of hematopoietic stem and progenitor cells (HSPC) transplantation, said method comprising: a. obtaining the selective surface of claim 83; b. contacting a sample comprising HSPC with the surface or the device; c. incubating said sample with the surface or in the device thereby exposing the cells to the apoptosis inducing ligand immobilized on the selective surface; d. retrieving the viable HSPC that have not undergone apoptosis, thereby obtaining an enriched population of HSPC; and e. transplanting the retrieved enriched population of HSPC in a subject in need thereof, thereby improving the clinical outcome of HSPC transplantation.
99. A method for eliminating at least one malignant cell in a composition comprising a stem and/or progenitor cell transplant, said method comprising: a. obtaining the selective surface of claim 83; b. contacting a composition comprising a stem and/or progenitor cell transplant optionally comprising malignant cells with the surface or the device; c. incubating said composition with the surface or in the device thereby exposing the cells to the apoptosis inducing ligand immobilized on the selective surface; d. retrieving the viable stem and/or progenitor cells of the cell transplant that have not undergone apoptosis, thereby obtaining a depleted population of stem and/or progenitor cells from which apoptosis-sensitive malignant cells were at least partially eliminated; and e. transplanting the retrieved depleted population of stem and/or progenitor cells in a subject in need thereof.
100. A method for reducing a transplant patient's likelihood of having graft vs. host disease (GvHD) while retaining graft vs. tumor (GvT) activity, said method comprising: a. obtaining the selective surface of claim 83; b. contacting a cell population comprising HSPC and immune cells with the surface or the device; c. incubating said cell population with the surface or in the device thereby exposing the cells to the apoptosis inducing ligand immobilized on the selective surface; d. retrieving the viable cells that have not undergone apoptosis thereby obtaining an enriched population of HSPC from which apoptosis-sensitive immune cells were at least partially eliminated; and e. transplanting the retrieved enriched population of HSPC into the transplant patient in need thereof.
101. A selective surface, comprising: at least one fluorocarbon polymer; and an apoptosis inducing ligand bound directly or indirectly to the fluorocarbon polymer.
102. The selective surface of claim 101, wherein said selective surface is in the form of a film, a disc or beads.
Description
DESCRIPTION OF FIGURES
[0122] The present invention will be further explained with reference to the attached drawings, wherein like structures are referred to by like numerals throughout the several views. The drawings shown are not necessarily to scale, with emphasis instead generally being placed upon illustrating the principles of the present invention. Further, some features may be exaggerated to show details of particular components.
[0123] The figures constitute a part of this specification and include illustrative embodiments of the present invention and illustrate various objects and features thereof. Further, the figures are not necessarily to scale, some features may be exaggerated to show details of particular components. In addition, any measurements, specifications and the like shown in the figures are intended to be illustrative, and not restrictive. Therefore, specific structural and functional details disclosed herein are not to be interpreted as limiting, but merely as a representative basis for teaching one skilled in the art to variously employ the present invention.
[0124] Among those benefits and improvements that have been disclosed, other objects and advantages of this invention will become apparent from the following description taken in conjunction with the accompanying figures. Detailed embodiments of the present invention are disclosed herein; however, it is to be understood that the disclosed embodiments are merely illustrative of the invention that may be embodied in various forms. In addition, each of the examples given in connection with the various embodiments of the invention is intended to be illustrative, and not restrictive.
[0125]
[0126]
[0127]
[0128]
[0129]
[0130]
[0131]
[0132]
[0133]
[0134]
[0135]
[0136]
[0137]
[0138]
[0139]
[0140]
[0141]
DETAILED DESCRIPTION OF THE INVENTION
[0142] Before explaining at least one embodiment of the invention in detail, it is to be understood that the invention is not limited in its application to the details set forth in the following description or exemplified by the Examples. The invention is capable of other embodiments or of being practiced or carried out in various ways. Also, it is to be understood that the phraseology and terminology employed herein is for the purpose of description and should not be regarded as limiting.
[0143] Throughout the specification and claims, the following terms take the meanings explicitly associated herein, unless the context clearly dictates otherwise. The phrases in one embodiment and in some embodiments as used herein do not necessarily refer to the same embodiment(s), though it may. Furthermore, the phrases in another embodiment and in some other embodiments as used herein do not necessarily refer to a different embodiment, although it may. Thus, as described below, various embodiments of the invention may be readily combined, without departing from the scope or spirit of the invention.
[0144] In addition, as used herein, the term or is an inclusive or operator, and is equivalent to the term and/or, unless the context clearly dictates otherwise. The term based on is not exclusive and allows for being based on additional factors not described, unless the context clearly dictates otherwise. In addition, throughout the specification, the meaning of a, an, and the include plural references. The meaning of in includes in and on.
[0145] In a first of its aspects, the present invention provides a selective surface, wherein said selective surface comprises a biocompatible polymer comprising maleic anhydride molecules and an apoptosis inducing ligand bound to the maleic anhydride molecules.
[0146] As used herein the term selective surface refers to a surface configured to selectively bind and/or affect a cell of interest. Non-limiting examples of surfaces include an inner surface of a container (e.g. a bag, a plate, a multi-well plate, a column, a tube, a bottle, a vial, a drum or a flask), or a removable surface such as a film or a bead (or a plurality of beads).
[0147] As used herein, biocompatible is a term describing a compatibility of a material, an object, a surface, a device or a polymer with biological entities e.g. cells, biological fluids, such as blood or plasma, and tissues. In some embodiments, a biocompatible material may be used for providing surfaces which will contact blood, plasma, cells or tissues in, for example, a container (e.g. a bead, a removable surface, a bag, a plate, a multi-well plate, a column, a tube, a bottle, a vial, a drum or a flask).
[0148] As used herein a biocompatible polymer is a polymer suitable for contacting a biological entity (e.g. cells). In one embodiment, a biocompatible polymer comprises a hydrophobic polymer coated with at least one layer that promotes the survival of apoptosis resistant cells of the invention.
[0149] Non limiting examples of a biocompatible polymer include polypropylene, polystyrene, silicone, polyvinyl chloride, polyethylene, polyurethane, ethylene vinyl acetate (EVA), fluorocarbon polymers such as perfluoroalkoxy alkanes (PFA), polytetrafluoroethylene (PTFE), fluorinated ethylene propylene (FEP), EFEP, Polyvinylidene fluoride (PVDF), fluoro modified polypropylene films. Polyether ether ketone (PEEK), High-density polyethylene (HDPE), Low-density polyethylene (LDPE), polysulfone (PSU), Ethylene tetrafluoroethylene (ETFE), polyethylene glycol, polyethylene terephthalate (PET), Poly(2-hydroxyethyl methacrylate), Poly(N-2-hydroxypropyl methacrylamide), dimethacrylate, PEG-dMA. Poly(ethylene glycol) diacrylate (PEG-dA), pHEMA, pHPMA, or any combination thereof.
[0150] In a preferred embodiment of the invention the biocompatible polymer further comprises maleic anhydride (MA) molecules. A biocompatible polymer which further comprises maleic anhydride (MA) molecules is also termed herein a maleic anhydride-copolymer. Maleic anhydride is an organic compound with the formula C.sub.2H.sub.2(CO).sub.2O. It is the acid anhydride of maleic acid. In one embodiment the biocompatible polymer is coated with MA. In another embodiment MA is incorporated into the biocompatible polymer using any method known in the art, for example as described in Nipithakul T. et al Chinese J. of Polymer Science Vol. 30, No. 2 (2012) or Chausse et al Clin. Chem 36/3, 525-528 (1990), the contents of which are incorporated herein by reference.
[0151] In certain embodiments the biocompatible polymer which comprises maleic anhydride (MA) molecules further comprises at least one additional compound capable of mediating binding of an apoptosis inducing ligand. In certain embodiments said additional compound is selected from the group consisting of an organic chemical, a protein, a protein fragment, a linker, a polynucleotide, or any combination thereof.
[0152] In another embodiment, the selective surface consists of a biocompatible polymer having maleic anhydride molecules incorporated therein and an apoptosis inducing ligand bound to the maleic anhydride molecules.
[0153] As used herein the term apoptosis inducing ligand refers to a compound with pro-apoptotic activity. In a non-limiting example, the apoptosis inducing ligand is selected from a group consisting of TNF?, FasL, Trail, Tweak, and any combination thereof. In a specific embodiment the apoptosis inducing ligand is TNF? or FasL. In a further non-limiting example, the apoptosis inducing ligand maintains its biological activity (e.g. its apoptosis inducing activity) when bound or immobilized onto a surface, such that its apoptotic activity can measure about at least 50% activity compared with a soluble apoptosis inducing ligand. Apoptotic activity can be measured for example by seeding cells that are susceptible to apoptosis (e.g. Jurkat cells as shown in the Examples) onto the selective surface of the invention and measuring the amount of apoptosis, for example by Annexin V staining.
[0154] In one embodiment, an apoptosis inducing ligand is FasL and/or TNF? comprising at least an active portion capable of binding the respective receptors and inducing apoptosis in its immobilized form bound to a surface.
[0155] In one embodiment, the apoptosis inducing ligand is derived from a mammalian source. In another embodiment, an apoptosis inducing ligand is a rodent (i.e., murine, including but not limited to mouse, rat, etc.) apoptosis inducing ligand. In another embodiment, the apoptosis inducing ligand is a human apoptosis inducing ligand.
[0156] A human FasL sequence, a human TNF? sequence, a human Trail sequence and a human Tweak sequence are provided below as SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, and SEQ ID NO: 4, respectively.
TABLE-US-00001 SEQ IDNo. Identification Sequence 1 HumanFasL MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCP TSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPP LKKRGNHSTGLCLLVMFFMVLVALVGLGLGMF QLFHLQKELAELRESTSQMHTASSLEKQIGHPSP PPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIV LLSGVKYKKGGLVINETGLYFVYSKVYFRGQSC NNLPLSHKVYMRNSKYPQDLVMMEGKMMSYC TTGQMWARSSYLGAVFNLTSADHLYVNVSELS LVNFEESQTFFGLYK 2 HumanTNF- MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLS alpha(?) LFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLI SPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQ WLNRKGQGCPSTHVLLTHTISRIAVSYQTKVNL LSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLE KGDRLSAEINRPDYLDFAESGQVYFGIIAL 3 HumanTrail MAMMEVQGGPSLGQTCVLIVIFTVLLQSLCVAV TYVYFTNEL KQMQDKYSKSGIACFLKEDDSYWDPNDE ESMNSPCWQVKWQLRQLVRKMILRTSEETISTV QEKQQNIS PLVRERGPQRVAAHITGTRGRSNTLSSPN SKNEKALGRKINSWESSRSGHSFLSNLHLRNGEL VIHEKGF 4 HumanTweak MAARRSQRRRGRRGEPGTALLVPLALGLGLALA CLGLLLAV VSLGSRASLSAQEPAQEELVAEEDQDPSE LNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRAR RAIAAHY EVHPRPGQDGAQAGVDGTVSGSGWEEARINS SSPLRYNRQIGEFIVTRAGLYYLYCQVHEDEGKA VYLKLDLL
[0157] In another embodiment, an apoptosis inducing ligand is a derivative or an analogue of the full protein (i.e., a complete amino acid sequence of a protein). In another embodiment, an apoptosis inducing ligand is a variant, derivative, modified version or truncated version of the full protein. In another embodiment, FasL is a human FasL such as set forth in SEQ ID NO: 1. In another embodiment, TNF? is a human TNF ? such as set forth in SEQ ID NO: 2. The proteins disclosed herein may be produced by recombinant or chemical synthetic methods.
