Rice resistant to HPPD and ACCase inhibiting herbicides

Abstract

Rice is described that is tolerant/resistant to a plurality of herbicides, for example, ACCase and HPPD inhibitors. Use of the rice for weed control and methods of producing tolerant/resistant rice are also described.

Claims

1. A seed of a rice plant tolerant/resistant to ACCase inhibitors wherein representative seed of said rice plant has been deposited under ATCC accession number PTA-13619.

2. A rice plant tolerant/resistant to ACCase inhibitors grown from the seed of claim 1.

3. The rice plant of claim 2 wherein the tolerance/resistance is correlated with the presence of at least one nucleic acid sequence selected from the group consisting of SEQ ID NOs: 208-226 in the plant genome.

4. The rice plant of claim 3, wherein the nucleic acid sequence is further selected from the group consisting of SEQ ID NO: 202 combined with at least one of SEQ ID NOS: 208-226.

Description

BRIEF DESCRIPTION OF DRAWINGS

(1) FIG. 1 is a graphical representation of a trait tolerance trial; the trial was planted, mesotrione was applied at the indicated rates about 1 month later (3-4 leaf stage), and a second application was applied on the two indicated treatments about 1 week later; the rice was evaluated for the percent of injury or damage as compared to unsprayed rice twenty-one days after the first herbicide application; line ML0831266-03093 is the HPPD resistant line and R0146 and P1003 are control lines with no induced mutation; the line PL1214418M2-73009 was selected out of a cross between the HPPD tolerant line ML0831266-03093 (parent is P1003) and the ACCase resistant line ML0831265-01493 (parent is R0146). The newly developed line PL1214418M2-73009 shows equivalent tolerance as the original HPPD tolerant line ML0831266-03093.

(2) FIG. 2 is a graphical representation of a trait tolerance trial; the trial rice were planted, quizalofop was applied at the indicated rates about 5 weeks later (initiating tillering); the rice was evaluated for the percent of injury or damage as compared to unsprayed rice four weeks after herbicide application; line ML0831265-01493 is the ACCase resistant line and R0146 and P1003 are control lines; the line PL1214418M2-73009 was selected out of a cross between the HPPD tolerant line ML0831266-03093 (parent is P1003) and the ACCase tolerant line ML0831265-01493 (parent is R0146). The newly developed line PL1214418M2-73009 which has combined resistance shows equivalent or better as the original ACCase resistant line ML0831265-01493.

(3) FIG. 3A-3B is a photograph of line ML0831266-03093 that in addition to resistance to HPPD herbicides also has enhanced resistance to ACCase herbicides. Enhanced resistance is demonstrated by plants from the HPPD resistant line ML0831266-03093 (FIG. 3A) surviving an application of quizalofop (77 gm ai/ha) whereas the wild-type parent line P1003 (FIG. 3B) does not survive. Picture taken four weeks after herbicide application.

(4) FIG. 4 is a graphical representation of results of a trait tolerance trial wherein mesotrione was applied at the indicated rates about 34 days after planting. (initiating tillering) the rice was evaluated for the percent of injury or damage as compared to unsprayed rice four weeks after herbicide application; the HPPD tolerant line ML0831266-03093 and the line with combined HPPD and ACCase tolerance PL1214418M2-73009 show a similar response indicating the full HPPD tolerance was recovered in the new line; the line PL1214418M2-73001 was selected to only carry the HPPD tolerant mutation from the HPPD line ML0831266-03093 and the line PL1214418M2-73013 was selected to only carry the HPPD non-induced tolerance from the HPPD line ML0831266-03093; P1003 is the non-mutant parent line for the HPPD tolerant line ML0831266-03093; note that over 420 gmai/ha, even the lines with genetic resistance may be injured.

(5) FIG. 5 illustrates grass weed control by the ACCase inhibitor quizalofop; control is shown by the prevalent grass weed (dead plants) being killed by quizalofop (77 gm ai/ha) while the resistant line ML0831265-01493 (live plants) were not injured.

(6) FIG. 6A-6B is a photograph of results of trait tolerance trials; weed control by mesotrione herbicide applied pre-planting was evaluated; the plots were planted with a hybrid of the HPPD tolerant line ML0831266-03093; just before planting, the plot on the right FIG. 6B received an application of mesotrione at 210 gmai/ha; the plot on the left FIG. 6A had no herbicide applied either pre-plant or post-emergence; pictures were taken four weeks after planting showing differences in weed appearance.

(7) FIG. 7A-7B is a photograph of rice growth versus stunted growth in a trait tolerance trial; both plots have rice line P1003 (carries some non-induced tolerance to HPPD herbicides); the herbicide treatments were applied at the initiation of tillering; the pictures were taken four weeks after herbicide application; only the ACCase herbicide fluazifop was applied to the plot on the left FIG. 7A (210 gmai/ha); at this rate fluazifop was not as active, no killing of the rice plants was observed; the right plot FIG. 7B was sprayed with a tank mixture of the ACCase herbicide fluazifop (210 gmai/ha) and the HPPD herbicide mesotrione (210 gmai/ha); combining herbicides improves activity.

(8) FIG. 8 is a graphical representation of results of a trait tolerance trial quizalofop was applied at the indicated rates about 30 days after planting (3-4 leaf stage), and a second application was applied on the two indicated treatments. The rice was evaluated for the percent of injury or damage as compared to unsprayed rice twenty-one days after the first herbicide application; line ML0831265-01493 is the ACCase tolerant line with the G2096S mutation; line ML0831265-02283 is also tolerant to ACCase herbicides however the tolerance is not from a mutation in the ACCase coding gene, R0146 is the parent line for both of the ACCase tolerant lines; P1003 is a control line.

(9) FIG. 9 shows results of a trait mapping experiment; an F2 population was derived from a cross between a cytoplasmic male sterile line A0109 and the ACCase tolerant line ML0831265-02283; the F2 individuals in the population were genotyped, sprayed with quizalofop (116 gmai/ha) twenty-six days after planting, and evaluated for tolerance to quizalofop nineteen days after herbicide application; using QTL mapping software, a major QTL for tolerance was identified on chromosome one (indicated by the arrow).

(10) FIG. 10 is a scattergram showing results of a mutation mapping experiment; an F2 population was derived from a cross between the ACCase tolerant line ML0831265-02283 and the parent line R0146; the F2 population was genotyped, sprayed with quizalofop (116 gmai/ha), and evaluated for resistance to quizalofop; only mutations including ACCase resistant mutations will be segregating in the population; the SNP index is a measure of the proportion of sequencing reads that carry a variation from the non-mutant line R0146; a score of one indicates that all sequencing reads had the variation; 19 variations (mutations) had an index of one and grouped together on chromosome one (circled) indicating the probable location of the tolerance causing mutations. (SEQ ID NOs: 208-226)

(11) FIG. 11 shows graphical results of HPPD trait tolerance trials; mesotrione was applied at the 3-4 leaf stage of rice (ML0831266-03093; P1003 and R0146) and evaluated twenty-one days after application for response to the herbicide; the rice was evaluated for the percent of injury or damage [see DEFINITIONS] as compared to unsprayed rice; the last two treatments included a sequential application two weeks after the first application.

(12) FIG. 12 shows graphical results of HPPD trait tolerance trial; a pre-plant application of mesotrione was applied (ML0831266-03093; P1003 and R0146) at 210 gmai/ha followed by post-emergent mesotrione applications at the 3-4 leaf stage at the indicated rates; the rice was evaluated for the percent of injury or damage as compared to unsprayed rice twenty-one days after the post-emergent application.

(13) FIG. 13 graphically represents results of trait mapping experiments; an F2 population was derived from a cross between the HPPD tolerant line ML0831266-03093 and the ACCase tolerant line ML0831265-01493; the population was genotyped, sprayed with mesotrione at 105 gmai/ha, and evaluated for tolerance to mesotrione; plants inheriting either the non-induced tolerance or the mutation tolerance from parent line ML0831266-03093 were expected to live; using QTL mapping software, a major QTL for tolerance was identified on chromosome two (indicated by the bold arrow). (X axis=chromosome number in the genome; Y axis=score, correlation with phenotype (resistance)).

(14) FIG. 14 graphically represents results of trait mapping experiments; an F2 population was derived from a cross between the HPPD tolerant line ML0831266-03093 and the ACCase tolerant line ML0831265-01493; the population was genotyped, sprayed with mesotrione at 105 gmai/ha, evaluated for tolerance to mesotrione, and sprayed again with mesotrione at 630 gmai/ha, and evaluated for tolerance to mesotrione; only plants inheriting the mutation for tolerance from parent line ML0831266-03093 were expected to live; using QTL mapping software a major QTL for tolerance was identified on chromosome one (indicated by the arrow) (X axischromosome number in the genome; Y-axis=score, correlation with phenotype).

(15) FIG. 15 shows results of mutation mapping experiments; an F2 population was derived from a cross between the HPPD tolerant line ML0831266-03093 and the parent line P1003; the population was genotyped, sprayed with mesotrione at 840 gmai/ha and evaluated for tolerance to mesotrione; only mutations including the HPPD tolerant mutation segregate in the population; the SNP index is a measure of the proportion of sequencing reads that carry a variation from the line P1003; a score of one indicates that all sequencing reads had the variation; ten variations (mutations) had an index of one and grouped together on chromosome one (circled) indicating the probable location of the tolerance causing mutation. (SEQ ID NOS: 227-236)

(16) FIG. 16A and FIG. 16B are a tabular representation of sergeants identified in a F4 population; the F4 population was derived from F2 selections carrying both HPPD and ACCase tolerance from a cross between the HPPD tolerant line ML0831266-03093 and the ACCase tolerant line ML0831265-01493; each row represents a different line and each column is a molecular marker within the QTL for the HPPD tolerant mutation on chromosome 1. FIG. 16B is a continuation of FIG. 16A black lines (boundaries) represent results of the genotype of the HPPD tolerant line ML0831266-03093 (20) and the genotype of the ACCase tolerant line ML0831265-01493 (10); observing the tolerance level of these lines to the HPPD herbicide mesotrione allows the tolerance mutation to be mapped to a specific gene.

(17) FIG. 17 is a tabular representation of sergeants identified in a F4 population; the F4 population was derived from F2 selections carrying both HPPD and ACCase tolerance from a cross between the HPPD tolerant line ML0831266-03093 and the ACCase tolerant line ML0831265-01493; each row represents a different line and each column is a molecular marker within the QTL for the HPPD non-induced tolerance on chromosome two; black lines (boundaries) represent results of the genotype of the HPPD tolerant line ML0831266-03093 (20) and the unshaded represents the genotype of the ACCase tolerant line ML0831265-01493 (10); observing the tolerance level of these lines to the HPPD herbicide mesotrione allows the resistance/tolerance to be mapped to a specific gene.

(18) FIG. 18A, FIG. 18B, FIG. 18C are photographs of controls used in the mesotrione herbicide bioassay after spraying one application of mesotrione at 105 gai/ha followed by a second application of 630 gai/ha; FIG. 18A the mutant line ML0831266-03093 shows little damage from the spray application, while FIG. 18B the unmutated type P1003 is severely injured (damaged) and FIG. 18C the other type of rice, R0146, used to make ACCase mutant line ML0831265-01493 is completely killed.

(19) FIG. 19A and FIG. 19B illustrate rate response of the mutant line ML0831266-03093, the unmutated original (parental) line P1003, and a different type of rice R0146; mesotrione was applied across all plots immediately following planting at a rate of 210 gai/ha; the response rates were applied at the 2-3 leaf stage; response was recorded twenty-one days following the foliar application. FIG. 19A=initial results and FIG. 19B=subsequent results.

(20) FIG. 20 shows a DNA sequence for the carboxyl transferease coding region in the ACCase coding gene; a single nucleotide change (box) that encodes a mutation from G2096S is identified in the mutant line ML0831265-01493 which is designated as 09PM72399. (SEQ ID NO: 202) [NIPPONBARE (SEQ ID NO: 200) is a control; R0146 (SEQ ID NO: 201) is the original line treated with a mitogen to produce a mutation population.

(21) FIG. 21 shows comparison of protein sequences for the carboxyl transferase region of the ACCase gene; the line with code 09PM72399 (SEQ ID NO: 204) is the line ML0831265-01493; this line shows a change of a single amino acid (box) at position 2096, relative to Black-Grass; R0146 (SEQ ID NO: 204) is the original line treated with a mutagen to produce a mutation population. [NIPPONBARE is SEQ ID NO: 203]

(22) FIG. 22 illustrates a response of different germplasms (genotypes) of rice with different genetic backgrounds to mesotrione applied at the 2-3 leaf stage; wherein different rates of mesotrione are applied.

(23) FIG. 23 is a photograph showing phenotypic differences (resistance) of an F2 population derived from the cross of ML0831266-03093 with tolerance to mesotrione and ML0831265-01493 with tolerance to ACCase herbicides; mesotrione was applied with one application of 105 gai/ha followed by a second application of 630 gai/ha; individuals (circled) are selected as inheriting the mesotrione tolerance, whereas the plants that did not inherit the tolerance are dead or severely injured.

(24) FIG. 24 is a flow chart of a type of cross used in some embodiments disclosed herein.

DETAILED DESCRIPTION

Mutation Population and Establishment

(25) A mutation breeding program was initiated to develop proprietary herbicide resistant/tolerant lines. A permanent mutant population was created by exposing approximately 10,000 seeds (estimated by the average weight of a kernel) of three rice lines including P1003, R0146, and P1062 to both mutagens sodium azide (AZ) and methyl-nitrosourea (MNU). The treated seeds were planted. Individual plants were harvested creating 8,281 potentially mutation lines. The lines have been maintained as a permanent mutant population for trait screening.

(26) Development of Tolerance to HPPD and ACCase Inhibiting Herbicides by Combining the Tolerances in Lines ML0831266-03093 and ML0831265-01493

(27) Herbicides that target the HPPD enzyme, primarily control broad leaf weeds. However trials in rice show prevalent control of grass weeds in rice, including red weedy rice especially with mesotrione herbicide.

(28) On the other hand, the primary weed target of ACCase herbicides is monocot plants including rice, grass weeds, and red rice. However, some ACCase herbicides have lower activity on rice. This weakness is likely transferred to red rice as the plants are very closely related. Combining the HPPD tolerance and the ACCase tolerance into a single rice line allows a broad spectrum weed control strategy for rice. The HPPD herbicide controls broad leaf weeds and enhances the effect of ACCase herbicides for control of monocot weeds including red rice.

(29) Combining the HPPD tolerance with the ACCase tolerance into a single rice line was initiated with the HPPD tolerance mapping project by crossing the HPPD tolerant line ML0831266-03093 to the ACCase tolerant line ML0831265-01493. In mapping the F2 population plants were selected for HPPD tolerance by applying mesotrione first at a low rate (105 gmai/ha) followed by a high rate (630 gmai/ha). In this process molecular markers were also developed allowing future selection of HPPD tolerance by either markers or herbicide tolerance screening or both.

(30) After identifying plants that were tolerant to the HPPD herbicide mesotrione, they were also tested with the ACCase tolerance functional marker for the G2096S mutation in the ACCase donor parent line ML0831265-01493. Information to develop ACCase G2096S markers are in FIGS. 20, 21.

(31) After this process, a set of 25 F2 plants with the ACCase mutation to herbicide resistance, and the HPPD genetic herbicide resistance on chromosome 1 and chromosome 2, in at least the heterozygous condition, were identified. The plants were transplanted to another field for harvesting at maturity. Out of the 25 plants, eight were homozygous for the ACCase mutation and one plant was homozygous for the ACCase mutation, the HPPD tolerance mutation, and the non-induced tolerance gene. The 25 plants were bagged at flowering and the seed harvested at maturity from each plant individually.

(32) An early maturing group of plants was harvested as early as possible and the seeds planted in the greenhouse to help quickly advance to the F4 generation. Selections on the F3 plants were made by molecular markers flanking the HPPD tolerance mutation and native tolerance the ACCase functional mutation. Homozygous plants for all the selected genomic regions were advanced to the F5 generation. The F5 seed was confirmed to carry tolerance to ACCase herbicides and the HPPD herbicide mesotrione. Among the F5 lines PL1214418M2-80048 was selected due to a high seed yield and being homozygous for the ACCase tolerance mutation at position G2096S, the HPPD tolerance mutation, and the HPPD tolerance native gene. Seed from the line PL1214418M2-80048 was deposited at the ATCC and given a deposit number PTA-121362 (see Table 8).

(33) A second line was developed by planting F3 seed in rows. The plants were sprayed with the HPPD herbicide mesotrione and selected for little or no injury as compared to unsprayed controls. Leaf tissue was also collected and the plants were tested for inheritance of the ACCase tolerance mutation G2096S, the HPPD mutation tolerance, and the HPPD non-induced tolerance. Plants homozygous for all three tolerance genes or QTLs were identified and harvested. The F4 seed (PL1214418M2-73009) was bulked together from plants carrying all three tolerance genes or QTLs and used for testing or as a new donor line for tolerance to both ACCase and HPPD herbicides. Seed of the source PL1214418M2-73009 was deposited at the ATCC and given a deposit number PTA-121398 (see Table 8).

(34) Tolerance of New Lines Combining HPPD and ACCase is Equivalent and Selectable in Breeding Populations

(35) The seed source PL1214418M2-73009 was developed from a cross between the HPPD resistant line ML0831266-03093 and the ACCase resistant line ML0831265-01493 and was sufficient to allow testing to verify equivalent tolerance to HPPD and ACCase inhibitors in new lines. Two trials were conducted to measure recovery of tolerance to both ACCase and HPPD herbicides in the new line PL1214418M2-73009. Recovery of tolerance in the line combining the two traits will illustrate that the traits are heritable and can be used to produce new varieties and hybrids carrying herbicide resistance. These trials are important as often times it is difficult to recover complex QTLs for quantitative traits or in some cases a traits response is dependent upon the genetic background. In the first trail the lines resistance to mesotrione (HPPD herbicide) was evaluated by planting line PL1214418M2-73009, the HPPD resistant line ML0831266-03093 and wild-type rice line P1003 and R0146 in plots (5 feet10 feet). Mesotrione was applied at 0.5, 1, 2, and 4 multiples of the labeled application rate (210 gmai/ha). Two additional treatments were included with a 1 and 2 rate followed by a second application 14 days afterward with the same rates. Full recovery of the HPPD resistance from line ML0831266-03093 was achieved in the line PL1214418M2-73009 as it and the original trait line had the same response to the herbicide applications (FIG. 1). These results show that the HPPD resistant trait can be bred and selected to develop commercial products.

(36) Another trial was conducted to confirm recovery of the ACCase inhibitor resistance from the G2096S mutation as in the line ML0831265-01493. In this trial the new line PL1214418-73009 with combined HPPD and ACCase tolerance was planted in a row along with other various lines including the original donor line ML0831265-01493 (planted in a plot), ML0831266-03093, P1003, R0146 parent line for ACCase tolerance. The lines were all tested with the ACCase herbicides fluazifop at 0.5, 1, 2, and 4 multiples of the label application rate (210 gmai/ha) and quizalofop at 0.5, 1, 2, and 4 multiples of the label application rate (77 gmai/ha). In these trials the three new lines that inherited the ACCase tolerance all showed equivalent tolerance to the ACCase herbicides as did the donor line ML0831265-01493 (FIG. 2).

(37) The tolerance to HPPD herbicides is more complex than the ACCase tolerance because it requires two genes that are different from the gene targeted by the herbicide. In spite of this greater complexity, the equivalent tolerance was recovered through selection of both the native tolerance gene and the mutation tolerance. The ACCase parent line ML0831265-01493 in this cross was highly sensitive to the HPPD herbicide mesotrione and thus was not expected to contribute any towards HPPD tolerance. Resistance/tolerance to HPPD herbicides is mostly likely caused by these two genes alone as they were the focus of the selection process, and the new line PL1214418M2-73009 shows equivalent resistance. These results show that the resistance for both ACCase and HPPD inhibitors is inherited and can be bred into any rice for commercial development of both HPPD and ACCase inhibitor resistance in rice.

(38) Identification of Unexpected Increased Tolerance to ACCase Herbicides by the HPPD Tolerance Mutation

(39) During the process of showing equivalent resistance of the ACCase tolerance in the new line PL1214418M2-73009, the HPPD tolerant line ML0831266-03093 was also evaluated for response to ACCase tolerance by application of the ACCase herbicides fluazifop at 0.5, 1, 2, and 4 multiples of the label application rate (210 gmai/ha) and quizalofop at 0.5, 1, 2, and 4 multiples of the label application rate (77 gmai/ha). In the field trials the resistant HPPD line ML0831266-03093 was planted in a row adjacent to the parent line P1003. During observations it became clear that the line ML0831266-03093 (FIG. 3A) had more resistance to the ACCase inhibiting herbicides than did line P1003 (FIG. 3B). These results suggest that the HPPD tolerance mutation has activity against ACCase inhibiting herbicides in addition to HPPD inhibiting herbicides. By combining the HPPD tolerance with the ACCase tolerance the newly developed line PL1214418M2-73009, or any other new line and other derived lines because resistance is heritable and can be bred into lines e.g. progeny may carry a higher tolerance to ACCase inhibiting herbicides than lines developed from only the ACCase inhibitor resistant line ML0831265-01493.

(40) Identification of the Tolerance Contribution from the HPPD Tolerance Mutation and the Non-Induced Tolerance Gene from P1003

(41) During the breeding process to develop new lines (PL1214418M2-80048 and PL1214418M2-73009) with resistance/tolerance to HPPD and ACCase herbicides, two other lines were also investigated to determine the contribution of the HPPD tolerance mutation and the HPPD tolerance native gene. The line PL1214418M2-73001 carries ACCase tolerance and only the HPPD tolerance, whereas mutation PL1214418M2-73013 carries ACCase tolerance and only the HPPD native tolerance gene. These selections allow the estimation of the tolerance effect of each of the two genes required for tolerance to HPPD herbicides. The tolerance effect of each gene was measured by growing the lines in single rows including the newly developed line PL1214418M2-73009 that carries both the HPPD tolerance from the mutation and the non-induced tolerance, the HPPD tolerant line ML0831266-0309, and the non-induced parent line P1003. The field plots were sprayed at the 4 leaf stage with the HPPD herbicide mesotrione at 0.5, 1, 2, and 4 multiples of the labeled application rate of 210 gmai/ha.

(42) The plots were evaluated 4 weeks after the herbicide was applied. The results showed that the native tolerance gene alone (PL1214418M2-73013) gave tolerance levels similar to the parent line P1003 (FIG. 4). This result would be expected if the native tolerance gene located on chromosome 2 located within the QTL flanking markers is the only causative source of tolerance in the non-mutant line P1003. The line PL1214418M2-73001 that carries only the HPPD mutation located on chromosome 1 within the QTL flanking markers, shows intermediate tolerance between the non-mutant line P1003 and the HPPD mutant line ML0831266-0309. This result shows that the HPPD mutation provides not only enhanced tolerance but also a greater level of tolerance than the native tolerance gene. In addition it also suggests that the HPPD mutation functions independently of the HPPD native tolerance gene. The two genes also appear to function in an additive manner as only by combining the two in the new line PL1214418M2-73009 does the tolerance level become equivalent to the original mutant line ML0831266-0309.

(43) Controlling Weeds and Red Rice in Rice Crops with ACCase Inhibitors and Mesotrione Herbicides (HPPD Inhibitors)

(44) The herbicide activity or ability to control non-mutant rice, such as line R0146 and P1003, is a good predictor of how well the herbicides will control red rice or wild weedy rice in a rice crop. Red rice and wild weedy rice are very similar to rice, even with the ability to cross with rice. This similarity is the reason these weeds are so difficult to control in a rice crop. The mutant lines (ML0831265-01493, ML0831265-02283, ML0831266-03093, PL1214418M2-80048, and PL1214418M2-73009) disclosed offer a new weed control strategy for red rice, wild weedy rice, and other weeds common in rice crops. These lines give rice tolerance to herbicides that will normally kill or cause yield reducing injury to the rice crop.

(45) While testing the tolerant lines, the parent lines were also tested to serve as controls and as an indication of commercial potential as a red rice/wild weedy rice control strategy. These trials showed that select treatments of the herbicides applied alone or in various combinations and application timings offer a new weed control strategy in rice crops.

(46) Rice is tolerant to certain ACCase inhibitor herbicides, for example cyhalofop is registered for use in rice. However other ACCase herbicides kill or severely injure rice to varying degrees. After testing, several of these other herbicides including fluazifop and quizalofop were found to offer good control of common grass weeds, such as barnyard grass, in rice (FIG. 5). Control of common weeds in rice was also achieved with mesotrione alone, especially when applied pre-plant or at higher rates (2 the labeled rate of 210 gmai/ha) (FIG. 6A and FIG. 6B). The applied rates of both types of herbicides giving the weed control are well within the tolerance level of the respective ACCase and HPPD tolerant lines including the combined lines carrying tolerance to both HPPD and ACCase herbicides.

(47) Development of the HPPD and ACCase tolerance into single lines (PL1214418M2-80048 and PL1214418M2-73009) gives the opportunity for an additional weed control strategy involving applications of ACCase and HPPD herbicides in a tank mix or individually at different times. The very effective pre-plant application of the HPPD herbicide mesotrione can now be followed with ACCase herbicides applied alone or in in combination with HPPD herbicides. This strategy provides full spectrum weed control in a rice crop by broad leaf weed control provided by the HPPD herbicide, and grass weed control by the ACCase herbicide. In addition the control of grasses and red rice/weedy rice by ACCase herbicides is greatly enhanced by the activity provided by the HPPD inhibiting herbicide. This strategy is anticipated as being especially effective for control of red rice when an ACCase inhibiting herbicides are used that have lower activity on rice (FIG. 7A and FIG. 7B).

(48) This particular weed control system is highly useful in rice crops due to some weeds, including red rice, developing tolerance to currently used herbicides. Use of this weed control strategy allows rotation of different modes of action herbicides in rice crops. By rotating different modes of herbicide action the development of resistant weeds is slowed or prevented allowing for longer term use of all available weed control methods.