[0158] As used herein. Fas Ligand (FasL) can refer to a FasL fusion protein, where a FasL protein can be fused with a tag at the N-terminus, the C-terminus, within the FasL protein, or any combination thereof, to construct a FasL fusion protein, such that the activity/binding affinity of FasL fusion protein is substantially the same or higher compared with endogenous (native) FasL. Namely the fusion protein is at least as active as the native molecule. Tags can include His-tags, FLAG-tags. MBP-tags, streptavidin-tags or any other tags typically used when performing protein analysis. Exemplary non-limiting embodiments of tagged FasL are: SuperFasLigand? (Enzo Life Sciences), Mega FasLigand? (AdipoGen), APO010 and streptavidin-FasL. Additionally, FasL can refer to a modified FasL protein, such as a truncated FasL protein, where the truncated FasL protein has substantially the same activity/binding affinity as endogenous FasL.
[0159] As used herein, TNF ? (TNF?) can refer to a TNF? fusion protein, where a TNF? protein can be fused with a tag at the N-terminus, the C-terminus, within the TNF? protein, or any combination thereof, to construct a TNF? fusion protein, such that the activity/binding affinity of TNF? fusion protein is substantially the same or higher compared with endogenous TNF?. Namely the fusion protein is at least as active as the native molecule. Tags can include His-tags, FLAG-tags, MBP-tags, His-tags, streptavidin-tags or any other tags typically used when performing protein analysis. An exemplary non-limiting embodiment of tagged TNF? is streptavidin-TNF?. Additionally, TNF? can refer to a modified TNF? protein, such as a truncated TNF? protein, where the truncated TNF? protein has substantially the same activity/binding affinity as endogenous TNF?.
[0160] TNF-related apoptosis-inducing ligand (Trail), also known as Apo-2 ligand and TNFSF10, is a type II transmembrane protein with a carboxy-terminal extracellular domain that exhibits homology to other TNF superfamily members. Among TNF superfamily members, Trail is the most homologous to Fas Ligand, sharing 28% amino acid sequence identity in their extracellular domains. Recombinant preparations of Trail are commercially available from various sources. e.g. R&D Systems.
[0161] Tweak is a type 11 transmembrane protein belonging to the TNF superfamily. A soluble form of Tweak is generated from the membrane-associated molecule by proteolytic cleavage after Arg 93. Tweak is expressed widely in many tissues and cells. Recombinant preparations of Tweak are commercially available from various sources, e.g. R&D Systems or AdipoGen.
[0162] In another embodiment, an apoptosis inducing ligand is a small organic molecule.
[0163] As used herein the term bound to or immobilized to, when referring to the interaction of the apoptosis inducing agent with the biocompatible biopolymer comprising the maleic anhydride molecules, encompasses any means of adherence or attachment of the apoptosis inducing agent to the biocompatible biopolymer comprising the maleic anhydride molecules. In one embodiment, the binding or immobilization is by chemical interaction with the maleic anhydride molecules, e.g. the MA molecules interact with primary amines (NH2) of the apoptosis inducing agent thus forming amide bonds.
[0164] In one embodiment, the selective surface of the invention is capable of selecting apoptosis-signaling resistant cells.
[0165] The term selecting or selection as used herein refers to a procedure in which only selected cells out of a heterogeneous cell population survive. In some embodiments, the selection is performed by incubating a heterogeneous population of cells with the selective surface of the invention. The procedure may further comprise filtering the population of cells after the incubation to retrieve at least one cell having selected-for characteristics. In one embodiment, the surviving cell (i.e. selected-for cell) is an apoptosis-signaling resistant cell. In another embodiment, an apoptosis inducing agent, e.g. FasL and/or TNF? are used as apoptotic inducing agent for selecting an apoptosis resistant cell.
[0166] The terms apoptosis-signaling resistant cells. apoptosis resistant or receptor-mediated apoptosis resistant are used interchangeably herein and relate to cells that do not undergo apoptosis in the presence of an apoptosis inducing agent. In some embodiments, the term refers to cells that do not undergo apoptosis in the presence of an apoptosis inducing agent, under conditions in which other (apoptosis-sensitive) cells do undergo apoptosis. Non-limiting examples of such conditions, e.g. concentrations of the apoptosis inducing agent and incubation times are provided in the Examples section below. In certain embodiments, the term apoptosis-signaling resistant cells relates to stem and progenitor apoptosis-resistant cells. Such cells include, for example, umbilical cord blood stem/progenitor cell, mobilized peripheral blood stem/progenitor cell, bone marrow stem/progenitor cell, cancer stem/progenitor cell, hematopoietic stem cells, or neural stem/progenitor cell.
[0167] In some embodiments, the apoptosis signaling resistant cells are leukocytes (also known as White blood cells (WBCs)). Leukocytes include neutrophils, eosinophils, basophils, monocytes and lymphocytes. Lymphocytes include B cells, T cells and NK cells.
[0168] Leukocytes may be identified on the basis of a surface phenotype, e.g. CD45, and are therefore identified as CD45+ cells.
[0169] CD45 (leukocyte common antigen) is a receptor-linked protein tyrosine phosphatase that is expressed on all leucocytes, and which plays a crucial role in the function of these cells.
[0170] In some embodiments, the apoptosis signaling resistant cells are identified on the basis of a surface phenotype, e.g. CD34+ cells.
[0171] The CD34 protein is a member of a family of single-pass transmembrane sialomucin proteins that show expression on early hematopoietic and vascular-associated tissue. Cells expressing CD34 (CD34.sup.+ cell) are found in various tissues, for example in the umbilical cord and bone marrow as hematopoietic cells, a subset of mesenchymal stem cells, or endothelial progenitor cells.
[0172] In some embodiments, the selected stem and progenitor apoptosis-resistant cell can be an immune cell insensitive to activation-induced cell death (AICD). In some embodiments, the immune cell insensitive to activation-induced cell death is a T cell. In another embodiment, the immune cell insensitive to AICD is a non-activated T cell.
[0173] The selective surface may be in the form of an inner surface of a container, a plate, a film, a disc, a bead, or a plurality of beads.
[0174] In some embodiments, when a selective surface is a surface of a bead of a plurality of beads, each bead of the plurality of beads can be uniformly composed, where a uniform composition refers to a surface material of each bead having the substantially the same chemical and/or physical composition as a core material of the bead.
[0175] In some embodiments, when a selective surface is a surface of a bead of a plurality of beads, each bead of a plurality of beads can be non-uniformly composed, where a non-uniform composition refers to a surface material of each bead having a substantially different chemical and/or physical composition as a core material of the bead.
[0176] In some embodiments, the selective surface of the instant composition of the present invention includes MA-bound beads, plates, or containers configured to bind a protein. e.g. an apoptosis inducing ligand, e.g., FasL, and where about ?1 ng-?4000 ng of FasL can be bound to the MA-coated beads, plates, containers, or any combination thereof. In a non-limiting example, standard tissue culture 96-well plates can be used as a selective surface bound to maleic anhydride; accordingly, the following proportions can be used to calculate the amount/concentration of, e.g., FasL and/or TNF?, for binding to other selective surfaces of containers and/or surfaces of heads. In some embodiments, MA-bound beads are configured to bind a protein, e.g. an apoptosis inducing ligand, e.g., FasL, where about ?4000 ng of FasL can be bound to the MA-coated beads. In some embodiments, a protein, e.g., FasL, can be bound to a surface at a concentration calculated by using an equivalent measurement of another protein, e.g. biotin, using for example, but not limited to, an equivalent amount of FasL in mass (grams) units to 125 picomoles of biotin. In some embodiments, the resulting MA-coated FasL bound wells can measure about 50% activity compared to 50 ng/ml soluble FasL (i.e., 10 ng per well in a plate). In some embodiments, the resulting MA-coated FasL bound wells can measure between 30-70% activity compared to 50 ng/ml soluble FasL. In some embodiments, the resulting MA-coated FasL bound wells can measure between 40-70% activity compared to 50 ng/ml soluble FasL. In some embodiments, the resulting MA-coated FasL bound wells can measure between 50-70% activity compared to 50 ng/ml soluble FasL. In some embodiments, the resulting MA-coated FasL bound wells can measure between 60-70% activity compared to 50 ng/ml soluble FasL. In some embodiments, the resulting MA-coated FasL bound wells can measure between 30-60% activity compared to 50 ng/ml soluble FasL. In some embodiments, the resulting MA-coated FasL bound wells can measure between 30-50% activity compared to 50 ng/ml soluble FasL. In some embodiments, the resulting MA-coated FasL bound wells can measure between 30-40% activity compared to 50 ng/ml soluble FasL.
[0177] In a non-limiting exemplary embodiment of the present invention, the selective surface is an amine immobilizer plate (e.g., Nunc amine immobilizer plate) composed of maleic anhydride bound to a protein, e.g., FasL (and/or TNF?), where FasL protein measures >30 kDa, and where about ?4000 ng of FasL can be bound to the amine immobilizer plate. While this exemplary embodiment illustrates FasL bound to the selective surface composed of maleic anhydride, the present invention also includes embodiments using bound TNF? in comparable concentrations. In some embodiments, both FasL and TNF? are bound to immobilizer plates such that the total concentrations of FasL and TNF ? equal the concentrations and activity noted herein.