(49) Tolerance/Resistance to ACCase Inhibitors

(50) 1. Validation of the Mutant Line ML0831265-02283 for Tolerance to ACCase Herbicides

(51) After screening a large mutant population, the line ML0831265-02283 also survived application of the ACCase herbicide quizalofop. The line was increased to obtain sufficient seed for larger trials to evaluate its tolerance to ACCase herbicides. The tolerance to ACCase herbicides in line ML0831265-02283 was validated by planting in the field plots (5 feet by 10 feet) of the line, the non-mutant parent line R0146, a second non-mutant line P1003, and the ACCase tolerant line ML0831265-01493. The ACCase herbicide quizalofop was applied at the four leaf stage at 0.5, 1, 2, and 4 multiples of the labeled rate (77 gmai/ha). Twenty one days after the herbicide was applied the plots were evaluated for percent injury caused to the rice based on control plots that had no herbicide application (FIG. 8). The data confirms the tolerance of line ML0831265-02283 and it may even carry more tolerance than line ML0831265-01493 as shown by less injury at the 2 and 4 rates of quizalofop.

(52) 2. Identification of the Causal Mutation for Tolerance to ACCase Herbicides in Line ML0831265-02283

(53) Often tolerance to ACCase herbicides is derived from a mutation in the carboxyl transferase region of the ACCase gene, as is the case in tolerant line ML0831265-01493 (mutation at G2096S). However after sequencing the carboxyl transferase region of the ACCase gene in line ML0831265-02283 no mutation was found. This result indicates that the tolerance in line ML0831265-02283 is derived from a non-target site process.

(54) Finding the causal mutation for tolerance in line ML0831265-02283 involved linkage mapping and mutation mapping as (mut mapping) described for finding the causal mutation and native tolerance for HPPD tolerance in line ML0831266-0309. (Wright et al., 2011)

(55) Linkage mapping to find the chromosomal region or QTL causing the tolerance in line ML0831265-02283 requires a population segregating for the trait. This population was made by crossing the tolerant line with the male sterile cytoplasm line A0109. The F1 collected from this cross was grown and allowed to self-pollinate to make a F2 population. The F2 population will segregate for ACCase tolerance. Eight hundred F2 seeds were planted and leaf tissue was collected from the seedlings to allow genotyping of each plant. When the seedlings where three weeks old the whole F2 population was sprayed with quizalfop (116 gmai/ha). The seedlings were evaluated for tolerance nineteen days after the herbicide application. Standard QTL mapping software was used to analyze the genotypes of each F2 individual and the associated tolerance response to identify molecular markers linked to the herbicide tolerance. After this analysis a genomic region (QTL) was identified for the tolerance on chromosome one (FIG. 9). Linked markers flanking the QTL and markers inside the QTL flanking the peak of the QTL were identified as being suitable to select the herbicide tolerance derived from line ML0831265-02283 (TABLE 5). Approximately 250 genes are between the flanking markers.

(56) The mutation mapping strategy to find the causal mutation was employed in the same manner as used to find the QTL for HPPD mutation tolerance. A mutation mapping population was created to find the causal tolerance mutation through genomic sequencing by next-generation sequencing. The mutant line ML0831265-02283 was crossed back to the original non-mutant parent R0146. The F1 progeny of the cross were selfed to produce a F2 population that is segregating for the tolerance causing mutation. Only mutations are segregating in this population because the mutations are the only genomic difference between ML0831265-02283 and R0146.

(57) The F2 population was planted as individuals, and leaf tissue was collected and DNA extracted from each individual to use for genotyping after the population was phenotyped. The ACCase herbicide quizalofop was applied to the F2 population at the 3-4 leaf stage and a concentration of 116 gmai/ha. Individuals that survived the herbicide application were scored as tolerant and those that died were scored as susceptible.

(58) The DNA derived from a set of twenty surviving F2 individuals and twenty that were killed was each respectively bulked together and sequenced along with both the mutant line ML0831265-02283 and the non-mutant parent line R0146. Mapping the causal mutation was based on an index accessing the frequency of all mutations in the bulk representing the surviving individuals. The index was derived from the proportion of sequencing reads that carried a variation different from the non-mutant parent line R0146. The more sequencing reads with the variation the closer the index was to one and if all sequencing reads had the variation the index equaled one.

(59) The analysis of these results showed two groups including 19 mutations of eleven mutations on chromosome one with an index score of one (FIG. 10). This result confirms the QTL linkage mapping results as the mutations identified here all are located within the QTL region identified on chromosome one by linkage mapping. Molecular markers (SNP) were made for each of the mutations (TABLE 6). These markers are used in fine mapping to find the causal mutation and for breeding the ACCase tolerance derived from line ML0831265-02283 into commercial rice lines.

(60) Tolerance/Resistance to HPPD Inhibitors: Herbicide Screening

(61) Mesotrione (Callisto), is an herbicide that inhibits the plant enzyme 4-hydroxyphenylpyruvate dioxygenase (HPPD). Callisto is a postemergent and preemergent herbicide used to control annual broadleaf weeds in corn and certain other crops. The herbicide only damages some rice at lower rates but kills other types of rice. All rice appears to be at least damaged by higher herbicide rates. Finding resistance to Callisto herbicide in rice results in a new mode of action for controlling broadleaf weeds and some grasses, in rice.

(62) Resistance to mesotrione herbicide was found by screening the permanent mutant population. All lines in the permanent mutant population were planted into a dry seed bed. Within twelve hours after planting mesotrione (Callisto) was applied at a rate of 255.1 gm ai per acre. The field was immediately flushed with water and kept moist through periodic flushing. The seedlings grew, many were bleached white and all lines derived from R0146 died whereas plants lived from 21 lines derived from the P1003 and 2 derived from P1062 mutation populations. The HPPD gene was sequenced, and no genetic mutation was identified causing any amino acid substitutions (SEQ ID NOs: 1, 2, 3).

(63) Validating the Mutant Line ML0831266-03093 for Tolerance to HPPD Inhibiting Herbicides

(64) After the initial screening of the mutation population, the lines with no damage were selected and tested in additional experiments using different rates of the herbicide. In particular, a rate response experiment was conducted in which two different rates of mesotrione were applied pre-emergence, plus an additional foliar application was also applied. This experiment differentiated one mutant line as having superior resistance (less injury) to the mesotrione herbicide as compared to the control (FIG. 19A and FIG. 19B, Table 1). Progeny of this designated ML0831266-03093 are maintained as a new line carrying resistance to mesotrione herbicide. Seeds are deposited under ATCC PTA-13620. The line (ML0831266-03093) is a source of resistance that is backcrossed into proprietary rice lines or used directly in breeding to develop new proprietary rice lines. The developed lines are a source of herbicide resistance for use in development of new hybrids that offer an alternative mode of action to control weeds in rice. Affording this opportunity to growers is of great value both in providing high yields and in extending the useful life of available weed control technologies. These herbicide resistant traits can be tracked through the simple application of herbicides to growing plants.

(65) The mutant line ML0831266-03093 was found to carry tolerance to mesotrione (a common HPPD inhibiting herbicide) through screening the line with different rates of the herbicide. The tolerance level of ML0831266-03093 was found to be much greater than the original non-mutant (native) line P1003.

(66) The original line P1003, carries natural tolerance to mesotrione. This non-induced resistance of the original line sometimes masked the resistance of the mutant line making the enhanced resistance of the mutant line ML0831266-03093 not obvious. Finding the value of the mutant line ML0831266-03093 was only achieved with careful testing over two years, in different locations, and using different rates and timings of herbicide application. The high tolerance of the mutant line ML0831266-03093 is now apparent and documented through a rate response trial measuring the response of line ML0831266-03093 and non-mutant control lines to different rates of mesotrione (FIG. 11).

(67) The validating trials included testing applications of mesotrione applied just before planting (pre-plant applications), after planting at various stages of rice growth (post applications), and combinations of both pre-plant and post applications. The discovered tolerance to HPPD inhibiting chemicals was apparent for both pre-plant and post-emergent applications (FIG. 12). The mutant line ML0831266-03093 shows tolerance greater than natural rice has to HPPD herbicides in all application regimes.

(68) Further validation of the trait involved testing the mutant line ML0831266-03093 in the presence of common rice weeds. The mutant line was completely tolerant to the applied rates of mesotrione whereas the prevalent weed population was well controlled by the herbicide (FIG. 6A and FIG. 6B). This level of grass weed control was completely unexpected as mesotrione is labeled for controlling broadleaf weeds in monocot crops. This result indicates that mesotrione and other HPPD inhibiting herbicides in combination with line ML0831266-03093 and derived lines, represent a new weed control system in rice. The high activity of the mesotrione on grass weeds and certain types of rice indicates that the system could be used to control red rice in a rice crop.

(69) Mesotrione and other HPPD inhibiting herbicides target the HPPD gene. An increase in herbicide tolerance could be achieved through a mutation in the HPPD gene. A mutation within the gene sequence can alter the enzyme structure sufficiently to prevent it from being inhibited by the herbicide, but still allow it to carry-out its normal physiological function. Assuming this as a plausible tolerance mechanism, the HPPD gene was sequenced by Sanger sequencing in both the mutant line ML0831266-03093 and the original line P1003. Surprisingly, no mutation was found in the HPPD gene (SEQ ID NO: 1). The herbicide tolerance in line ML0831266-03093 appears to be derived from a non-target site process.

(70) Two different methods were used to find the tolerance causing mutation. The first method involved using a QTL mapping strategy only employing a unique phenotyping process to find both the tolerance causing mutation and the gene causing the natural tolerance. The second method involved sequencing the entire genome of F2 plants derived from a cross to the non-mutant parent. [P1003]

(71) 1. QTL Mapping to Find the Causal Mutation and the Natural Tolerance Causing Gene

(72) The mutant line ML0831266-03093 contains high tolerance to mesotrione and possibly other HPPD inhibiting herbicides, due to both a new mutation and a native tolerance gene present in the original non-mutant line P1003. The mesotrione tolerant line ML0831266-03093 was crossed to another mutant line ML0831265-01493. This second mutant line ML0831265-01493 lacks the native tolerance gene and is highly susceptible to mesotrione. However line ML0831265-01493 does have tolerance to ACCase herbicides due to a mutation in the ACCase gene that changes amino acid 2096 from glycine to serine. This mutation alters the enzyme making it unaffected by certain ACCase herbicides, however it still retains its normal physiological function. The mutation site for change the amino acid 2096 most commonly arises in weeds as a change to alanine rather than the only rarely found serine change. (FIGS. 20, 21) A molecular marker was developed based on the sequencing information, to test for inheritance of the mutation G2096S.

(73) The F1 progeny from the cross of line ML0831266-03093 to ML0831265-01493 was selfed to produce a large population of F2 individuals. Each F2 individual was genotype with a set of 192 SNP markers (Table 3) that were polymorphic between the parents, to fully cover the genome with molecular markers.

(74) Next in a QTL mapping strategy was to spray the herbicide on the F2 individuals and observe those that survive. However, this strategy could introduce complications due to both the native tolerance gene and the tolerance mutation segregating. A different strategy was used in which first mesotrione was applied at a low rate (105 gmai/ha). At this rate all plants inheriting the tolerance causing mutation, the native tolerance, or both, survived, whereas plants inheriting the corresponding genomic regions from the line ML0831265-01493 died as they are highly sensitive to the herbicide. QTL analysis based on this phenotyping method identified one QTL located on chromosome 2 (FIG. 13). After phenotyping the F2 plants with a low application rate of mesotrione a second high rate (630 gmai/ha) was applied, and the plants were again phenotyped. After analysis, a second QTL was found on chromosome 1 representing the higher tolerance achieved from the tolerance mutation (FIG. 14). With this strategy the two genes were resolved, one of which is the mutation (chromosome 1) and the other the native tolerance (chromosome 2).

(75) Based on the QTL positions and linked markers a set of markers was identified that flank the mutation and native tolerance QTLs (TABLE 4). These markers define the region containing the HPPD tolerance causing genes. In addition this set of markers can be used for breeding purposes to develop new lines carrying tolerance to HPPD herbicides. The use of these markers allows selection without having to apply the herbicide to breeding populations.

(76) 2. Mutation Mapping to Find the Tolerance Causal Mutation

(77) A mutation mapping population was created to find the tolerance causal mutation through genomic sequencing by next-generation sequencing. The mutant line ML0831266-03093 was crossed back to the original non-mutant parent P1003. The F1 progeny of the cross was selfed to produce a F2 population that will be segregating for the tolerance causing mutation. Only mutations will be segregating in this population because the mutations are the only genomic difference between ML0831266-03093 and P1003.

(78) The F2 population was planted as individuals and leaf tissue collected and DNA extracted from each individual to use for genotyping after the population was phenotyped. In this method all of the population will carry the native tolerance gene rendering the population tolerant to a certain level to mesotrione herbicide. To differentiate the native tolerance from the tolerance causal mutation mesotrione was applied to the population with a high rate (840 gmai/ha) so that all individuals without the tolerance causal mutation died.

(79) The DNA derived from a set of twenty surviving F2 individuals and twenty that were killed was each respectively bulked together and sequenced along with both the mutant line ML0831266-03093 and the non-mutant parent line P1003. Mapping the causal mutation was based on an index accessing the frequency of all mutations in the bulk representing the surviving individuals. The index was derived from the proportion of sequencing reads that carried a variation different from the non-mutant parent line P1003. The more sequencing reads with the variation the closer the index was to one and if all sequencing reads had the variation the index equaled one.

(80) A single mutation causing the high tolerance to mesotrione was predicted. Instead the data showed a peak of mutations carrying a score of 1 introducing another level of difficulty in finding the causal mutation. The result did confirm that the QTL on chromosome 1 found through linkage mapping is the genomic location of the tolerance casual mutation (FIG. 15). Within the peak of mutations we found seven mutations with an index of one, none of which are an obvious cause for tolerance to mesotrione herbicide. (TABLE 7) Markers were developed for the mutations to facilitate finding the casual resistance mutation(s).

(81) A set of lines was identified with recombination points evenly distributed within the identified QTLs and mutations (FIG. 16A, 16B, FIG. 17). These lines were recovered in a homozygous condition for each recombination allowing phenotyping for herbicide tolerance on multiple individuals (full plots). Analysis of these lines allowed the tolerance mutation and native gene to be narrowed to a small region of the chromosome.

(82) Through the described strategy the specific genomic regions containing the tolerance causal mutation and the native tolerance gene are now known and useful for developing commercial products. The commercial products are useful in rice production as they survive application of mesotrione herbicide at rates that will control prevalent weeds including red rice without harming the rice crop. The specific genomic location allows the use of molecular markers on the flanking regions of each QTL to select for the HPPD tolerant trait in the development of commercial products.

(83) Genetic mapping of the three groups of F2 individuals including the set of individuals sprayed with mesotrione at only 105 gm ai/ha, the set followed by a sequential application of 630 gm ai/ha, and the final group sprayed with 420 gm ai/ha shows two genes controlling resistance to mesotrione. In the population sprayed with 105 gm ai/ha a single QTL found on chromosome 2 with strong linkage to SNP marker BG-id2004662 acted in a mostly dominate manner. This marker and QTL identifies the inherent tolerance in line P1003. The marker is useful for breeding and selection of new mesotrione tolerant lines. The discovery of this QTL facilitates commercial development of new rice varieties with a new method for controlling weeds through the use of mesotrione herbicide. The finding of the linked marker BG-id2004662 is a novel finding and selection strategy for breeding and selecting the tolerance to mesotrione and other herbicides derived from line P1003.

(84) In the two groups of F2 individuals sprayed with the higher rates of mesotrione (420 and 630 gm ai/ha) a second QTL was found with strong linkage to SNP marker WG-id1002788. This QTL is the demonstrated genetic position of the causal mutation for high tolerance to mesotrione. The combined tolerance of the QTL developed through mutation breeding on chromosome 1 and the QTL discovered in line P1003 provides a novel tolerance to mesotrione and combined with the linked molecular markers facilitates quick and efficient breeding of new rice varieties (FIG. 24).

(85) Genetic mapping for the genomic location for resistance in line ML0831266-03093 is carried out by common QTL mapping strategies. The resistant line ML0831266-03093 may be crossed with a highly sensitive line and the resulting F1 seeds grown and plants selfed to produce a F2 mapping population segregating for the resistance trait. Finding trait linked markers is done by genotyping each F2 plant, spraying the plants with an appropriate concentration of the herbicide, and associating the molecular genotypes with the phenotype of each individual. This process will identify a genomic region between markers for the causal mutation for resistance.

(86) Identifying the mutation causing the herbicide resistance is possible through a variety of processes. The mutant line and the original non-mutant line sequences are prepared and compared to identify mutations within the region of the QTL found through common trait mapping methods. Then markers are developed to the sequence differences, they are testing on a phenotyped segregating population such as the one used for QTL identification or make a new similar population. In another method, next generation sequencing is used to sequence and compare a bulk of individuals that are resistant to either a bulk of susceptible individuals or to the original non-mutant line. In this method the causal mutation is found through the resistant bulk having the highest portion of the mutation or sequence difference as compared to the susceptible bulk or non-mutant original line.

(87) A recent publication for these methods includes Akira Abe, et al.; Nature Biotechnology 30, 174-178(2012) doi:10.1038/nbt.2095, Published online 22 Jan. 2012.

EXAMPLES

Example 1: Production of Hybrid Rice Resistant to One HPPD Inhibiting Herbicide

(88) The HPPD inhibiting herbicide resistance provided by ML0831266-03093 is deployed individually into hybrids through either the male or female parent resulting in the hybrid seed being resistant to the herbicide. If the resistance is deployed in only the male parent, then in addition to its use for weed control, the herbicide when applied to hybrid seed kills contaminating female selfed seed. On the other hand if the resistance is deployed only through the female parent, growers may eliminate contaminating male selfed seed.

(89) Growers may alternate the type of resistance they purchase and apply in their fields to reduce the chance that weeds develop resistance to the herbicide. The HPPD inhibiting herbicide, though primarily for control of broad leaf weeds, also allows for some enhanced control of red rice. At higher rates it will kill certain types of rice. If resistance arose in red rice from cross pollination, it could still be controlled with a different herbicide class in the next season.

Example 2: Production of Hybrid Rice with High Level of Resistant to HPPD Inhibiting Herbicides

(90) The HPPD inhibiting herbicide resistance provided by ML0831266-03093 is deployed into both the male and female parents of a hybrid. The resulting hybrid seed may carry resistance to mesotrione and other HPPD inhibiting herbicides. Resistance provided in this manner is stronger and offers better weed control through the possibility of being able to apply higher rates of herbicide.

Example 3: Production of Hybrid Rice Resistant to Multiple Herbicides

(91) The herbicide resistance for at least 2 herbicides is deployed in a single hybrid through making both the female and male parent resistant to both herbicides. Deployment in this manner results in hybrid seed being homozygous for both resistances. By providing resistance in homozygous condition in the hybrid for both herbicide classes the hybrid seed shows maximum level of resistance. In addition by deploying both resistances together, the grower has the option to select either herbicide to apply in a given season, alternatively, both herbicides could be applied within the same season. The ability to rotate herbicides provides the opportunity to extend the life of the herbicides through delaying the development of weed resistance. This method also allows for the use of both herbicide classes for weed control during hybrid seed production.

Example 4: Production of Hybrid Rice Resistant to Mesotrione and at Least One Other Herbicide Class

(92) 1. Resistance to mesotrione and at least one other herbicide class is deployed in a single hybrid by using a male parent that carries resistance to the mesotrione (or the other herbicide) and a female that carries the other resistance. The method allows the grower to make a single purchase but to be able to choose which herbicide to apply. A single class of herbicide may be used in any one season and rotated between seasons, or alternatively both herbicides could be applied within a single season. In addition, deployment by this method, elements contaminating selfed seed of both parents in the hybrid seed through application of both herbicides, or one type or the other, are eliminated through application of only one herbicide.

(93) 2. In another method of deployment the mesotrione resistance and any other herbicide resistance is deployed through making a hybrid with a male parent that carries both resistances. The grower then has the option to choose which herbicide class to apply or to apply both within a single season. In addition, through the application of either herbicide contaminating selfed female seed would be eliminated. Alternatively both herbicide class resistances are provided in the female parent, giving the grower the same options for weed control.

(94) 3. Another embodiment is to deploy the mesotrione resistance to both parents, and another herbicide resistance into only one parent, such as the male parent. The hybrid seed are then homozygous for the mesotrione resistance but not the other. A scheme like this is used to make an early application with the herbicide put into only the male parent, providing weed control and elimination of contaminating female selfs. Later in the season mesotrione may be applied or another HPPD inhibitor herbicide. The useful life of both herbicides is extended through limiting or eliminating the development of weed resistance. In another application this method allows the use of mesotrione or other HPPD inhibitor herbicide to control weeds in seed production fields, allowing for cleaner seed.

(95) 4. Alternatively a different herbicide could be deployed in both of the hybrid parents and the mesotrione/HPPD inhibitor is deployed in only the male parent.

(96) 5. Other embodiments for deploying herbicide resistant lines include other traits such as resistance to other classes of herbicides, or other traits of importance.

Example 5: Seed Production

(97) The herbicide resistance is also used for seed production. As an example, if it is deployed into the female parent, making it resistant, the herbicide is applied to the seed production field to kill the male plants before setting seed so that a seed production field is harvested as a bulk. In addition the purity of the seed may also be verified through deploying two herbicide resistances with only one in each parent. Selfed seed is detected and eliminated by applying herbicide put into the other parent.

Example 6: Control of Broadleaf Weeds and Limited Control of Grasses

(98) The resistance when deployed in a hybrid, by any combination, provides resistance to mesotrione or other HPPD inhibiting herbicides. This deployment results in a new mode of action in rice to control broadleaf weeds with some limited control of grasses such as red rice. Further options or broad spectrum control of weeds is provided by deployment in the same hybrid another resistance to herbicides providing grass weed control, such as ACCase inhibiting herbicides. Through deployment with other modes of action development of weed resistance is more likely to be prevented through the use of multiple modes of action.

Example 7: Selection of Herbicide Resistant Rice Using a Herbicide Bioassay

(99) Selection of material inheriting mesotrione tolerance is accomplished by a simple herbicide bioassay. A high rate of mesotrione (at least 420 gm ai/ha) is applied allowing differentiation of heterozygous individuals from homozygous individuals and the tolerance level of the mutation line from the inherent tolerance level in the background of some types of rice. In one example a rate of 105 gm ai/ha is applied followed three weeks later by a second application of 630 gm ai/ha. In another example a rate of 420 gm ai/ha is applied in a single application. Yet another example entails applying the herbicide at a rate of 630 gm ai/ha. Herbicide applications are done at the three to four leaf stage of seedling growth. The ideal situation is to have also planted near or within the plants to be selected a set of plants from the original mutant mesotrione tolerant donor line ML0831266-03093, (FIG. 18A) a row of plants of the wild-type of the mutation line, P1003 (FIG. 18B), and a row of the line involved as the other parent in the cross (FIG. 18C). These control lines allow easy differentiation for inheritance of the tolerance provided by the ML0831266-03093 mutant line through comparison of the response in the plants to be selected with the control lines. Only plants that live and are relatively healthy will have inherited and be homozygous for the tolerance level provided by the ML0831266-03093 mutant line (FIG. 18A).

Example 8: Production of Rice Resistant to Both HPPD and ACCase Inhibiting Herbicides

(100) The mutant line ML0831266-03093 that is tolerant to mesotrione and likely other herbicides including HPPD inhibitors, was crossed with mutant line ML0831265-01493 having tolerance to ACCase herbicides and more specifically fop type of ACCase herbicides. In one example the ML0831266-03093 plants are the female parent and pollination is by a plant from line ML0831265-01493. In another embodiment the parents are reversed so that ML0831266-03093 serves as the pollinating parent. The resulting F1 seed are harvested having inherited both mesotrione and ACCase herbicide tolerance. The F1 individual carries tolerance to both herbicides at a partially dominant level so they show some tolerance but not to the same level as the tolerant parent lines.

(101) The F1 seeds are planted and the resulting plants are allowed to self-pollinate to produce F2 seed making a population segregating for tolerance to both mesotrione and ACCase herbicides. This population is screened by an herbicide bioassay to identify individuals that have inherited tolerance from the original mutant line ML0831266-03093 and are homozygous for the resistance. A high rate of mesotrione is applied allowing differentiation of heterozygous individuals from homozygous individuals and the tolerance level of the mutation line from the tolerance level in the background of some types of rice including the original line used for mutation to create the ML0831266-03093 line, which was P1003 (FIG. 3A and FIG. 3B).

(102) In one example a rate of 105 gm ai/ha is applied followed three weeks later by a second application of 630 gm ai/ha. In another example a rate of 420 gm ai/ha is applied in a single application. Yet another example entails applying the herbicide at a rate of 630 gm ai/ha. Herbicide applications are done at the three to four leaf stage of seedling growth. The ideal situation is to have also planted near or within the F2 population a set of plants from the original mutant mesotrione donor line ML0831266-03093, a row of plants of the wild-type of the mutation line, P1003, and a row of the line involved as the other parent ML0831265-01493. These control lines will allow easy differentiation for inheritance of the tolerance provided by the ML0831266-03093 mutant line through comparison of the response in the F2 plants to these control lines. Only plants that live and are relatively healthy will have inherited and be homozygous for the tolerance level provided by the ML0831266-03093 mutant line.

Example 9: A Co-Dominant Marker Assay to Select and Develop ACCase and HPPD Tolerant Rice Lines

(103) A simple co-dominant marker assay is available to select for inheritance to ACCase herbicides derived from line ML0831265-01493. The marker is developed as a single nucleotide polymorphic marker and detects the causal mutation at position G2096S (blackgrass number) for ACCase tolerance in line ML0831265-01493. All of the surviving plants following the mesotrione bioassay as employed in Example 8 are sampled for tissue collection, the DNA is extracted by known methods and the samples are tested with the SNP assay. A subset of the surviving plants are then also identified as carrying homozygous tolerance to ACCase herbicides through marker assisted selection.