[0178] In some embodiments, between 1 ng and 4000 ng of FasL can be bound to the amine immobilizer plates. In some embodiments, between 50 ng and 4000 ng of FasL can be bound to the amine immobilizer plates. In some embodiments, between 500 ng and 4000 ng of FasL can be bound to the amine immobilizer plates. In some embodiments, between 1000 ng and 4000 ng of FasL can be bound to the amine immobilizer plates. In some embodiments, between 2000 ng and 4000 ng of FasL can be bound to the amine immobilizer plates. In some embodiments, between 3000 ng and 4000 ng of FasL can be bound to the amine immobilizer plates. In some embodiments, between 1 ng and 3000 ng of FasL is bound to the amine immobilizer plates. In some embodiments, between 1 ng and 2000 ng of FasL is bound to the amine immobilizer plates. In some embodiments, between 1 ng and 1000 ng of FasL is bound to the amine immobilizer plates. In some embodiments, between 1 ng and 500 ng of FasL is bound to the amine immobilizer plates. In some embodiments, between 1 ng and 50 ng of FasL is bound to the amine immobilizer plates.
[0179] In some embodiments, the selective surface of the instant composition of the present invention includes maleic anhydride (MA)-bound beads, plates, or containers configured to bind at least one protein, e.g., FasL. TNF?, Trail, Tweak, or any combination thereof, where about 1 ng-100 ng of FasL, TNF?, Trail, Tweak. or any combination thereof, can be bound to the MA-coated beads, plates, containers, or any combination thereof. In some embodiments, the at least one protein, i.e., FasL, TNF?, Trail, Tweak, or any combination thereof, can be bound to the MA-coated beads, plates, containers, or any combination thereof at a concentration of 1-10 ng. In some embodiments, the at least one protein. i.e., FasL, TNF?, Trail, Tweak, or any combination thereof, can be bound to the MA-coated beads, plates, containers, or any combination thereof at a concentration of 1-25 ng. In some embodiments, the at least one protein, i.e., FasL, TNF?, Trail, Tweak, or any combination thereof, can be bound to the MA-coated beads, plates, containers, or any combination thereof at a concentration of 1-50 ng. In some embodiments, the at least one protein, i.e., FasL, TNF?, Trail, Tweak. or any combination thereof, can be bound to the MA-coated beads, plates, containers, or any combination thereof at a concentration of 1-75 ng. In some embodiments, the at least one protein, i.e., FasL, TNF?, Trail, Tweak, or any combination thereof, can be bound to the MA-coated beads, plates, containers, or any combination thereof at a concentration of 10-100 ng. In some embodiments, the at least one protein, i.e., FasL, TNF?, Trail, Tweak, or any combination thereof, can be bound to the MA-coated beads, plates, containers, or any combination thereof at a concentration of 25-100 ng. In some embodiments, the at least one protein. i.e., FasL, TNF?. Trail, Tweak, or any combination thereof, can be bound to the MA-coated beads, plates, containers, or any combination thereof at a concentration of 50-100 ng. In some embodiments, the at least one protein, i.e., FasL, TNF?. Trail, Tweak, or any combination thereof, can be bound to the MA-coated beads, plates, containers, or any combination thereof at a concentration of 75-100 ng.
[0180] In some embodiments, the density of linkers (e.g. the density of maleic anhydride molecules) is 1.7-3.4 residues/square nm. In some embodiments, the density of linkers is 2.0-3.4 residues/square nm. In some embodiments, the density of linkers is 2.5-3.4 residues/square nm. In some embodiments, the density of linkers is 3.0-3.4 residues/square nm. In some embodiments, the density of linkers is 1.7-3.0 residues/square nm. In some embodiments, the density of linkers is 1.7-2.5 residues/square nm. In some embodiments, the density of linkers is 1.7-2.0 residues/square nm. In some embodiments, the density of linkers is 2.0-3.0 residues/square nm. In some embodiments, micro-carriers are used. In some embodiments, micro-carriers are not used.
[0181] In some embodiments, the composition of the present invention includes a selective surface, where the selective surface can be selected from the following group: agarose/magnetic/polystyrene/sepharose/silica beads bound to N-hydroxysuccinimide (NHS) (e.g., NHS-activated agarose), aldehyde-activated agarose, azlactone-activated support, carbonyl diimidzaole agarose/Trisacryl, carboxyl groups, cyanogen bromide, polyethylene glycol (PEG), maleic anhydride, or any combination thereof. In some embodiments, the composition of the present invention includes a plurality of selective surfaces that can be selected from the following group: agarose/magnetic beads bound to N-hydroxysuccinimide (NHS) (e.g., NHS-activated agarose), Nunc amine immobilizer (Nunc?), aldehyde-activated agarose, azlactone-activated support, carbonyl diimidzaole agarose/Trisacryl, carbonyl diimidazole, carboxyl groups, azlactone, or any combination thereof.
[0182] In some embodiments, more specific examples of the composition of the present invention include selective surfaces, where the selective surfaces are the surfaces of a plurality of beads selected from the group consisting of agarose/magnetic beads bound to NHS (e.g., but not limited to, NHS-activated agarose, Thermo Scientific Catalog No. 26196, 26197, 26198, 26199); aldehyde-activated agarose (e.g., but not limited to, amino link resin, Thermo Scientific Catalog No. 20381, 20382), azlactone-activated support (e.g., but not limited to, Ultra link bio-support, Thermo Scientific Catalog No. 53110, 53111), carbonyl diimidazole agarose/Trisacryl, or any combination thereof.
[0183] In some embodiments, examples of the composition of the present invention include a selective surface, where the selective surface has a regular bead shape(s) (e.g., spherical shapes or spherical-like shape). In some embodiments, examples of the selective surface of the composition of the present invention include geometrical shapes, including bead (and any polygonal shape and ellipsoid shape), fiber, and film shapes.
[0184] In some embodiments, the composition of the present invention includes a protein ligand bound to a surface, where the protein ligand is FasL, and where the surface can be a plurality of beads, where the plurality of beads comprise a biocompatible material. In some embodiments, each of the plurality of beads measures between 20?-350? (as used herein ?=micron or micrometer). In some embodiments, each of the plurality of beads measures between 20?-300?. In some embodiments, each of the plurality of beads measures between 20-250?.
[0185] In some embodiments, each of the plurality of beads measures between 20?-200?. In some embodiments, each of the plurality of beads measures between 20?-150?. In some embodiments, each of the plurality of beads measures between 20?-100?. In some embodiments, each of the plurality of beads measures between 20?-300?. In some embodiments, each of the plurality of beads measures between 50?-350?. In some embodiments, each of the plurality of beads measures between 100?-350?. In some embodiments, each of the plurality of beads measures between 150?-350?. In some embodiments, each of the plurality of beads measures between 200?-350?. In some embodiments, each of the plurality of beads measures between 250?-350?. In some embodiments, each of the plurality of beads measures between 300?-350?. In some embodiments, each of the plurality of beads measures between 20?-50?. In some embodiments, each of the plurality of beads measures between 20?-90?. In some embodiments, each of the plurality of beads measures between 50?-150?. In some embodiments, each of the plurality of beads measures between 250?-350?.
[0186] In some embodiments, each of the plurality of beads measures between 1-5?.sup.3. In some embodiments, each of the plurality of beads measures between 0.1-10?.sup.3. In some embodiments, each of the plurality of beads measures between 1-10?.sup.3. In some embodiments, each of the plurality of beads measures between 2.5-10?.sup.3. In some embodiments, each of the plurality of beads measures between 5-10?.sup.3. In some embodiments, each of the plurality of beads measures between 7.5-10?.sup.3. In some embodiments, each of the plurality of beads measures between 0.1-7.5?.sup.3. In some embodiments, each of the plurality of beads measures between 0.1-5?.sup.3. In some embodiments, each of the plurality of beads measures between 0.1-2.5?.sup.3. In some embodiments, each of the plurality of beads measures between 0.1-1?.sup.3. In some embodiments, each of the plurality of beads measures between 1-3?.sup.3. In some embodiments, each of the plurality of beads measures between 3-5?.sup.3.
[0187] In some embodiments, the composition of the present invention includes surfaces of a plurality of beads, where the surfaces of the plurality of beads are configured to increase binding of cellular ligands, resulting in increased apoptosis compared with a flat surface bound to comparable peptides/proteins.
[0188] In some embodiments, the composition of the present invention includes surfaces of a plurality of beads, where the surfaces of the plurality of beads can be housed in a column. In some embodiments, the composition of the present invention includes the surfaces of a plurality of beads, where the beads are in slurry form. In some embodiments, the composition of the present invention includes surfaces of a plurality of beads, where the beads are in a packed form.
[0189] In some embodiments, the method of the present invention can include the packing a plurality of beads in a column, where the packing is achieved by a typical flow packing technique.
[0190] In some embodiments, the selective surface is kept dry. In another embodiment, the selective surface in placed in a solution for maintaining the integrity and activity of the apoptosis-inducing ligand, e.g. buffer or media.
[0191] In another embodiment, apoptosis-signaling resistant cell is resistant to FasL.
[0192] In some embodiments, the present invention is a device having a selective surface wherein the device can be used in the selection of stem and progenitor cells. In certain embodiments, the device is a container made of or coated with a biocompatible material further comprising a selective surface, namely a surface comprising a biocompatible polymer comprising maleic anhydride and a biologically active apoptosis-inducing ligand immobilized thereto. The biologically active apoptosis-inducing ligand may be immobilized to (a) an inner selective surface of the container and/or (b) selective surfaces of a plurality of beads within the container. In some embodiments, the container is selected from the group consisting of a bag, a plate, a multi-well plate, a column, a tube, a bottle, a vial, a drum and a flask.
[0193] In some embodiments, the device comprises a biocompatible material, where the biocompatible material includes, but is not limited to: polypropylene, polystyrene, silicone, polyvinyl chloride, polyethylene, polyurethane, ethylene vinyl acetate (EVA), fluoro carbons polymers such as perfluoroalkoxy alkanes (PFA), polytetrafluoroethylene (PTFE), fluorinated ethylene propylene (FEP). EFEP, Polyvinylidene fluoride (PVDF), fluoro modified polypropylene films. Polyether ether ketone (PEEK), High-density polyethylene (HDPE). Low-density polyethylene (LDPE), polysulfone (PSU), Ethylene tetrafluoroethylene (ETFE), polyethylene glycol, polyethylene terephthalate (PET), Poly(2-hydroxyethyl methacrylate), Poly(N-2-hydroxypropyl methacrylamide), dimethacrylate, PEG-dMA, Poly(ethylene glycol) diacrylate (PEG-dA), pHEMA, pHPMA, magnetic/paramagnetic beads, dextran beads having an iron oxide/hydroxide core (iron-dextran complex, about 50-100 nm in diameter) or any combination thereof. In some embodiments, the beads include: agarose/magnetic/polystyrene/sepharose/silica beads bound to N-hydroxysuccinimide (NHS) (e.g., NHS-activated agarose), aldehyde-activated agarose, azlactone-activated support, carbonyl diimidzaole agarose/Trisacryl, carboxyl groups, cyanogen bromide, polyethylene glycol (PEG). In some embodiments, the immobilized apoptosis-inducing ligand is Fas ligand (FasL). In some embodiments, the immobilized apoptosis-inducing ligand is TNF? (TNF?).
[0194] In some embodiments, when a selective surface is a surface of a bead or a plurality of beads, each bead of the plurality of beads can be uniformly composed, where a uniform composition refers to a surface material of each bead having substantially the same chemical and/or physical composition as a core material of the bead. In some embodiments, when a selective surface is a surface of a bead of a plurality of beads, each bead of a plurality of beads can be non-uniformly composed, where a non-uniform composition refers to a surface material of each bead having a substantially different chemical and/or physical composition as a core material of the bead.
[0195] In another embodiment, the device of the present invention can utilize and/or relate to a container, wherein the container having an inner selective surface and/or selective surfaces of a plurality of beads, where the selective surface(s) is/are composed of, e.g., a biopolymer with maleic anhydride bound to an apoptosis inducing ligand. In an embodiment, the device can provide a selective surface for binding stem cells. In another embodiment, the device of the present invention can use a container, with an apoptosis-inducing ligand immobilized to the surface of beads introduced therein. In another embodiment, the device of the present invention is utilized for selecting stem/progenitor cells using a single step. In another embodiment, single step includes the incubation of a heterogeneous cell population within the container. In another embodiment, incubation exposes the cell population to apoptotic ligands (e.g., FasL and/or TNF?) as provided herein. In another embodiment, incubation results in survival of apoptotic-resistant cells such as stem-cells and apoptotic death of apoptosis-sensitive cell types. In another embodiment, incubating a population of cells with the selective surface composed of, e.g., maleic anhydride, bound to FasL and/or TNF ? results in binding specific cells expressing proteins that interact/bind with FasL and/or TNF ?. In another embodiment, a selected population of apoptosis-signaling resistant cells do not bind to the selective surface.
[0196] In another embodiment, a selected population of apoptotic-resistant cells (such as stem and progenitor cells) is used for transplanting in the course of treating a disease, such as, but not limited to: cancer, immune diseases, chemotherapy-resistant cancer, or congenital or acquired immunodeficiency. In another embodiment, one of skill in the art can readily determine the use of apoptosis resistant cells of the invention.
[0197] In another embodiment, the container is constructed of at least one biocompatible material. In another embodiment, a biocompatible material includes but not limited to: polypropylene, polystyrene, silicone, polyvinyl chloride or a combination thereof. In another embodiment, a biocompatible material is selected according to parameters such as, but not limited to: durability or ability to facilitate immobilization of apoptosis-inducing ligands on its inner surface or transparency. In another embodiment, a biocompatible material is inert with respect to eliciting any undesirable local or systemic effects in the recipient or beneficiary of that therapy, but generating the most appropriate beneficial cellular or tissue response in that specific situation, and optimizing the clinically relevant performance of that therapy.
[0198] In another embodiment, container can be used in the selection of a population of stem and progenitor cells, and is a bag that is configured to house a plurality of beads having a plurality of surfaces having selective surfaces composed of, e.g., but not limited to, maleic anhydride bound to FasL and/or TNF?. In another embodiment, the container is a column, where a column can be packed with beads according to typical packing parameters, including adding a slurry of a plurality of beads to the column and flow packing the column. In another embodiment, the container is a tube. In another embodiment, the container is a bottle. In another embodiment, the container is a vial. In another embodiment, the container is a flask. In another embodiment, the container is a drum. In another embodiment, the container is any other receptacle which suits the specific intended selective use of the device.
[0199] According to one embodiment, the device that can be used in a selective method is comprised of a single container into which a cell-population is introduced. In another embodiment, the container comprises two interlocking chambers separated by a filter apparatus adapted to separate whole cells from cell debris and proteins. In another embodiment, a cell-population is introduced into one chamber, incubated within the chamber and after incubation the filter may be used to further isolate the selected cells from cell debris and proteins in the solution.
[0200] According to another embodiment, the container that can be used in a selective method is in the form of a column in which the cell population is incubated, allowing attachment of whole cells, or specifically of stem and/or progenitor cells, to the column. In another embodiment, following incubation, the remaining cell debris and proteins are discarded and the selected cells are isolated from the column.
[0201] In some embodiments, the method of preparing a selective surface or a plurality of selective surfaces in accordance with the present invention includes: (i) dissolving an apoptosis inducing ligand in a solution, medium or buffer, e.g. an immobilization buffer, (ii) adding the dissolved apoptosis inducing ligand to a surface composed of, or comprising, a maleic anhydride-copolymer as defined above, (iii) incubating the surface with the dissolved apoptosis inducing ligand, (iv) optionally, removing the unbound dissolved apoptosis inducing ligand from the surface, (v) optionally, adding a protein blocking buffer to the surface, (vi) optionally, incubating the surface with the protein blocking buffer, (vii) optionally, washing the surface. In some embodiments, the method further includes contacting and/or incubating a population of cells with the selective surface or a plurality of selective surfaces so as to result in (a) selective binding of cells expressing apoptosis inducing ligand binding proteins and (b) an unbound (i.e., free) cell population, where the cell population can include stem and progenitor cells.
[0202] According to another embodiment, the biologically active apoptosis-inducing ligand(s) (e.g., FasL and/or TNF?) is/are immobilized/bound to a selective surface composed of, e.g., maleic anhydride, where the selective surface can be the surfaces of a plurality of beads and/or a flat surface (e.g., a multi-well plate). In another embodiment, the biologically active apoptosis-inducing ligand(s) (e.g., FasL and/or TNF?) is/are immobilized to beads within the container. In another embodiment, the biologically active apoptosis-inducing ligands are immobilized in a manner that allows free interaction of the ligands with cells contained within the container.
[0203] In some embodiments, the selective method of the present invention can use immobilization methods that involve modification or coating of the surface with appropriate substances to change the surface property or provide functional groups for the binding of protein. In some embodiments, immobilization of proteins on a bare surface with no modification necessitates using an affinity peptide that is specific to the particular surface. In some embodiments, immobilization is achieved by utilizing a chelator compatible with the apoptosis inducing ligand of the invention. In some embodiments, a chelator is both compatible with the apoptosis inducing ligand of the invention and maintains its biological activity (e.g., but not limited to, at least 25% biological activity, at least 50% biological activity, at least 75% biological activity, at least 90% biological activity, at least 99% biological activity). In some embodiments, a chelator is (1) compatible with the apoptosis inducing ligand of the invention and (2) promotes biological activity of the apoptosis inducing ligand of the invention.
[0204] In another embodiment, immobilization of an apoptosis-inducing ligand is achieved by: physical adsorption, interaction between His-6 and Ni.sup.+ ions, coiled coil association of a heterodimeric Leu zipper pair. Chemisorption of SH groups, Schiff's base linkage between aldehyde and amino groups, acyl transfer reaction of TGase, affinity between streptavidin-biotin, affinity between FLAG and anti-FLAG antibody, affinity between glutathione and GST or binding of a protein fused with a PS-affinity peptide to hydrophilic polystyrene, or any combination thereof.
[0205] For example, in an embodiment, a method for immobilizing/stabilizing a protein and/or peptide on tissue culture-treated plastic surfaces can include:
[0206] (a) coating a tissue culture-treated plastic surface with a coating solution, where the coating solution comprises a protein or polypeptide to be immobilized in a concentration of about 1 ng/mL to about 2000 ng/mL, in a coating buffer, wherein the coating buffer has a buffer species dissolved in distilled and/or deionized water in a concentration of about 2 mM to about 500 mM and in one embodiment the pH of the coating buffer is from about 2 to about 6, in another embodiment the pH of the coating buffer is from about 6 to about 8, and in yet another embodiment, the pH is from about 8 to about 13:
[0207] (b) incubating the coating solution on the tissue culture-treated plastic surface;
[0208] (c) washing the plastic surface to remove any extraneous materials not firmly attached to the plastic surface;
[0209] (d) drying the plastic surface having the coating solution thereon;
[0210] (e) obtaining a tissue culture-treated plastic surface having a protein efficiently and stably bound thereto, or
[0211] (f) any combination thereof.
[0212] For example, in another embodiment, a method for immobilizing/stabilizing a protein and/or peptide on tissue culture-treated plastic surfaces can include:
[0213] (a) activating a group (e.g., but not limited to, carboxyl group) included in a solid substrate;
[0214] (b) surface-treating the solid substrate having the activated group by adhering the peptide hybrid for protein immobilization of the present invention onto the surface;
[0215] (c) binding a protein onto the surface-treated solid substrate of step 2), and a substrate for protein imnunobilization surface-treated with the peptide hybrid for protein immobilization of the invention prepared by the same;
[0216] (d) or any combination thereof.
[0217] For example, in another embodiment, the present invention can utilize a method of immobilizing a protein onto a support comprising in an expression system, expressing a fusion protein comprising a cleavable intein and reacting the fusion protein with a ligand capable of cleaving the intein to form a protein-ligand; and contacting the products of the expression system with a support that is functionalized with an affinity receptor, thereby immobilizing the protein-ligand onto the support. In another embodiment, the method can increase the efficiency of intein-mediated covalent attachment of a ligand to the C-terminus of a protein comprising expressing a fusion protein comprising a cleavable intein, wherein the fusion protein comprises at least one small side-chain amino acid immediately upstream to the N-terminus of the intein. Some embodiments also provide a method of immobilizing a protein onto a support comprising in a cell-free expression system, expressing a protein and covalently attaching. e.g., but not limited to, a puromycin-ligand at the C-terminus of the protein; and contacting the products of the cell-free expression system with a support that is functionalized with an affinity receptor, thereby immobilizing the protein onto the support.
[0218] In another embodiment, provided herein a method for selecting apoptosis-resistant cells out of a heterogeneous cell population, wherein the heterogeneous population comprises apoptosis-signaling resistant cells and apoptosis-signaling sensitive cells. In another embodiment, the method consists of introducing the heterogeneous cell population into a device and incubation therein. In another embodiment, the method comprises introducing a sample comprising the heterogeneous cell population into the device of the present invention and incubation therein. In one embodiment, an apoptosis-signaling resistant cell is a stem/progenitor cell.