(104) Individuals with tolerance to both mesotrione and ACCase herbicides are selfed to produce F3 families and further selected for other important agronomic characters. The F3 lines are selfed and purified to derive a new line or variety with dual resistance to mesotrione and ACCase herbicides. Such lines are highly valuable as the use of both herbicides provides more complete and broad-spectrum weed control.

(105) In another embodiment the individuals with tolerance to both mesotrione and ACCase are used as trait donors in a backcross (BC) breeding program. After selecting one individual or a few individuals they are used either as the pollinating parent or the female parent. Another more elite and desirable line serves as the recurrent parent to which the traits are transferred.

(106) Following the first cross the F1 plants are crossed again to the recurrent parent. The resulting backcross seed from this cross and ongoing crosses to the recurrent parent are tested with either markers or through herbicide bioassays for inheritance of the herbicide tolerance or a combination of markers and bioassays. In the best situation markers for the functional mutations are used. Alternatively an herbicide bioassay for mesotrione is applied to the BC seed or possibly the BC seed is progeny tested to verify inheritance of the tolerance. Furthermore an herbicide bioassay is used to identify individuals that also inherited tolerance to ACCase herbicides. This process is repeated until the recurrent parent genome is recovered along with the two new traits for tolerance to mesotrione and ACCase herbicides. After the last backcross individuals are selfed to recover the dual herbicide tolerances in a homozygous resistant level in at least one plant.

(107) In yet another embodiment the individuals with resistance to both mesotrione and ACCase herbicides are crossed to a third line and subsequently selfed or even crossed with other lines. The resulting new lines and germplasm is tested and evaluated for other agronomic important traits. Finally new varieties or male and female lines are developed with tolerance to both mesotrione or other HPPD herbicides and ACCase herbicides a combination novel to rice.

Example 10: Mutant Rice ML0831266-03093

(108) The mutant line ML0831266-03093 is demonstrated to carry a high tolerance level to mesotrione herbicide beyond the tolerance found naturally in some rice types including the original mutation treated line P1003. The mutant line is planted in rows or alternatively whole plots are planted and rows of the unmutated line (P1003) and other types of rice or whole plots are planted. Mesotrione is applied pre-emergence or alternatively it is applied post-emergence at the three to four leaf stage of the rice plants. Various rates of mesotrione are applied pre-emergence, pre-emergence followed by post-emergent, or post-emergent with a single or sequential application. Post-emergent applications are applied at the 3-4 leaf stage of the rice.

(109) With low rates (105 gm ai/ha) of mesotrione applied both the mutant line as well as the original unmutated line survive. However, other types of rice, such as the mutant line with ACCase tolerance ML0831265-01493 and the associated unmutated line R0146 are killed at these rates of mesotrione. Applying mesotrione herbicide at higher rates clearly shows new and novel tolerance level as only the mutant line ML0831266-03093 survives while the original unmutated line P1003 and all other tested lines are killed or severally injured. The higher tolerance to mesotrione makes the line ML0831266-03093 of commercial value as both the tolerance can be controlled or bred into new varieties and it is of a high enough level to allow commercial weed control in rice with the application of mesotrione herbicide and possibly other HPPD inhibiting herbicides (FIG. 19A initial results, FIG. 19B new results after 1 year, and FIG. 22trial results on various rice lines).

Example 11: Chromosomal Locations of Mutations Related to HPPD Inhibiting Resistance

(110) The mesotrione tolerant line ML0831266-03093 is tolerant to rates of 420 gm ai/ha and even a dual application of mesotrione first at a rate of 105 gm ai/ha followed three weeks later by an application of 630 gm ai/ha. The line ML0831266-03093 with this high level of tolerance is crossed with a line highly sensitive to mesotrione one being line ML0831265-01493, which has tolerance to ACCase herbicides. The cross is made and the resulting F1 seeds are harvested, planted, and allowed to self to produce a F2 population. The F2 population is grown and tissue is collected from individual plants. Each F2 plant and parental lines are tested with a set of 192 SNP markers identified as being polymorphic between the two mutant lines ML0831266-03093 and ML0831265-01493. The set of polymorphic markers was identified as evenly spaced across the rice genome after testing both parental lines with a set of 796 SNP markers. All 192 markers including two found with linkage to target traits were selected from the 44 k SNP set described by Zhao et al. 2011.

(111) Seedlings of size 3 to 4 leaves are sprayed with mesotrione herbicide. In one set of 89 plants mesotrione is first applied at 105 gm ai/ha killing 23 plants. Both the mutant line control ML0831266-03093 and the unmutated line P1003 survived the herbicide application while the unmutated line R0146 was killed. The surviving plants including some additional plants making a total of 95 are then sprayed with another treatment of mesotrione at a rate of 630 gm ai/ha killing or injuring 67 while 28 survived. (FIG. 23) The surviving ratio of plants to those killed or injured fits a one quarter ratio with a chi squared value of 1.03, well within the expected for a single recessive gene. Another set of F2 individuals of size 78 individuals are sprayed with a single application of mesotrione herbicide at a rate of 420 gm ai/ha resulting in 26 plants surviving also fitting in the expected one quarter ratio for a single recessive gene with a chi square value of 2.88 (Table 2).

Example 12: Crosses Between Mutant Lines Resistant to Different Herbicides

(112) The cross between mutant line ML0831266-03093 (ATCC PTA-13620) carrying tolerance to mesotrione and possibly other HPPD inhibiting herbicides with mutant line ML0831265-01493 with (ATCC PTA-12933) tolerance to ACCase herbicides produced F1 seed inheriting both herbicide tolerances. Following selfing of the F1 plants F2, individuals are selected either through herbicide bioassays or alternatively with molecular markers. In the case of ACCase a functional molecular marker is described such that the mutation at position G2096S (based on the black grass numbering system) is selected. Furthermore using either markers linked to the QTLs on chromosome 1 and chromosome 2 or herbicide bioassays recovery of tolerance to mesotrione and ACCase including other HPPD herbicides or other herbicides.

(113) Individuals selected for tolerance to mesotrione including other HPPD herbicides and possibly other herbicides may be used in a backcross conversion program or in breeding to develop new varieties and hybrids with a commercial level of tolerance to mesotrione and other herbicides. Selection with either bioassays or the chromosome 1 and chromosome 2 QTLs leads to the recovery of the inherent tolerance in P1003 along with the mutant tolerance for development of a novel variety or hybrid with herbicide tolerance and representing new weed control options in rice. The tolerance level of the mutant line is superior to other lines and allows for various commercial application methods.

(114) The individual plants with tolerance to both herbicides are used in breeding to develop new varieties and hybrids with tolerance to both ACCase inhibiting herbicides, mesotrione, other HPPD inhibiting herbicides, and other herbicides. The new varieties and hybrids are commercial products. The commercial products are used commercially for rice production. In the production process both ACCase and mesotrione or other herbicides may be applied to the rice crop to control weeds. In one example mesotrione or other herbicides are applied preplant to control germinating weeds and provide residual weed control. Following germination of the rice crop ACCase herbicides are applied for controlling grass weeds. In another example both mesotrione or the equivalent is applied preplant and a second application is made post emergent along with an ACCase herbicide with one or two applications. In another example both mesotrione and an ACCase herbicide or other herbicides including other HPPD herbicides are applied post emergent with one or two applications. In this manner a new and novel strategy is implemented to provide full spectrum weed control in rice. In addition these herbicides have new not previously used in rice modes of action. This strategy therefore has commercial application not only for weed control but as a method to extend the useful life of this strategy and others through the application of multiple modes of action for weed control.

Example 13: Identification of the Causal Mutation for Tolerance to Mesotrione and Other HPPD Herbicides

(115) The mutant line ML0831266-03093 is crossed back to the original line, P1003, used for induction of mutations. The F1 seed is grown and the plants selfed to produce an F2 population segregating for tolerance to mesotrione. Each F2 plant is labeled and a leaf sample is collected for DNA extraction. The F2 plants are then sprayed with mesotrione herbicide at the 3-4 leaf stage at a rate of 630 gmai/ha. Among the surviving set of the least injured twenty are identified and used for DNA extraction to represent individuals that inherited the mesotrione tolerance and presumably the causal mutation for tolerance. Out of the plants killed by the herbicide application a set of twenty is also identified for DNA extraction to represent individuals that have the wild-type allele at the causal tolerance locus.

(116) The leaf tissue from the identified individuals is used for DNA extraction and DNA is combined from each set to make a bulk of individuals carrying the tolerance and a bulk lacking the tolerance. In addition DNA is also extracted from leaf tissue derived from the original line, P1003, used for mutation treatment. These samples are used in next generations sequencing at 30 coverage and compared to the rice reference sequence, NIPPONBARE, to the original line used for mutation treatment, P1003, and to each other. Using these comparisons it is possible to identify among the group with tolerance a single mutation being present across all individuals and thus highly likely to be the causal mutation for tolerance to mesotrione.

(117) The genome regions suspected to carry the causal mutation are sequenced by Sanger sequencing technology in both the mutant line ML0831266-03093 and the original non-mutant line P1003. Following the identification of real SNP markers or some other suitable marker is developed and the whole F2 phenotyped segregating population is tested to identify linkage of the suspected causal mutation to the phenotype.

(118) Other characterizations and processes are also applicable to verify the function of the causal mutation. For example the gene containing the mutation is identified through comparison to the published full rice sequence and related databases. Furthermore the gene product or enzyme can be isolated and characterized to describe its normal function and function with the new mutation especially in relation to its function in the presence of mesotrione.

Example 14: Double Mutant Resistant to HPPD and ACCase Herbicides

(119) A simple co-dominant marker assay is available to select for inheritance to ACCase herbicides derived from line ML0831265-01493. The marker is developed as a single nucleotide polymorphic marker and detects the causal mutation at position G2096S (blackgrass number) for ACCase tolerance in line ML0831265-01493. All of the surviving plants following the mesotrione bioassay as employed in example 11 are sampled for tissue collection, the DNA is extracted by known methods and the samples are tested with the SNP assay. A subset of the surviving plants are then also identified as carrying homozygous tolerance to ACCase herbicides through marker assisted selection.

(120) Individuals with tolerance to both mesotrione and ACCase herbicides were selfed to produce F3 families and further selected for other important agronomic characters. The F3 lines were selfed and purified to derive a new line or variety with dual resistance to mesotrione and ACCase herbicides. Such lines are highly valuable as the use of both herbicides provides more complete and broad-spectrum weed control. For example line PL1214418M2-73009 (ATCC deposit PTA-121398) and PL1214418M2-80048 (ATCC deposit PTA-121362) contains tolerance to both HPPD inhibiting herbicide mesotrione and the ACCase inhibiting herbicide fluazifop (see Table 8). Other related lines have also been developed and are highly useful for use as a new weed control system in rice employing both ACCase and HPPD types of herbicide.

(121) In another embodiment the individuals with tolerance to both mesotrione and ACCase are used as trait donors in a backcross breeding program. After selecting one individual or a few individuals they will be used either as the pollinating parent or the female parent. Another more elite and desirable line serves as the recurrent parent to which the traits are transferred. Following the first cross the F1 plants are crossed again to the recurrent parent. The resulting backcross seed from this cross and ongoing crosses to the recurrent parent are tested with either markers or through herbicide bioassays for inheritance of the herbicide tolerance or a combination of markers and bioassays. In the best situation markers for the functional mutations are used. Alternatively an herbicide bioassay for mesotrione is applied to the BC seed or possibly the BC seed is progeny tested to verify inheritance of the tolerance. Furthermore an herbicide bioassay is used to identify individuals that also inherited tolerance to ACCase herbicides. This process is repeated until the recurrent parent genome is recovered along with the two new traits for tolerance to mesotrione and ACCase herbicides. After the last backcross individuals are selfed to recover the dual herbicide tolerances in a homozygous resistant level in at least one plant.

(122) In yet another embodiment the individuals with resistance to both mesotrione and ACCase herbicides are crossed to a third line and subsequently selfed or even crossed with other lines. The resulting new lines and germplasm is tested and evaluated for other agronomic important traits. Finally new varieties or male and female lines are developed with tolerance to both mesotrione or other HPPD herbicides and ACCase herbicides a combination novel to rice.

Example 15: Full Spectrum Weed Control in Rice Based on Dual Resistance to Both ACCase and HPPD Herbicides

(123) In the production process both ACCase and mesotrione or other herbicides may be applied to the rice crop to control weeds. In one example mesotrione or other herbicides are applied preplant to control germinating weeds and provide residual weed control. Following germination of the rice crop ACCase herbicides are applied for controlling grass weeds. In another example both mesotrione is applied preplant and a second application is made post emergent along with an ACCase herbicide with one or two applications. In another example both mesotrione and an ACCase herbicide or other herbicides including other HPPD herbicides are applied post emergent with one or two application. In this manner a new and novel strategy is implemented to provide full spectrum weed control in rice. In addition these herbicides have not previously been used in rice modes of action. This strategy therefore has commercial application not only for weed control but as a method to extend the useful life of this strategy and others through the application of multiple modes of action for weed control.

SEED DEPOSITS UNDER BUDAPEST TREATY

(124) Seed deposits by Ricetec AKTIENGESELLSCHAFT were made with the American Type Culture Collection (ATCC), 10801 University Boulevard, Manassas, Va. 20110, United States of America. The dates of deposit and the ATCC Accession Numbers are: ML0831266-03093 (PTA-13620, Mar. 19, 2013); ML0831265-01493 (PTA-12933, May 31, 2012); ML0831265-02283 (PTA-13619, Mar. 19, 2013); PL1214418M2-73009 (PTA-121398, Jul. 18, 2014); PL1214418M2-80048 (PTA-121632, Jun. 30, 2014) (see also Table 8). All restrictions will be removed upon granting of a patent, and the deposits are intended to meet all of the requirements of 37 C.F.R. 1.801-1.809, and satisfy the Budapest Treaty requirements. The deposit will be maintained in the depository for a period of thirty years, or five years after the last request, or for the enforceable life of the patent, whichever is longer, and will be replaced as necessary during that period.

Definitions

(125) In the description and tables which follow, a number of terms are used. In order to provide a clear and consistent understanding of the specification and claims, including the scope to be given such terms, the following definitions are provided:

(126) Acetyl-Coenzyme. A carboxylase (ACCase; EC 6.4.1.2) enzymes synthesize malonyl-CoA as the start of the de novo fatty acid synthesis pathway in plant chloroplasts. ACCase in grass chloroplasts is a multifunctional, nuclear-genome-encoded, very large, single polypeptide, transported into the plastid via an N-terminal transit peptide. The active form in grass chloroplasts is a homodimeric protein.

(127) ACCase enzymes in grasses are inhibited by three classes of herbicidal active ingredients. The two most prevalent classes are aryloxyphenoxypropanoates (FOPs) and cyclohexanediones (DIMs). In addition to these two classes, a third class phenylpyrazolines (DENs) has been described.

(128) Certain mutations in the carboxyl transferase region of the ACCase enzyme results in grasses becoming resistant to ACCase herbicides. In the weed Black-Grass at least five mutations have been described which provide resistance to FOP or DIM class of ACCase herbicides. Some mutations rendering ACCase enzymes resistant to these herbicides may be associated with decreased fitness.

(129) Allele. Allele is any one of many alternative forms of a gene, all of which generally relate to one trait or characteristic. In a diploid cell or organism, the two alleles of a given gene occupy corresponding loci on a pair of homologous chromosomes.

(130) Backcrossing. Process of crossing a hybrid progeny to one of the parents, for example, a first generation hybrid F1 with one of the parental genotypes of the F1 hybrid.

(131) Blend. Physically mixing rice seeds of a rice hybrid with seeds of one, two, three, four or more of another rice hybrid, rice variety or rice inbred to produce a crop containing the characteristics of all of the rice seeds and plants in this blend.

(132) Cell. Cell as used herein includes a plant cell, whether isolated, in tissue culture or incorporated in a plant or plant part.

(133) Cultivar. Variety or strain persisting under cultivation.

(134) Embryo. The embryo is the small plant contained within a mature seed.

(135) Essentially all the physiological and morphological characteristics. A plant having essentially all the physiological and morphological characteristics of the hybrid or cultivar, except for the characteristics derived from the converted gene.

(136) Grain Yield. Weight of grain harvested from a given area. Grain yield could also be determined indirectly by multiplying the number of panicles per area, by the number of grains per panicle, and by grain weight.

(137) Injury to Plant. Is defined by comparing a test plant to controls and finding the test plant is not same height; an abnormal color, e.g. yellow not green; a usual leaf shape, curled, fewer tillers.

(138) Locus. A locus is a position on a chromosome occupied by a DNA sequence; it confers one or more traits such as, for example, male sterility, herbicide tolerance, insect resistance, disease resistance, waxy starch, modified fatty acid metabolism, modified phytic acid metabolism, modified carbohydrate metabolism and modified protein metabolism. The trait may be, for example, conferred by a naturally occurring gene introduced into the genome of the variety by backcrossing, a natural or induced mutation, or a transgene introduced through genetic transformation techniques. A locus may comprise one or more alleles integrated at a single chromosomal location.

(139) Induced. As used herein, the term induced means genetic resistance appeared after treatment with mutagen.

(140) Non-induced. As used herein, the term non-induced means genetic resistance not known to be induced; is at different location in the genome, than induced resistance.

(141) Plant. As used herein, the term plant includes reference to an immature or mature whole plant, including a plant from which seed or grain or anthers have been removed. Seed or embryo that will produce the plant is also considered to be the plant.

(142) Plant Part. As used herein, the term plant part (or a rice plant, or a part thereof) includes protoplasts, leaves, stems, roots, root tips, anthers, seed, grain, embryo, pollen, ovules, cotyledon, hypocotyl, glumes, panicles, flower, shoot, tissue, cells, meristematic cells and the like.

(143) Quantitative Trait Loci (QTL). Genetic loci that controls to some degree numerically measurable traits that are usually continuously distributed.

(144) Regeneration. Regeneration refers to the development of a plant from tissue culture.

(145) Resistance/Resistant.sup.1. The inherited ability of a plant to survive and reproduce following exposure to a dose of herbicide normally lethal to the wild type resistance may be naturally occurring or induced by such techniques as genetic engineering or selection of variants produced by tissue culture or mutagenesis. .sup.1Weed Science Society of America, Weed Technology, vol. 12, issue 4 (October-December, 1998, p. 789)

(146) Single Gene Converted (Conversion). Single gene converted (conversion) includes plants developed by a plant breeding technique called backcrossing wherein essentially all of the desired morphological and physiological characteristics of an inbred are recovered, while retaining a single gene transferred into the inbred via crossing and backcrossing. The term can also refer to the introduction of a single gene through genetic engineering techniques known in the art.

(147) Tolerance/Tolerant. The inherent ability of a species to survive and reproduce after herbicide treatment implies that there was no selection or generic manipulation to make the plant tolerant.

(148) Resistance/tolerance are used somewhat interchangeably herein; for a specific rice plant genotype information is provided on the herbicide applied, the strength of the herbicide, and the response of the plant.

(149) Sequence listing of HPPD gene and protein

(150) LOC_Os02g07160 sequence information

(151) TABLE-US-00001 Genomic sequence length: 2760 nucleotides CDS length: 1341 nucleotides Protein length: 446 amino acids Putative Function: glyoxalase family protein, putative, expressed

(152) TABLE-US-00002 GenomicSequence >LOC_Os02g07160 (SEQIDNO:1) ACGCCGCCACTGTCATCCACTCCCCCACACCCCACGACGCGCCACGCCACGCCGCGCCGC GCCGCGCCATGCCTCCCACTCCCACCCCCACCGCCACCACCGGCGCCGTCTCGGCCGCTG CGGCGGCGGGGGAGAACGCGGGGTTCCGCCTCGTCGGGCACCGCCGCTTCGTCCGCGCCA ACCCGCGGAGCGACCGGTTCCAGGCGCTCGCGTTCCACCACGTCGAGCTCTGGTGCGCCG ACGCCGCGTCCGCCGCGGGCCGGTTCGCCTTCGCCCTGGGCGCGCCGCTCGCCGCCAGGT CCGACCTCTCCACGGGGAACTCCGCGCACGCCTCCCTCCTCCTCCGCTCCGCCTCCGTCG CGTTCCTCTTCACCGCCCCCTACGGCGGCGACCACGGCGTCGGCGCGGACGCGGCCACCA CCGCCTCCATCCCTTCCTTCTCCCCAGGCGCCGCGCGGAGGTTCGCCGCGGACCACGGCC TCGCGGTGCACGCCGTGGCGCTGCGCGTCGCCGACGCGGCCGACGCCTTCCGCGCCAGCG TCGCGGCCGGTGCGCGCCCGGCGTTCCAGCCCGCCGACCTCGGCGGTGGCTTCGGCCTCG CGGAGGTGGAGCTCTACGGCGACGTCGTGCTCCGCTTCGTCAGCCACCCGGACGGCGCCG ACGCGCCCTTCCTCCCGGGTTTCGAGGGCGTCAGCAACCCGGGCGCCGTGGACTACGGCC TCCGCCGGTTCGACCACGTCGTCGGCAACGTGCCGGAGCTCGCTCCGGTAGCCGCGTACA TCTCCGGGTTCACCGGGTTCCACGAGTTCGCCGAGTTCACCGCCGAGGACGTGGGCACCG CCGAGAGCGGCCTCAACTCGGTGGTGCTCGCCAACAACGCGGAGACCGTGCTGCTGCCGC TCAACGAGCCGGTGCACGGCACCAAGCGGCGGAGCCAGATACAGACGTACCTGGACCACC ACGGCGGCCCGGGGGTGCAGCACATCGCGCTGGCCAGCGACGACGTGCTCGGGACGCTGA GGGAGATGCGGGCGCGCTCCGCCATGGGCGGCTTCGAGTTCTTGGCGCCGCCGCCGCCCA ACTACTACGACGGCGTGCGGCGGCGCGCCGGGGACGTGCTCTCGGAGGAGCAGATCAACG AGTGCCAGGAGCTCGGGGTGCTCGTGGACAGGGATGACCAGGGGGTGTTGCTCCAGATCT TCACCAAGCCAGTAGGAGACAGGTAAAATCCTCACCTCTTTCATGATGAAAATGGCTTAT GAATTCAGATTTGCAGTTATTTGTTGGCACATAGCATCGATTAGGCGCAGAAAGGTGTCA AGCATTATGAAATTAATCCAGAATGCTIGAATAATACAGTATAATATATGATAGTGAGCT CTGTGATACTCCATGGATACTCTTTATGTGTCTCCATGAATCCATGATGCGCCTTTCTGA AGATTGTGACACTAGAAAGGGAATAAAGCTGAATGTGCATAGGAAAAAAATGAAAAGCCA ATGTGTGTCTGTTTATGCCITCTTGCAAGCATATCCCAGTICCTTTTTGCCGGCATGTTG TAATGCAGATAGCCAGCCACATATAGCTACTTAATTAGTGAGTACTCCCTCTCACAATGT AAGTCATTCTAGTATTTTCCACATTCATATTGATGCTAATCTATCTAGATTCATTAGCAT CAATATGAATATGGGAAATACTAGAATGACTTACATTGTGAAACGGAGGAAGTATTACTT ACTACATCTAAGGTCCATGGATTCCTTTTTTTACAAAAGAAAGAAAGAATCTTATGGCAA CTCCATCAGCATAAACCAGCAATGCTGCTGGGAACAACTTAAACTTTAGGTTCAGGAGGT TGTAATTGTCTTTAAGCTTAATAGTCTGATTCAGTCAGTATTCTAATTTCTGCTGCATCT TTGCTATTGTTATTTCCTCTCTGTGACTCCAAATCTAACTGGATCAGCTATTTCACTCAG GCCAACCTTTTTCTTGGAGATGATACAAAGGATTGGGTGCATGGAGAAGGATGAGAGTGG GCAGGAGTACCAGAAGGGCGGCTGCGGCGGGTTTGGGAAGGGCAACTTCTCGGAGCTGTT CAAGTCCATTGAGGAGTATGAGAAATCCCTTGAAGCCAAGCAAGCCCCTACAGTTCAAGG ATCCTAGGTAGGAACTGGAGGCCTGGAGCAACAGATGTAACCAGTGTATTTGTATTATGG AGCAGAAGAAAAAAGATGTGCTTTCACTGCTTTGTGATATGTGTCATGCAAGTTGATGTT GTAATTTGTGGAAGCTGAAGACAAATGATGGTACAATCACTGTAATAGATAATAGACATG GATCACATACAAGAATGTAACCTAGTGTTGGCATTGCTGCTGTACAATCTTGCTTGGAAA TAAAATAATAATCAACCTGGAGAAAGAATGTAACCTACTGTTGGCATTGCTGATGTACAA TCTTGCTTGGAAATAAAATAAGAATCAACCAAGAGAATCTGTCCTTGTGATGCTTGTGAT CTTCTGGTGTCTTTTTATTTAACAGAATGTAGTGGTCCTCTGCTGCCTCCAACCGTCCAG GGTAAAAGTGTAAACCGTGGGCTGAGTTACAGCGAATTGCAGTTAGCAATCTGCAAGAGA CAGGGGATGAACAGAGTAAGGTCAATAGTTCAGTGTATGACATGATCATCTTGTTTCGTG GCCTTAAATGGCAAGAAAATGGGCTTGTCAGATCTCAAAGAACTCCTATATGTTAAAAGG CDS (SEQIDNO:2) >LOC_Os02g07160.1(SEQIDNO:2) ATGCCTCCCACTCCCACCCCCACCGCCACCACCGGCGCCGTCTCGGCCGCTGCGGCGGCG GGGGAGAACGCGGGGTTCCGCCTCGTCGGGCACCGCCGCTTCGTCCGCGCCAACCCGCGG AGCGACCGGTTCCAGGCGCTCGCGTTCCACCACGTCGAGCTCTGGTGCGCCGACGCCGCG TCCGCCGCGGGCCGGTTCGCCTTCGCCCTGGGCGCGCCGCTCGCCGCCAGGTCCGACCTC TCCACGGGGAACTCCGCGCACGCCTCCCTCCTCCTCCGCTCCGCCTCCGTCGCGTTCCTC TTCACCGCCCCCTACGGCGGCGACCACGGCGTCGGCGCGGACGCGGCCACCACCGCCTCC ATCCCTTCCTTCTCCCCAGGCGCCGCGCGGAGGTTCGCCGCGGACCACGGCCTCGCGGTG CACGCCGTGGCGCTGCGCGTCGCCGACGCGGCCGACGCCTTCCGCGCCAGCGTCGCGGCC GGTGCGCGCCCGGCGTTCCAGCCCGCCGACCTCGGCGGTGGCTTCGGCCTCGCGGAGGTG GAGCTCTACGGCGACGTCGTGCTCCGCTTCGTCAGCCACCCGGACGGCGCCGACGCGCCC TTCCTCCCGGGTTTCGAGGGCGTCAGCAACCCGGGCGCCGTGGACTACGGCCTCCGCCGG TTCGACCACGTCGTCGGCAACGTGCCGGAGCTCGCTCCGGTAGCCGCGTACATCTCCGGG TTCACCGGGTTCCACGAGTTCGCCGAGTTCACCGCCGAGGACGTGGGCACCGCCGAGAGC GGCCTCAACTCGGTGGTGCTCGCCAACAACGCGGAGACCGTGCTGCTGCCGCTCAACGAG CCGGTGCACGGCACCAAGCGGCGGAGCCAGATACAGACGTACCTGGACCACCACGGCGGC CCGGGGGTGCAGCACATCGCGCTGGCCAGCGACGACGTGCTCGGGACGCTGAGGGAGATG CGGGCGCGCTCCGCCATGGGCGGCTTCGAGTTCTTGGCGCCGCCGCCGCCCAACTACTAC GACGGCGTGCGGCGGCGCGCCGGGGACGTGCTCTCGGAGGAGCAGATCAACGAGTGCCAG GAGCTCGGGGTGCTCGTGGACAGGGATGACCAGGGGGTGTTGCTCCAGATCTTCACCAAG CCAGTAGGAGACAGGCCAACCTTTTTCTTGGAGATGATACAAAGGATTGGGTGCATGGAG AAGGATGAGAGTGGGCAGGAGTACCAGAAGGGCGGCTGCGGCGGGTTTGGGAAGGGCAAC TTCTCGGAGCTGTTCAAGTCCATTGAGGAGTATGAGAAATCCCTTGAAGCCAAGCAAGCC CCTACAGTTCAAGGATCCTAG Protein (SEQIDNO:3) >LOC_Os02g07160.1 MPPTPTPTATTGAVSAAAAAGENAGFRLVGHRRFVRANPRSDRFQALAFHHVELWCADAA SAAGRFAFALGAPLAARSDLSTGNSAHASLLLRSASVAFLFTAPYGGDHGVGADAATTAS IPSFSPGAARRFAADHGLAVHAVALRVADAADAFRASVAAGARPAFQPADLGGGFGLAEV ELYGDVVLRFVSHPDGADAPFLPGFEGVSNPGAVDYGLRRFDHVVGNVPELAPVAAYISG FTGFHEFAEFTAEDVGTAESGLNSVVLANNAETVLLPLNEPVHGTKRRSQIQTYLDHHGG PGVQHIALASDDVLGTLREMRARSAMGGFEFLAPPPPNYYDGVRRRAGDVLSEEQINECQ ELGVLVDRDDQGVLLQIFTKPVGDRPTFFLEMIQRIGCMEKDESGQEYQKGGCGGFGKGN FSELFKSIEEYEKSLEAKQAPTVQGS*