[0219] In accordance with the invention, the device includes a biologically active apoptosis-inducing ligand (e.g. FasL and/or TNF?) immobilized to (a) an inner selective surface of a container and/or (b) selective surfaces of a plurality of beads within the container, resulting in selecting stem and progenitor apoptosis-signaling resistant cells from the cell population. In some embodiments, the method includes enriching stem and progenitor apoptosis-signaling resistant cells from a first cell population. In some embodiments, the selected stem and progenitor apoptosis-resistant cell is a stem/progenitor cell, selected from a group comprising: umbilical cord blood stem/progenitor cell, mobilized peripheral blood stem/progenitor cell, bone marrow stem/progenitor cell, hematopoietic stem cells, cancer stem/progenitor cell, and neural stem/progenitor cell.
[0220] In some embodiments, the selected stem and progenitor apoptosis-resistant cell can be an immune cell insensitive to activation-induced cell death (AICD). AICD, as used herein refers to cell of the immune system that does not undergo apoptosis upon activation. In some embodiments, the immune cell insensitive to activation-induced cell death (AICD) is a T cell. In another embodiment, an immune cell insensitive to AICD is a non-activated T cell. In some embodiments, the selected apoptosis-resistant cell is a stem/progenitor cell. In some embodiments, the cell population used in the method is derived from: bone marrow, a stem/progenitor cell mobilized peripheral blood, or umbilical cord blood (UCB).
[0221] In one embodiment, a stem/progenitor cell is an umbilical cord blood stem/progenitor cell. In another embodiment, a stem/progenitor cell is a mobilized peripheral blood stem/progenitor cell. In another embodiment, a stem/progenitor cell is bone marrow stem/progenitor cell. In another embodiment, a stem/progenitor cell is a hematopietic stem/progenitor cell. In another embodiment, a stem/progenitor cell is a cancer stem/progenitor cell. In another embodiment, a stem/progenitor cell is a neural stem/progenitor cell. In another embodiment, a stem/progenitor cell is a cord blood stem/progenitor cell, a mobilized peripheral blood stem/progenitor cell, a bone marrow stem/progenitor cell, a hematopoietic stem cell, a cancer stem/progenitor cell, a neural stem/progenitor cell or a combination thereof.
[0222] Harvesting of stem-cells for therapeutic purposes requires extraction of a tissue which contains stem-cells, either autologous or from a donor, and then isolation of the stem-cells from other cell populations that may have deleterious effects if co-transplanted along with stem-cells.
[0223] In another embodiment, the phrase apoptosis resistant is receptor-mediated apoptosis resistant. In another embodiment, the cell-selection method of the present invention is a single-step negative selection method for cell types that are resistant to receptor-mediated apoptosis. In another embodiment, the present method enables parallel isolation of both stem cells and immune-cells that support the clinical outcome of transplantation, via a single use of the device, as is exemplified below.
[0224] According to another embodiment, the cell populations which may be used in the method of the present invention are stem/progenitor cells derived from, but are not limited to, bone marrow, umbilical cord blood (UCB) and progenitor cell mobilized peripheral blood (mPB). In some embodiments, the cell population can be derived from adult tissues (e.g., but not limited to: fat, heart, brain) which contain apoptosis-resistant cells. In another embodiment, the cell population derives from embryonic tissue.
[0225] In another embodiment, a heterogeneous cell population is derived from an organ or a tissue. In another embodiment, a heterogeneous cell population is derived from an embryo. In another embodiment, a heterogeneous cell population is derived from a tissue comprising embryonic cells, stem cells, immune cells, or any combination thereof. In another embodiment, a heterogeneous cell population is derived from bone marrow. In another embodiment, a heterogeneous cell population is derived by mechanical dislodgement from the bone marrow stroma by aspiration or by apheresis following mobilization into the peripheral blood (mPB) through activation and disruption of the molecular anchors. In another embodiment, a heterogeneous cell population is derived from peripheral-blood.
[0226] In another embodiment, the stem cell is selected from a heterogeneous population of cells. In another embodiment, the phrase heterogeneous population of cells as used herein refers to a mixture of cell types comprising a stem cell as defined above and at least one apoptosis-sensitive cell. In another embodiment, the heterogeneous population of cells is derived from any organism. In another embodiment, the heterogeneous population of cells is derived from a mammalian source. In another embodiment, the heterogeneous population of cells is derived from a human source.
[0227] In another embodiment, the heterogeneous population of cells comprises a mixture of a lineage positive cell and stem/progenitor cells. In another embodiment, a lineage positive cell as used herein refers to a cell expressing mature cell lineage marker. In some embodiments, a mature cell lineage marker is a Cluster of Differentiation (CD) protein.
[0228] In another embodiment, the method of the present invention is used to perform lineage depletion.
[0229] In another embodiment, the heterogeneous population of cells is a tissue or a part thereof. In another embodiment, the heterogeneous population of cells is a cell aggregate. In another embodiment, the heterogeneous population of cells is a single cell suspension. In another embodiment, the heterogeneous population of cells is a primary culture. In another embodiment, the heterogeneous population of cells is a cellular sample. In another embodiment, the heterogeneous population of cells comprises a population which is accessible to the pro-apoptotic agents of the present invention.
[0230] According to another embodiment, incubating within the device lasts from 2 hours to 72 hours. In another embodiment, incubating within the device lasts from 2 hours to 4 hours. In another embodiment, incubating within the device lasts from 4 hours to 10 hours. In another embodiment, incubating within the device lasts from 10 hours to 24 hours. In another embodiment, incubating within the device lasts from 12 hours to 36 hours. In another embodiment, incubating within the device lasts from 24 hours to 48 hours. In another embodiment, incubating within the device lasts from 36 hours to 72 hours. In another embodiment, incubating within the device lasts from 48 hours to 72 hours.
[0231] In some embodiments, the incubation time within the device is from 6 hours to 72 hours. In some embodiments, the incubation time within the device is from 12 hours to 72 hours. In some embodiments, the incubation time within the device is from 18 hours to 72 hours. In some embodiments, the incubation time within the device is from 24 hours to 72 hours. In some embodiments, the incubation time within the device is from 30 hours to 72 hours. In some embodiments, the incubation time within the device is from 36 hours to 72 hours. In some embodiments, the incubation time within the device is from 42 hours to 72 hours. In some embodiments, the incubation time within the device is from 48 hours to 72 hours. In some embodiments, the incubation time within the device is from 54 hours to 72 hours. In some embodiments, the incubation time within the device is from 60 hours to 72 hours. In some embodiments, the incubation time within the device is from 66 hours to 72 hours. In some embodiments, the incubation time within the device is from 2 hours to 66 hours. In some embodiments, the incubation time within the device is from 2 hours to 60 hours. In some embodiments, the incubation time within the device is from 2 hours to 54 hours. In some embodiments, the incubation time within the device is from 2 hours to 48 hours. In some embodiments, the incubation time within the device is from 2 hours to 42 hours. In some embodiments, the incubation time within the device is from 2 hours to 36 hours. In some embodiments, the incubation time within the device is from 2 hours to 30 hours. In some embodiments, the incubation time within the device is from 2 hours to 24 hours. In some embodiments, the incubation time within the device is from 2 hours to 18 hours. In some embodiments, the incubation time within the device is from 2 hours to 12 hours. In some embodiments, the incubation time within the device is from 2 hours to 6 hours.
[0232] Unexpectedly, the inventors found that different incubation times with different combinations of apoptosis-inducing ligands may result in functionally distinctive clinical outcomes. Therefore, incubation time is in accordance of specific use, as is exemplified herein below.
[0233] In some embodiments, the present invention provides a kit. The kit of the present invention can be used in the selection of stem and progenitor cells that are resistant to receptor-mediated apoptosis.
[0234] In some embodiments, the cell selection kit of the invention comprises a device and a solution for maintaining the integrity and/or activity of an apoptosis-inducing ligand within the device.
[0235] In another embodiment, the kit further comprises an insert with instructions for performing cell selection according to the methods of the invention. In some embodiments, the solution for maintaining the integrity and activity of an apoptosis-inducing ligand is a buffer or media. In another embodiment, the constituents of the solution vary depending on the apoptosis-inducing ligands used. In another embodiment, the solution comprises a protease inhibitor. In another embodiment, the protease inhibitor is selected from, but not limited to: Phenylmethylsulfonyl fluoride, Benzamidine. Pepstatin A, Leupeptin, Aprotinin, Antipain, EDTA. EGTA, or any combination thereof. In another embodiment the solution comprises a buffer system selected from, but not limited: to TRIS buffer, Phosphate-buffered saline, and Glycine-NaOH.
[0236] In another embodiment, the solution comprises elements which enable and/or promote cell survival, cell growth, cell proliferation, or any combination thereof. In another embodiment, elements which enable and/or promote cell survival, cell growth, cell proliferation, or any combination thereof include: growth media, serum or anti-bacterial agents. According to this embodiment, the solution enables to maintain viability of a cell within the device of the kit.
[0237] In another embodiment, the solution comprises factors which enable stem-cell and/or progenitor cell proliferation. In another embodiment, factors which enable stem-cell proliferation are selected from, but are not limited to, growth factors, hormones, enzymes or chemicals.
[0238] In another embodiment, the kit can include an additional apoptosis-inducing ligand, e.g., TNF ?, that is added to the device or to the solution, thus rendering the solution as selective towards the apoptosis resistant cells of the invention.
[0239] In another embodiment, the kit can be used in the present invention to provide flexibility in the identity or concentration of apoptosis-inducing ligands that are added to a population of cells. According to this embodiment, the kit comprises additional containers, each containing a different apoptosis inducing ligand. The kit's user selects a combination of apoptosis-inducing ligands according to a specified use, as is exemplified below, introduces the ligands into the device and allows incubation with the ligands.
[0240] In another embodiment, the kit can be used in the present invention to provide temporal flexibility in addition of the apoptosis-inducing ligands. As is exemplified herein below, different combinations, sequential administration or incubation times of apoptosis-inducing ligands results in a clinically distinct outcome. The kit's user can select the desired order of addition of the apoptosis-inducing ligands and the incubation period with each ligand within the device, thus achieving the clinical outcome of choice.