(153) TABLE-US-00003 TABLE 1 Phenotypic characteristics of a mutant rice line showing resistance to mesotrione, with comparison to the original unmutated parent line. Days to 50% Designation Heading Plant Height Plant Type Pubesence Sheath Color Awns TKW, g yield/plant Unmutated 85 96.5 erect glaborous purple inside None 23.15 N/A parent line sheath ML0831266- 82 94 erect glaborous purple inside None 24.55 4.5 03093F2 sheath

(154) TABLE-US-00004 TABLE 2 Numbers of tolerant plants after three different herbicide bioassays applied to an F2 individuals derived from a cross of ML0831266-03093 with tolerance to mesotrione and ML0831265-01493 with tolerance to ACCase herbicides. One application of mesotrione Single application Single application at 105 gai/ha followed of mesotrione at of mesotrione at by second application of 105 gai/ha 420 gai/ha 630 gai/ha Parameters Tolerant Susceptible Tolerant Susceptible Tolerant Susceptible Observed (o) 64 23 26 52 28 67 Expected (e) 21.75 65.25 19.5 58.5 23.75 71.25 Deviation (o e) 42.25 42.25 6.5 6.5 4.25 4.25 Deviation (o e).sup.2 1785.06 1785.06 42.25 42.25 18.06 18.06 (o e).sup.2/e 82 27.35 2.166 0.722 0.76 0.253 Chi-Square Value 109.35 2.88 1.013 Degrees of 1 1 1 freedom (df) Probability value 0.08919242 0.31393809 Critical Chi- 3.84 3.84 3.84 Square value at p = 0.05

(155) TABLE-US-00005 TABLE 3 Markers used in QTL analysis MARKER SEQ ID NO: WG-id11001864 8 WG-id11002275 9 WG-id11003701 10 WG-id11007323 11 WG-wd10001341 12 WG-wd11001701 13 WG-wd2002275 14 WG-wd7000143 15 BG-id10001133 16 BG-id10003147 17 BG-id10004614 18 BG-id1001716 19 BG-id1012406 20 BG-id1015060 21 BG-id1020809 22 BG-id1026723 23 BG-id11000280 24 BG-id11000643 25 BG-id11001000 26 BG-id11003263 27 BG-id11005541 28 BG-id11011578 29 BG-id12001413 30 BG-id12003453 31 BG-id12006669 32 BG-id12010130 33 BG-id2000100 34 BG-id2001406 35 BG-id2002159 36 BG-id2004662 37 BG-id2006793 38 BG-id2008132 39 BG-id2009032 40 BG-id2010498 41 BG-id2012278 42 BG-id2013398 43 BG-id3002278 44 BG-id3006415 45 BG-id3007343 46 BG-id3008063 47 BG-id3008702 48 BG-id3011050 49 BG-id3011406 50 BG-id3015075 51 BG-id4001244 52 BG-id4002084 53 BG-id4004010 54 BG-id4010543 55 BG-id4012206 56 BG-id5003430 57 BG-id5004121 58 BG-id5011704 59 BG-id5014703 60 BG-id6007975 61 BG-id6011524 62 BG-id6016683 63 BG-id6016941 64 BG-id7006069 65 BG-id8000032 66 BG-id8004971 67 BG-id8006271 68 BG-id9003596 69 BG-ud11001609 70 BG-ud7000168 71 BG-ud7000468 72 BG-ud7001467 73 BG-ud9000404 74 BG-ud9000939 75 BG-wd12000096 76 BG-wd5002107 77 BG-wd7000537 78 BG-wd8000300 79 WG-id10000057 80 WG-id1000027 81 WG-id10000678 82 WG-id10005716 83 WG-id10006397 84 WG-id10006890 85 WG-id10007362 86 WG-id1000987 87 WG-id1002788 88 WG-id1003490 89 WG-id1004858 90 WG-id1005915 91 WG-id1006413 92 WG-id1007758 93 WG-id1008433 94 WG-id1011077 95 WG-id1013249 96 WG-id1015747 97 WG-id1019114 98 WG-id1022207 99 WG-id1023338 100 WG-id12004473 101 WG-id12005677 102 WG-id12007189 103 WG-id12008113 104 WG-id12009381 105 WG-id2000711 106 WG-id2003035 107 WG-id2003988 108 WG-id2005453 109 WG-id2005879 110 WG-id2007502 111 WG-id2011561 112 WG-id2011986 113 WG-id2014452 114 WG-id2015344 115 WG-id2016104 116 WG-id3000020 117 WG-id3003557 118 WG-id3003855 119 WG-id3004338 120 WG-id3005216 121 WG-id3005783 122 WG-id3009997 123 WG-id3010769 124 WG-id3013945 125 WG-id3016222 126 WG-id3017628 127 WG-id3018382 128 WG-id4000023 129 WG-id4001471 130 WG-id4002895 131 WG-id4004798 132 WG-id4005527 133 WG-id4005882 134 WG-id4006725 135 WG-id4007645 136 WG-id4008100 137 WG-id4008430 138 WG-id4008947 139 WG-id4009312 140 WG-id4009705 141 WG-id4011039 142 WG-id4011619 143 WG-id4011820 144 WG-id5001055 145 WG-id5002055 146 WG-id5002453 147 WG-id5002782 148 WG-id5004697 149 WG-id5006824 150 WG-id5007247 151 WG-id5007583 152 WG-id5008807 153 WG-id5009334 154 WG-id5010535 155 WG-id6000075 156 WG-id6001960 157 WG-id6002888 158 WG-id6003335 159 WG-id6004012 160 WG-id6004657 161 WG-id6005348 162 WG-id6007016 163 WG-id6010853 164 WG-id6012703 165 WG-id6014165 166 WG-id6016119 167 WG-id7000480 168 WG-id7001929 169 WG-id7002851 170 WG-id7003936 171 WG-id7004491 172 WG-id8000555 173 WG-id8001575 174 WG-id8002235 175 WG-id8005634 176 WG-id8006703 177 WG-id8007014 178 WG-id8007344 179 WG-id8007751 180 WG-id9000056 181 WG-id9002563 182 WG-id9002755 183 WG-id9005502 184 WG-id9006187 185 WG-id9006850 186 WG-id9007344 187 WG-ud1001267 188 WG-ud7000348 189 WG-ud7001018 190 WG-ud7002024 191 WG-id1028225 192 WG-id11000006 193 WG-id11007850 194 WG-id11008114 195 WG-id11009132 196 WG-id12002544 197 WG-id11006215 198 WG-id11002912 199

(156) TABLE-US-00006 TABLE4 SNPmarkers SEQID ID Chromo-some upstreamsequence Allele downstreamsequence NO: WG-id1002788 1 ATGCCCACGGCGGCGGCGGCGGAGGA C/T GTCGGAAATGCCTGCCACGGGCTGTTCC 4 GGAGGAGGAGGAGGAGCTAAGGAGCG CGCAGGTATTGAGAAATGAGCGCTGAG GCGCGGTACGTCGCCGGTGCTGTTCTGC TTCCTGACGCGTTTAAATCCACTGATTA TTTGTAGCCGCTGCTGTCCT GCTGAGTTCCCTTCCAA WG-id1003490 1 GAGAGTGGAGGAGGAGGACGAGTGGA A/G CAAGCAAAGGAAGCAAGCAAAAGAAA 5 GGTGGAGGTGGCGCGCGGCTGCGCGG AAAAGCCCGGGAATTTACCTGGCGGGA TGCGCTTCTTTTTTTTTTCTTTTTTTGTTC ATGCCCTACTTGGCAGCGCCGCCCGTCT CCGCCGCAACCAAAGGAG CTCTCCACAAACGCCCTGC BG-id2004662 2 TTCTATCTCAAGGCGGCAATAGAATCAT C/T GCCAAATGTCTGATGAATTGCTCTTGCT 6 AGATGCTAGAGTCCAGAAGAAGGCCAA CTGATGTTGAGCCCGATGAAGTTGTTAG AGACTTGAAATTTTCAGTTGAGAATGAG CTGCTGAGGACATGATCGGTACCACCTA CAATCCAAGGTGATGCT TATTGACAACCCTGAT WG-id2003988 2 TCAGTGTTCACGGACCCTACATGGAGTT A/G TATCAATCGATCAATCACCAATCGGATG 7 CTCCTAAGTTCAACTACAAGAGACATAG GTACCAAATCCAAAACAACAGTTGGGG CCCATAGGGTAATGCCCTCACTTTCCAG AAAACTGATCCTACCAACCCAGCTCAAC CTCTTTAACTATGGAG TAATTTTGCAGTGCTAC

(157) TABLE-US-00007 TABLE5 UnknownACCasemutation-QTLstartandendSNPmarkersequences SEQ Chromo- ID ID some Upstreamsequence Allele Downstreamsequence NO: id1019752 1 Ataaagatgaggtgtttgatgaattaaaggccgca g/t acagcaactgatgcagctgctgcgaaagcccatat 206 gggttgaagaggccatgtagctttacagatatttc taggcgccagcttcatccagatgtctgttcccagg cagtgaaaatgctttgcttcttgaatttga acaagaatacttctggtcatgaactttttg id1025754 1 tcacatgatctgcaactgtcaacagtcttaccgga t/c gcatgatgtgtctatactctatactgcaaagatga 207 attggattctgaaggtggatactccacctgtccac atactaacaagtttttcttgggcttaaaagaagaa cataagtccttatttgtcagaggttacaat aaactaggaacagcctcactagtttgctag