[0241] In some embodiments, the present invention can be used in a method for improving the clinical outcome of hematopoietic stem and progenitor cells (HSPC) transplantation. In some embodiments, a sample comprising a cell population is provided; the cell population comprises stem and progenitor cells. In some embodiments, the population is incubated in a device comprising the selective surface of the invention. Upon contact with the apoptosis-inducing ligand (e.g., FasL and/or TNF?) which is immobilized on the selective surface apoptosis sensitive cells undergo apoptosis and the remaining cells (i.e., the cells that have not undergone apoptosis) are retrieved and used for transplantation in a mammal (e.g., but not limited to, a human). In some embodiments, the contacting occurs within the device of the present invention, wherein the device can have at least one selective surface, or has a plurality of selective surfaces (e.g., but not limited to beads and/or multi-well plates), where the at least one selective surface or the plurality of selective surfaces is/are composed of or comprise a biocompatible polymer comprising maleic anhydride bound to an apoptosis-inducing ligand (e.g., FasL and/or TNF?). In some embodiments, the cell population is derived from: bone marrow, a stem/progenitor cell mobilized peripheral blood, or umbilical cord blood (UCB). In some embodiments, the stem/progenitor cell can be selected using the method, and is selected from a group comprising: umbilical cord blood stem/progenitor cell, mobilized peripheral blood stem/progenitor cell, bone marrow stem/progenitor cell, hematopoietic stem cell, cancer stem/progenitor cell, and neural stem/progenitor cell. In some embodiments, the population of cells is incubated with FasL for a period of 21 to 24 hours. In some embodiments, the population of cells is incubated with tumor necrosis factor ? (TNF-?) for a period of 24 to 48 hours. In some embodiments, the population of cells is sequentially incubated with (1) FasL and (2) TNF-?. In some embodiments, the population of cells is sequentially incubated with (1) TNF-? and (2) FasL. In some embodiments, the population of cells is incubated with FasL and TNF-? for an overlapping duration. In some embodiments, retrieved cells from the method are used for either autologous, allogeneic or haploidentical transplants. In some embodiments, the retrieved cells further comprise an immune-cell insensitive to activation-induced cell death (AICD). In some embodiments, the immune cell insensitive to AICD is a T cell.
[0242] In another embodiment, allogeneic cord blood is introduced into the device related to the kit of the present invention. According to this embodiment, FasL is immobilized on a selective surface or a plurality of selective surfaces of the device. The blood is incubated in the device for less than 24 hours. When the incubation has completed, TNF-? is introduced into the device and incubation is continued for 24-48 hours. Following the second incubation the cells are extracted from the device and are transplanted into the patient. In another embodiment, an isolation step is used between the end of incubation and transplantation, in order to isolate the living cells from cell debris and proteins in the solution.
[0243] In another embodiment, the cell population can be derived of an autologous transplant. In another embodiment, the cell population can be derived of an allogeneic transplant.
[0244] In some embodiments, the present invention can be used in a method for eliminating at least one malignant cell in a composition comprising a stem/progenitor-cell transplant. In some embodiments, a composition comprising a stem/progenitor-cell transplant is provided and then contacted/incubated with an apoptosis-inducing ligand. In some embodiments, the contacting/incubating occurs within the device and/or on a surface or plurality of surfaces of the present invention. In some embodiments, the composition is contacted with the apoptosis-inducing ligand FasL for a period of, e.g., but not limited to: about 24 hours. In some embodiments, the composition is contacted with the apoptosis-inducing ligand TNF-? for a period of, e.g., but not limited to: about 24 hours. In some embodiments, the stem/progenitor-cell transplant is used as an autologous transplant.
[0245] According to another embodiment, the present invention can relate to a method for reducing the numbers of malignant cells in a cell population. In this method, the cell population is contacted and incubated with at least one apoptosis-inducing ligand, e.g., FasL and/or TNF?. In another embodiment, the composition comprises a progenitor-cell transplant.
[0246] In another embodiment, the apoptosis-inducing ligand is FasL. In another embodiment, the incubation is for about 24 hours. The inventors have shown in-vivo that, unexpectedly, addition of FasL for about 24 hours to a transplant containing a malignant cell eliminates the malignant contaminant and improves survival rate (see, e.g.,
[0247] According to another embodiment, this elimination technique has the potential to reduce the amount of malignant cells in grafts from apparently healthy donors that suffer of subclinical malignant disease.
[0248] According to another embodiment, a transplant is extracted out of the bone marrow of a cancer-patient and introduced into the device of the present invention. According to this embodiment, the transplant is incubated with immobilized FasL and/or TNF? for about 24 hours. Upon completion of the incubation, the selected cells are transplanted back into the cancer patient. In another embodiment, an isolation step precedes transplantation, as so to isolate the selected cells from cell debris and proteins.
[0249] According to another embodiment, the present invention further discloses a method for selecting cells using a selective surface, which can then be used to treat a mammal, and where the selected cells reduce the likelihood of causing graft vs. host disease (GvHD) while retaining graft vs. tumor (GvT) activity. According to this method, a sample is provided. In one embodiment, the sample comprises a cell population. In another embodiment, the cell population comprises HSPC. In another embodiment, the cell population comprises an immune cell. In another embodiment, the cell population comprises HSPC, an immune cell or a combination thereof. According to one embodiment, the cell population is contacted with an apoptosis-inducing ligand, e.g., FasL and/or TNF?. In another embodiment, surviving cells are retrieved from the device having a selective surface composed of, e.g., but not limited, maleic anhydride bound to FasL and/or TNF?. In another embodiment, the retrieved cells are transplanted in a subject.
[0250] According to another embodiment, the method provides a selection of T cell subsets that do not induce GvHD using a selective surface. The inventors have found, unexpectedly, that short incubation with FasL, of 2-16 hours, without concurrent T cell sensitization, results in an effective removal of GvHD effectors (see, e.g.,
[0251] In another embodiment, the selective elimination of apoptosis-sensitive T cells from the donor inoculum does not impair generation of a potent graft vs. tumor (GvT) reaction.
[0252] According to another embodiment, the method of the present invention can be used on an allogeneic mobilized peripheral blood transplant using a selective surface. In this embodiment, the allogeneic mobilized peripheral blood transplant is introduced into the device of the present invention. The transplant is next incubated with immobilized FasL and/or TNF? bound to a selective surface composed of, e.g., but not limited to, maleic anhydride for a short period of 2-16 hours. Following incubation, the remaining cells are retrieved and transplanted into the patient. In some embodiments, an isolation step may precede the transplantation, as so to isolate the selected cells from cell debris and proteins.
[0253] In some embodiments, the method of the present invention may use a selective surface for selective depletion of un-stimulated T cells prior to donor lymphocyte infusion (DLI).
[0254] Additional objects, advantages, and novel features of the present invention will become apparent to one ordinarily skilled in the art upon examination of the following examples, which are not intended to be limiting. Additionally, each of the various embodiments and aspects of the present invention as delineated hereinabove and as claimed in the claims section below finds experimental support in the following examples.
EXAMPLES
Example 1
Coating a Surface with an Apoptosis Inducing Ligand
[0255] The following example illustrates the use of coating a surface to select for a population of stem and progenitor cells. While this example included the use of a plate, the results discussed herein can be extrapolated and used on other surfaces, such as beads or surfaces of containers.
[0256] Materials and Methods:
[0257] Immobilizing FasL on Maleic Anhydride (MA) Coated Surfaces
[0258] MA-bound tissue culture well plates (e.g., Pierce? Amine-binding. Maleic Anhydride Plates Nos. 15100, 15102, 15110, 15112, or 15108); Immobilization buffer (phosphate-buffered saline (PBS) pH 7.2; or 0.1M sodium phosphate, 0.15M sodium chloride, pH 7.2 (Thermo scientific (Pierce) Cat. No. 28372), or an amine-free buffer, e.g., carbonate/bicarbonate buffer 0.2M, pH 9.4); Recombinant human Super FasLigand? (Enzo Life Sciences); MegaFasL? or APO010 (Adipogen); Protein blocking buffer (e.g., Thermo Scientific SuperBlock Blocking Buffer, Product No. 37515 or 37535); and wash buffer (PBS containing 0.05% Tween?-20 Detergent).
[0259] The polystyrene tissue culture well plates were washed three times with wash buffer (e.g. with 200 ?L). FasL was dissolved in the Immobilization buffer and various amounts (e.g. 0.5 ng, 10 ng, 50 ng or 200 ng) of FasL were added to each well (e.g., FasL concentration was 1 ?g/ml and 200 ?l of the FasL solution was used). The plates were incubated (while shaking) for 1 hour at room temperature or 37 degrees C., or overnight at 4 degrees C. or at room temperature or 37 degrees C. The FasL solution was removed, and then Protein Blocking Buffer was added and incubated (e.g. 200 ?L of Protein Blocking Buffer was added per well and incubated for 1 hour at room temperature). Wells were washed (e.g. 3 times with Wash Buffer, and then washed with PBS) and the assay method was performed.
[0260] Seeding of Jurkat Cells
[0261] Jurkat cells (a human T lymphocyte cell line) were centrifuged at 1300 rpm (300 g) for 8 at 4? C. and the supernatant was discarded. The cell pellet was re-suspended in 10 ml RPMI complete medium. 20 ?l of re-suspended cells were sampled and mixed with 190 ?l of pre-diluted Trypan Blue. The mixture was loaded (10 ?l) into a hemocytometer (total loading volume=20 ?l). The number of viable cells and of dead cells was counted in at least 4 fields. The concentration of viable cells (viable cells/ml) were calculated using the following equation:
[0262] The cells were seeded at a concentration of 2.5?10.sup.6 cells/ml (0.5?10.sup.6 cells/well) in 96 well plate (0.2 ml per well), in RPMI complete medium, with or without immobilized FasL. As control, cells were incubated in regular well plates (without MA and without immobilized FasL) in the presence of 50 ng/ml FLAG-tagged soluble super FasL. The cells were incubated for 6 hours at 37? C. in 5% CO.sub.2 in a humidified incubator, and then collected. 2 ml PBS were added to wash the cells, followed by centrifugation at 4? C. at 1300 rpm (300 g) for 8 minutes. Annexin V staining was performed to identify dead cells (Annexin V is an apoptotic marker and PI is a marker for dead cells). The number of cells was determined using FACS analysis.
[0263] FACS Analysis
[0264] At the end of the incubation time the cells (200 ?l) were removed from the wells and placed in FACS tubes filled with 1 ml PBS (between 0.5-1?10.sup.6 cells in each tube). The cells were centrifuged for 3 min at 1300 RPM, 4? C. The supernatant was discarded and 155 ?l of AnnexinV solution (eBioscience) was added to each tube. The tubes were incubated in room temperature, in the dark for 10 min. At the end of incubation 1 ml PBS was added to each sample and the tubes were centrifuged. 200 ?l of PI/7AAD staining solution (eBioscience) were added into each well. Negative control samples were prepared without staining (i.e. an unstained sample, Annexin V only sample, and PI/7AAD only sample). The samples were read using a Flow Cytometer (using FACS Calibur, according to the BD CellQuest? Pro Software Acquisition Tutorial).
[0265] Table 1 illustrates the conditions of the experiments.
TABLE-US-00002 TABLE 1 Name of treatment (amount Number of of superFasL per well) repetitions 1 100 ng superFasL 3 2 50 ng superFasL 3 3 10 ng superFasL 3 4 5 ng superFasL 3 5 10 ng soluble superFasL (50 ng/ml) 3 6 No superFasL 3
Results
[0266] FasL was immobilized onto MA-coated cell culture well plates as described above. The amount of immobilized FasL was measured by ELISA using a specialized kit (Human Fas Ligand/TNFSF6 DuoSet ELISA CAT # DY126). The measurements were performed according to manufacturer's instructions. As shown in
Example 2
Comparison of MA, Epoxy and NUNC Amino-Immobilizer Coated Plates
[0267] Jurkat cells were seeded on maleic anhydride (MA) coated plates (Thermo scientific (Pierce). Cat. No. 15100) which were previously incubated with 1000 ng/ml MegaFasL (Adipogen) overnight at 4? C. The cells were incubated for 4 hours or for 6 hours. As control, cells were seeded onto MA coated plates without FasL. As can be seen in
[0268] Next, Jurkat cells were seeded on Nunc amino-immobilizer coated plates (Thermo Scientific Nunc. Cat. No. 436006) which were previously incubated with 1000 ng/ml MegaFasL (Adipogen) or SuperFasL (Enzo Life Sciences). The cells were incubated for 4 hours or for 6 hours. As control, cells were seeded onto the same plates without immobilized FasL. As can be seen in
[0269] Next Jurkat cells were seeded on 3D-Epoxy coated 96 well plates (PolyAn. Cat. No. 00 690 251) which were previously incubated with 1000 ng/ml MegaFasL. The cells were incubated for 4 hours or for 6 hours. As control, cells were seeded onto the same plates without immobilized FasL. As can be seen in
Example 3
Apoptosis of Jurkat Cells Seeded onto Maleic AnhydrideBiocompatible Polymers
Attaching FasL to Maleic Anhydride-Coated Fluoropolymer or Polyethylene Films
[0270] Copolymers comprising Gamma-irradiation stable polymers ETFE (poly (ethene-co-tetrafluoroethene)) or HDPE (high density polyethylene) and maleic anhydride were prepared according to methods known in the art (see for example Nipithakul T. et al Chinese J. of Polymer Science Vol. 30, No. 2 (2012) or Chausse et al Clin. Chem 36/3, 525-528 (1990), the contents of which are incorporated herein by reference). The copolymer films were then cut into 24-well size discs and put into cell culture plates. The discs were kept in the dark until use. The discs were then washed twice with Wash buffer and coated with FasL overnight at 4 degrees C. as described in Example 1 above.
Apoptosis of Jurkat Cells Incubated on FasL-Coated Maleic Anhydride-Fluoropolymer Films
[0271] Next, Jurkat cells were seeded on a fluoropolymer (ETFE)-maleic anhydride (MA) substrate or a polyethylene-maleic anhydride (MA) substrate which was previously incubated with 1000 ng/ml MegaFasL (FL-MA-FasL and PE-MA-FasL, respectively). The cells were incubated for 6 hours. As control, cells were seeded onto the fluoropolymer-maleic anhydride (MA) substrate or a polyethylene-maleic anhydride (MA) substrate without FasL. Additional control included seeding without polymer. A positive control included seeding without polymer in the presence of soluble FasL. As can be seen in
[0272] FasL (Fc-FasL, monomer FasL and MegaFasL) was attached onto maleic anhydride (MA)-coated fluoropolymer as described above using 1000 ng/mL or 1500 ng/ml solutions. Following coating with the ligands, human Jurkat cells were incubated with the bound ligands for 4 hours and stained with Annexin V to test early apoptosis (FIG. 2E). Despite differences in levels of efficiency all types of FasL molecules were effective in inducing apoptosis. Interestingly, as shown in
Determination of the Efficacy of Beads
[0273] In an experiment, polystyrene magnetic beads are used and functionalized with MA for binding FasL. In this experiment, the functionalized MA-bound beads induce apoptosis in human Jurkat cells, but not limited to, and can be used for the selection of stem and progenitor cells.
Example 4
Ex Vivo Exposure of Umbilical Cord Blood Cells to Death Ligands
Apoptotic Activity of Death Receptor Activation In Vitro
[0274] The primary activity of the TNF superfamily is transduction of apoptotic signals. Fresh umbilical cord blood (UCB) obtained from term deliveries upon informed consent were exposed to FasL and TNF-? for various periods of time in liquid culture without supplementation of growth factors. Gated CD34.sup.+ progenitors within the bulk UCB cultures displayed reduced rates of apoptosis, with increasing susceptibility as a function of time (see, e.g.,
[0275] To define which subsets of UCB cells were susceptible to apoptosis, the myeloid and lymphoid lineages were further assessed. Whereas CD3.sup.+ T cells express high levels of Fas, the TNF receptors were dominant in CD33.sup.+ myeloid cells (see, e.g.,
SCID Repopulating Cells and Long-Term Culture Initiating Cells were Resistant to Receptor-Mediated Apoptosis
[0276] Several surrogate assays were employed to evaluate the function of progressively committed progenitors, including SCID repopulating cells (SRC), long-term initiating cells (LTC-IC) and short-term clonogenic assays. SRC activity was partially compatible with the human reconstituting cell and served as a surrogate functional assay for the most primitive progenitors within the sample. Equal initial numbers of cells incubated with and without FasL and TNF-? prior to transplantation were used, because the wide variability in levels of xenochimerism precludes precise evaluation of enhanced engraftment (see, e.g.,
[0277] Deficient human cell engraftment after extended periods of ex vivo culture was associated with proliferation and egress from the G0/G1 cell cycle phase. Both the proliferation rates (see. e.g.,
[0278] Surrogate ex vivo assays for hematopoietic progenitor activity include long-term cultures over mesenchymal stromal cells (LTC-IC), which represent a more primitive subset than colonies formed by committed progenitors in semisolid methylcellulose cultures. Exposure to FasL and TNF-? at concentrations that were toxic to somatic cells during the entire 5 weeks period of the long-term cultures did not impact LTC-IC activity (
Enrichment of Myeloid Progenitors by Elimination of Dead Cells
[0279] Inherent susceptibility to spontaneous and receptor-induced apoptosis of various subsets of UCB cells results in marked variations in the composition of viable cells after ex vivo incubation. For example, following 48 hours of incubation with toxic doses of FasL there was marked enrichment in viable lineage-negative cells, whereas incubation with TNF-? results in relative enrichment in viable myeloid cells (see, e.g.,
Cross-Talk Between TNF Family Receptors Did not Sensitize to Apoptosis
[0280] To determine whether TNF-induced Fas expression sensitized UCB cells to apoptosis, cells were first exposed to TNF-? and then exposed to FasL (see. e.g.,
Depletion of Differentiating Cells During Ex Vivo Expansion of UCB Cells
[0281] Umbilical cord blood was a sufficient source of hematopoietic progenitors for reconstitution of the immuno-hematopoietic system after aggressive radiochemotherapy, however had two major disadvantages: small number of cells and slow engraftment. To overcome these limitations, a number of approaches to ex vivo expansion of UCB cells prior to transplantation have been developed.
[0282] The cells were numerically expanded and progenitors became activated, which improved the quality of hematopoietic reconstitution. It was reasoned that exposure of the cell cultures to TNF-family ligands awarded a relative advantage to more primitive progenitors by limitation of the clonal expansion of differentiated cells, which did not impact significantly the efficiency of engraftment. Using a standard expansion protocol that increased the fraction (see, e.g.,
Example 5
Ex Vivo Exposure of Mobilized Peripheral Blood Cells to Death Ligands
Apoptotic Activity of Death Receptor Activation In Vitro
[0283] A prevalent source of hematopoietic progenitors for transplantation was peripheral blood following mobilization with granulocyte colony stimulating factor (G-CSF) or antagonists of c-kit and CXCR4. The mobilized mononuclear cells were subsequently collected from peripheral blood by apheresis, containing a substantial number of CD34.sup.+ progenitors. Cells harvested from the peripheral blood were generally activated, therefore the periods of exposure to death ligands for selective depletion were significantly shorter.
[0284] An additional difference from data presented for UCB cells was the use of cryopreserved mPB samples, the thawing of which was associated with apoptotic death of 15-25% of the cells. Fas was expressed in ?25% of CD34.sup.+ progenitors (see, e.g.,
[0285] Whereas 25-45% of lineage-positive cells were apoptotic within 4 hours of ex vivo incubation, 60-90% of these cells were induced into apoptosis within 16 hours of incubation (see, e.g.,
Depletion of mPB-Derived T Cells Sensitive to Fas Cross-Linking Ameliorated Graft Versus Host Disease
[0286] The most significant cause of morbidity in mPB cell transplants was GvHD, a consequence of the intrinsic state of activation of T cells in peripheral blood. To assess the impact of FasL on xenogeneic GvHD, NOD.SCID mice were grafted with 1.5?10.sup.7 viable mPB from the same unit with and without exposure to the ligand. Preincubation with FasL for 4 hours resulted in survival of all mice, whereas incubation in medium caused death of one third of the recipients (see. e.g.,
Exposure to Death Ligands Increased Myeloid Progenitor Frequency
[0287] The composition of viable subsets within mPB cultures following brief incubation reflected differential sensitivities of mPB-derived immune cells to apoptosis mediated by the Fas and TNF receptors. The relative distribution of cells was consistent with the high sensitivity of CD3.sup.+ T cells to apoptosis during 4 hours of incubation and subsequent death of CD19.sup.+ B lymphocytes and CD33.sup.+ myeloid cells during longer incubation periods (see, e.g., FIG. 10A). These variations suggested that mPB samples the frequency of progenitors was increased by brief incubation with the death ligands and elimination of the dead cells (see, e.g.,
Pretransplant Exposure to FasL Did not Impair Immune and Graft Versus Tumor Reactivity
[0288] The crucial question in experiments using selective T cell depletion to prevent and reduce GvHD severity is whether the graft retains the capacity to elicit potent graft versus tumor reactions. Despite these changes in composition, mPB incubated in medium and with FasL preserve reactivity against irradiated allogeneic human mPB stimulators (see. e.g.,
Example 6
Pretransplant Depletion of T Cells Prevents Lethal GvHD
Prevention of Lethal GvHD by Ex Vivo Selective Depletion of Host-Sensitized T Cells
[0289] Both physical depletion of T cells from donor inoculum and FasL-mediated elimination of host-reactive T cells reliably prevented GVHD. Haploidentical murine transplants (parent to child) represented the extreme risk of GvHD, characterized by high levels of mortality. In first stage experiments were recapitulated using depletion of T cells by apoptotic signals following sensitization to host antigens. Antigen-specific sensitization in vitro for 2-3 days caused T cell receptor (TCR)-mediated stimulation of responsive T cells that concomitantly upregulated Fas and its cognate ligand, resulting in execution of the apoptotic cascade in parallel to downregulation of protective antiapoptotic mechanisms. To compare this procedure to tested approach using brief exposure to apoptotic ligands ex vivo without prolonged incubation, the donors were pre-immunized against host antigens in vivo (see, e.g.,
[0290] To evaluate the effects of FasL exposure on the ability of sensitized lymphocytes to cause GvHD, viable cells from the H2K.sup.d-immunized H2K.sup.b parental donors were adoptively transferred into sublethally irradiated haploidentical F1 recipients (H2K.sup.b.fwdarw.H2K.sup.b/d). Infusion of presensitized splenocytes incubated in control medium caused severe GvHD, which became uniformly lethal following lipopolysacharide (LPS) challenge leading to death of all mice (see, e.g.,
Prevention of Lethal GvHD by Ex Vivo Selective Depletion of Unstimulated T Cells
[0291] We reasoned that pretransplant exposure of donor lymphocytes to host antigens might augment T cell stimulation, and that these alloresponses might persist due to the limited sensitivity of some effector/memory lymphocyte subsets generated in culture to Fas-mediated apoptosis or due to the inability of Fas cross-linking to eliminate completely all the alloreactive T cells. In addition, clinical adaptation of this presensitization approach to human donor:host pairs might be quite challenging. In search for a simpler and more reliable model of FasL selection of alloreactive T cells, the incubation technique was modified to use na?ve donor cells that had not been previously exposed to recipient alloantigens (see, e.g.,
[0292] To assess the effect of ex vivo elimination of unstimulated lymphocytes, viable splenocytes were infused into sublethally irradiated haploidentical F1 recipients (H2K.sup.b-GFP.fwdarw.H2K.sup.b/d). Unsensitized lymphocytes incubated in medium were less potent mediators of lethal GvHD, therefore LPS was used to induce cytokine storm and polarize the activity of donor lymphocytes. Survival of 70% of recipients of FasL-pretreated unstimulated splenocytes following the LPS challenge was superior to survival of recipients of ex vivo depleted host-stimulated splenocytes, whereas lethal GvHD was precipitated in all recipients of splenocytes incubated in control medium (see, e.g.,
Quantitative and Qualitative Aspects of GvHD Prevention
[0293] Adoptive transfer of viable splenocytes after incubation in control medium caused significant GvHD in sublethally irradiated haploidentical F1 recipients, which was blunted by donor cell preincubation with FasL (see, e.g.,
[0294] The dose-dependent decrease in body weight was evidence of progressive GVHD severity in recipients of haploidentical splenocytes incubated in medium (see, e.g.,
[0295] To evaluate the differences in immune profiles of survivors in the different experimental groups, the composition of the spleens was assessed before and 2 days after the LPS challenge (see, e.g.,
Simulation of GvHD in NOD.SCID Mice to Determine the Time of Exposure to Death Ligands Ex Vivo
[0296] Prevention of GvHD by selective depletion of unstimulated donor T cells questions the involvement of two possible mechanisms. First, partial immuno and myelodepletion induced by sublethal irradiation suggests that residual host immune elements might operate successfully against FasL-deleted donor T cells, resulting in suppression of GvHD. Second, conditioning with total body irradiation induces tissue injury that plays an important role in the afferent arm of GvHD. To assess both these mechanisms, the disease was induced in lymphocyte-deficient NOD.SCID mice without pretransplant conditioning. Exposure of unstimulated splenocytes to FasL for 24 and 48 hours elicited significant apoptosis (see, e.g.,
[0297] Following a series of calibration experiments, NOD.SCID mice were infused with 3?10.sup.6 or 10.sup.7 na?ve allogeneic splenocytes (H2K.sup.b.fwdarw.H2K.sup.g7) after 24 or 48 hours of ex vivo incubation in FasL-containing medium, respectively (see, e.g.,
Example 7
The Impact of Ex Vivo Selective Depletion of Unstimulated Lymphocytes on Hematopoietic Cell Engraftment
Depletion of Fas-Sensitive Na?ve Splenocytes Alleviates GVHD in Bone Marrow Transplants
[0298] To extend the findings of the GvH-like model to the transplant setting, the effect of Fas-mediated depletion of host-na?ve cells was assessed in mice undergoing haploidentical BMT together with donor lymphocyte infusion (see. e.g.,
Immuno-Hematopoietic Reconstitution Following Haploidentical BMT and Selective Depletion of Apoptosis-Sensitive Cells
[0299] GvHD depresses graft function and profoundly abrogates recipient immune responses. To determine how depletion of Fas-sensitive donor splenocytes affects immuno-hematopoietic reconstitution following transplantation, hosts were assessed for survival of the grafted donor lymphocytes, chimerism and immune responsiveness to unrelated antigens. Recipients of the highest dose (4.5?10.sup.6) of unmanipulated donor splenocytes preincubated in control medium displayed decreased levels of chimerism at 3 weeks and 6 weeks post-transplantation (see, e.g.,
[0300] Because the mature lymphocytes that were infused at the time of transplantation compete with lymphocytes generated by the bone marrow graft for peripheral homeostatic expansion and effect the net lymphocyte numbers, the impact of FasL treated lymphocyte infusions on lymphoid reconstitution was examined. Minor CD45 antigen disparity (CD45.1 vs. CD45.2) were used to differentiate between infused splenocytes and BMC graft-derived T cells in the recipients during the weeks following transplant. Despite the fact that F1 recipients do not reject parental immune cells, few of the infused splenocytes (H2K.sup.b, CD45.2.sup.+GFP.sup.+) were detected in peripheral lymphoid organs of the recipients at 3 weeks post-transplantation, whether or not they had been incubated with FasL or in control medium (see, e.g.,
[0301] We questioned whether prevention of GvHD by preincubation of unstimulated lymphocytes with FasL is caused by impaired navigation capacity of the cells. This possibility was assessed by infusion of viable splenocytes into sublethally irradiated F1 recipients (H2K.sup.b-GFP.fwdarw.H2K.sup.b/d) and demonstration that lymphocytes homed to recipient spleen and mesenteric lymph nodes 24 hours after infusion, whether the cells had been preexposed to FasL or to control medium (see. e.g.,
Exposure of Hematopoietic Cells to Death Ligands Improves Engraftment
[0302] Depletion of all T cells from the hematopoietic grafts removes engraftment-facilitating cells, requiring a compensatory infusion of large doses of stem cells. Preincubation of the graft with FasL for 24 hours (see, e.g.,
[0303] T cells support hematopoietic progenitor engraftment through two mechanisms: a) donor T cells may counteract graft rejection by residual donor immunity, and b) T cells co-reside with progenitors at sites of seeding in the bone marrow and support engraftment through unidentified non-immunogenic mechanisms. To determine whether depletion of apoptosis-sensitive T cells to prevent rejection also eliminates engraftment-facilitating cells, irradiated H2K.sup.b mice were grafted with 10.sup.6 viable unmanipulated H2K.sup.d linprogenitors. In this model splenocytes from F1 donors (H2K.sup.b/d), which are devoid of GvHD activity were used. Infusion of 10.sup.6 viable F1 splenocytes after incubation in control medium or with FasL increased the levels of donor chimerism (see, e.g.,
Preexposure of Donor Lymphocytes to Death Ligands Preserves the Engraftment-Supporting Activity of Delayed Donor Lymphocyte Infusion
[0304] Post-transplant infusion of donor lymphocytes (DLI) is an effective approach to improve donor chimerism, enhance responsiveness to infections and foster graft versus tumor reactions. Although delayed DLI is better tolerated and causes less GvHD than infusion of lymphocytes in conditioned recipients at the time of hematopoietic transplantation, the lymphocytes have the capacity to increase the severity of GvHD. Delayed donor lymphocyte infusion in a model of mixed chimerism (see, e.g.,
FasL Alleviates GVHD without Impairing GvT
[0305] The overall success of stem cell transplantation performed for the treatment of malignant disease may depend on graft versus tumor (GvT) effects. Bulk depletion of T cells (either ex vivo or by administration of potent in vivo immune suppression) can blunt the GvT effect and increase post-transplant relapse rates in a variety of clinical situations. It was examined whether FasL incubations abrogated GvT effects in parallel to its salutary effect on GvHD in two experimental models. In a first model the preservation of GvT reactivity of host-matched lymphocytes after FasL-mediated depletion against an
allogeneic tumor was assessed. CT26 colon carcinoma cells (H2K.sup.d) were implanted in
NOD.SCID mice (H2K.sup.g7) adoptively transferred with 1.5?10.sup.7 splenocytes from NOD (immunocompetent) donors (H2K.sup.g7, see, e.g.,
FasL-Mediated Purging of Malignant Cells
[0306] Despite the significant advantages and safety of autologous transplants after aggressive radiochemotherapy, contamination of the graft with residual malignant cells is a risk factor of disease relapse. To evaluate this possibility, mice were infused with a mixture of bone marrow cells and A20 B cell lymphoma, at a dose that is lethal in
Syngeneic BALB/c mice (see, e.g.,
Depletion of Fas-Sensitive Cells Prevents Adoptive Transfer of Autoimmunity in Autologous Transplants
[0307] Type 1 diabetes is an autoimmune reaction that destroys the insulin-producing ?-cells in the pancreatic islets of Langerhans. This disorder is generally modeled in non-obese diabetic mice (NOD), with a disease incidence above 80% in females aged 30 weeks. Autoimmune diabetes is adoptively transferred by T cells, but not so efficient by transplantation of whole bone marrow cells. Preliminary experiments determined that 5?10.sup.7 bone marrow cells transfer the disease into ?50% of sublethally-irradiated NOD.SCID mice (see, e.g.,
[0308] While a number of embodiments of the present invention have been described, it is understood that these embodiments are illustrative only, and not restrictive, and that many modifications may become apparent to those of ordinary skill in the art. Further still, the various steps may be carried out in any desired order (and any desired steps may be added and/or any desired steps may be eliminated).
[0309] The methods are disclosed herein.