(158) TABLE-US-00008 TABLE6 ListofmutationsidentifiedinQuizalofopmutant.Thesemutationswereidentifiedusing MutMapmethod(wholegenomesequencing) SEQ Chromo- ID ID some Upstreamsequence Allele Downstreamsequence NO: Chr1Q 1 tgtttcaagtttggttgctgaaaaacgtacggacaaa g/a cttcggtggtttgccaagaacatgaaacctggggataa 208 MM327 ccatgaactaacttgctattttgctccacatgggttt ggatttttttcgactttgctaatgctggtcgtctggat 85958 gtctcgaagcaaccaggaattgatca taggaacagaacaggtattgctac Chr1Q 1 agtctaaatgggctgcactttgattgggctgggttca a/g gggtaaacggtgtgcggacgtgagacgagaaaagcatg 209 MM331 tatgagattaggggaaaaaacacgaacattccagtaa agagaaaacgatctgtgtgcatgcatagggctggacga 47227 aatggggagtgtgaactgtgaagaag aaagctcgtgactcgttagctcgc Chr1Q 1 tagggcttctgatagccctccatctgtccgtcctttg t/c tcttcaactcgattggaacagcaggctccgtgtatgtg 210 MM332 cccgtttgcttcttggcctaaaccaccgaaaaggtgg taactatggctgtgtttagatctaaagtttagattcaa 01871 gtccgttttgctggacgcctggaata agtatagatttaaacttcagtcat Chr1Q 1 tgctgattctcaggctgattctacttggttggtagaa a/g gagaaaactcgctacactttataggaaatgaactactc 211 MM343 aatctacttatccaggaacaagcgtagggtaactttt ttctaccgacggatatcctaaaggctatcctctggtac 74172 cctttttttctcagctatgtgaaaag ctcggccttacgctaactcaaaac Chr1Q 1 cgatcccagggaggttgtggaagtgcttctcatgacc a/g acctgaaggctggtgccatcatgttggccagtaatctg 212 MM344 ttcgaggcactgcggcgtaggcatcttcaattggatg agggctaacattgggaagaggattggagctgtccctgg 82064 agacacaagagactagcaaacgtgca agttgaagtaggggatattttcta Chr1Q 1 aattccaatttcatcccatttgtcccattccctcctg a/g ccctccatcagctgaaaaattaccagaaacaaaatatt 213 MM346 attactttgccaagaaaaataagcctgtggagaattc catctggaaatctgggaaattttcagaacagctcacag 80949 atcagatgcaggaatagtgccagaag gtgatgggcagtcaggcagcaaac Chr1Q 1 gttttggttgctattaatcgattgagcaagtagggga t/c cgattacaccgttgtgttcgtaataattaaatctttac 214 MM349 aatattcctatcatctatgcttcaaataaagttttct aacaagatctcacatgattatattttgatgaaaaatca 76760 cttaaattactcatccgatttacaat caaattacttttatgatatgtcta Chr1Q 1 gtcccgcctggtgacgatttccatgggcattgcgccg a/g agtacacgcgaagactgtaggtagaggtgcttttcccg 215 MM354 actgactgtgtcggcagcatgcatcgtctcgggcgtt cgaaaagtggcagtagcggcggttggacagtaaccttc 98447 caacgtgtggaggggacgacgtataa gtgtatggttgtgtgttcatctca Chr1Q 1 tgcttgtgcgttcactgttcagagaagctggttatcc a/g tcacccagcacaattgactggctgagtgttgcattaag 216 MM357 tccctgataagaacagccgggaggtcagtgtgctatg caaatctggaccggatttgagggaattttctcgcgcag 79866 gttttgtttagttctggaatgatcca tggagatctatgataaatctcgta Chr1Q 1 ctgcttcgccaacggcctcgaggcgaggctggcaggt a/g cgtaccagctttatttggcagcttgcccatttaagaag 217 MM361 actggtagtcaaatttacaagaactacacgataactc atctctcattactttgccaatcaaacaattttgaatgc 60202 ggcttccatgcactgatgtgctgaaa tgtggagaaggccaagaaagttca Chr1Q 1 tcacattctggttgttgagggtccactgataccttta a/g cacagcagcagtacatgcaatgcaagatgcccagatga 218 MM363 cctgttgcagtttattgttttaaataatccaatcaaa tgagaataaaggcaatggcaaaaatataagtgctagtt 86713 cttttgtttgagcttattgctgaata ctatttcaaaataacaaacagaca Chr1Q 1 tatgatgatgcttattatagcctaaggtatgtacttt a/g ccactctacttatgagaagccgggccaccacattcata 219 MM364 taagatttagttcgaagtaatgcccatctggcaagtt cattacagccagaaacaacaaatccaggaagttaatac 47011 aattccagcattaacgtgttctaaaa gtgattaagaatgcatcaaacaag Chr1Q 1 tcgatatgttgggttttttctctttactagtagcatg a/g ctccgaggacgaggaggaggacgactaatttggcagct 220 MM367 ccatctagtgtgcatcttacgtagtggaatattatcg cagctcacctgcacggctgcactgtgctgtgcccggtg 47244 ggcacccaatattcggctcgcacaaa ggcgaagccatttcacccgcgggc Chr1Q 1 tctgaaaacgcatggccgaaataagatgcaagaacac a/g ggaaaaaaacaaaaactaggatgaatgcagtgtcactt 221 MM282 ctgcaaaataatctcaggatcagtccaggtacgcatt tgctgcttgtaattctctgaatttctgaatgaaagaaa 57622 ctctactgttatctactgaaccagag agaaaagaaaagaagcgaaactgg Chr1Q 1 cttaaattctcatgttttattcccgttgcaacgaacg a/g gtgtggcgcctacgtgatcgttggtttgtttcgcttgt 222 MM292 gtcatttcttttagtgtccataaatagctataagagg ttgggcatacagctatgagaactttgttgggggcccat 78751 catcgatcatcgcagcaagccgactg actacttatcatcatgtgtctaat Chr1Q 1 gaactaaacacacccggaatgtgatggatccgaatct a/g aaaaacataggaataagaatcctatgtgaattggtact 223 MM293 gctgtagttgatactgtgaatgtaacttgtaggcctc gttcatccctttgatttgtaggaattgaacaaaggaaa 40100 atttgattttctagaaaaaaatggag agcatggggaaaaaaatcctatga Chr1Q 1 agcgccacgccgcggccagcgccgtggtgttctccgg a/g atccggcggctccacagggccgtcggcaacgcggtcgt 224 MM298 gtggcatcgcttgagctacatcaccaccgatggccac cgacgacaagtacttggtcttcgggaccggctccaccc 75869 ttaaagtccgttgagctcgatcgcca acctgatcaacgcgctggtgtacg Chr1Q 1 acgggcggtaccagctacctgtcacagacatgtgggc c/t tccacgggcgcaccgagcgtccaccgccccccgcgata 225 MM301 ccagcttaacgctaacgcgctgatggccccacatggc tccgggggtttaggcgatatttagccacgagaggggga 73016 agcgacctgccccctctgtccctccg ggggagagtaggagaccgacgctt Chr1Q 1 agaaagacttgctttagctttattgtttcttttccat a/g cacttcaaaagggatgaaggaaagaaggctgtcatatc 226 MM301 attctatattcttgaaaaggactgcaaagctcttcta aattactcaatcatgaccagatcatcgatctgatgcag 98493 gtatatgcaattagctgctttggaag ttaaaaatttcattaattttgcca

(159) TABLE-US-00009 TABLE7 ListofmutationsidentifiedinMesotrionemutant.Mutationswere identifiedthroughMutMapmethod(wholegenomesequencing). SEQ Chromo- ID ID some Upstreamsequence Allele Downstreamsequence NO: Chr1C 1 atcgatgtaattagtgatgtcaatcaatggtccaga a/g Tacagcatattccaaggaatctgtgtgcttcctat 227 MM334 tggcatttggagtcttcgagccttatctttagtgtc caggttttgctggaatggaaaattgtgctggctca 9975 acttgcattttcagttccaaatgaacatctggaaga gttttgctgttccccctacttttcaataaatcagg aggcttggatatctttggaatttcattgataggatg ttcaccttcttttcgcagaccagttgaattttgta aaaatctcttgccgcatgaagcctgacggagtttcc tattctctttacaagcagatgctgaagagtggcct gttagccaaagtggcatcag aataaattatttggtgaaacctcta Chr1C 1 Taaccttatagtgggacaaggactgaaaagcagttc a/g aaatagattttctacaagcacatgatcattggtgg 228 MM356 ctcttgctttaacccagagagggtcaacatttttct gcactgcccacagataaaactagctagctctcggc 8176 ccctgtaagttccaatgctccacaatatttgtatca agtcttacccatgggaaacagtaggatctatcgaa agtgttttgaggttccaggatatgcttcagaatcca aaatcaagcagctgctttgatataactttccaggc ttgctccccatctcaatagaatgcataagctgaaaa agtatagaaatctggcaaagagattagcagctcac ggcaagaaaaagtggaataa ctcagaagtgaaatttggagggcaa Chr1C 1 ccaagcggagacatcgcttccatgagcaattcacgg a/c tgcagcagtcagctcatcagttcttgtaagactca 229 MM405 tttttcactagatctctcacc ctgatcaacacagattgtgcagccactaagttact 2710 ctttctctgatccattctggaccagcctctaatgcg tatactgcattgctatggtgataatttaagggaat tagagcgccaggcgctgcccgatgatggaagcacag gccctggtaaaagattcaagtggatgcgggaaatt ataggtatgttatcttgcactttgagcagctgtgca catgaaactgaaagaactcaatattgactcttaca tgaagaccgtcagcttcgtttgggtgggcaat tcagcattttcaagcctaagcagag Chr1C 1 tttaaatcaaatcttaaaaatataaatcataaataa t/c tttataagtatggagggagtatccatttcacatat 230 MM420 ctatcaagttgttgagtttaaaaatataaaaattat acttatggtcttgtttacatcccaacaaattttag 3161 ataaatatatttgtcttgaaaaatactttcataaaa ccaaaaacatcacatcaaatatttagccacatgta gtatacatatatcactttttaataaatatttttata taggacattaaatataaaaaaacaattacacagtt aaaacaagaagtcaaagttatgttttagagaccgcg tgcatgtaaattgcgagacgaatcttttgagccta tctctgttctaaacgacttc attacgccattatttgacaatgtgg Chr1C 1 cggaactatgactaactcctctccgtaagcttcttt t/c ttccagtgttactcaaaatctagctactggaaaca 231 MM438 gtaatatgtattgctgctgtacttggtctcattatc ataccaatattatagaacaaacagctgatgttatc 8604 tccttacagatatatatacattttttgcagggtata acaaaaatagacaatagtatgagttcaccacggat tccacttcatcttctccgtgacattgagactagggt gagaataacagaaaggaatggtataagggacaaca ttggctcctggccgtggagtcagagagtcagtgtaa ccaccccatcattccatcaacatttgcaactcttt agctgacggagaatatgcac gagtctaatggcgaaggcgtacata Chr1C 1 caactactgacaacaagtgccatgtctaaatttctg t/c caacttttaaaaatgtgggaacaatcaaaccatat 232 MM442 aacatgcacacaacacacaaatgatgaatatggtga gcttgagatatacccacaaagccatcggcggccgc 5961 aaccgcaattagcattagaaagttttaactctagaa ttacagcagagtacaccctcatcttgcacgcctcc atcaatttccaagttgtaatccccatactcccaacc gaagaagcaggagccgtgatcaacacgagcatctt cagaagggaaaaaaaacaactccaaaaccc gtcctgctccaccccacacagtgacgagtctaggg cacgacgaaggcgcgctcctaaacc Chr1C 1 cttcctgtcgtgagtgactgggtggtgggctcaatc t/c tagtgctgttctgaacctcttgcgcatacattaac 233 MM445 ggcctggcccgatacgatgcaagcgcgtggctgggc atgttttatctaatctaataaacatgattaaattt 4432 aggagatcggacggtgctgattgttggggcgacgtg agcgtttgcttttacagtagtagaaatatgaaatt gccgcgtgggcgaatgaatagtgaacagtaccgacg gaacaatggttagtctgaggaatcataagcctatg tgaggtttataggattttatatgactaggggtgaac atctagctggagtcttctccggtttaagctaccaa gttggatagaagggaatgtg ttgaaacatattaattgatgcctga Chr1C 1 aatgtgctcaacttcatatatatgtgtgttgagcac a/g aatattcaactttactcaatgttttgtttaacaag 234 MM449 atagctcatatataagatcaatggttagatcaatgg ttccttttggtcacttgccaatttttctagatcat 6531 tttttgggttagatcaatggttgagcacatagctca acagtacaatctattgatcacaattcacattgaat tatatatgtgtgctcaacggctcacacacaacttca aactaggtcaagccattctgtacatgcccatgcat tatatatgtacccaaaaaagcactattagatcaatg gaacttactgtactaatattatcttagattaattt gttataattgtttcaccacg atcctgaaacttatagtcatatgtg Chr1C 1 gcatgaaagctgagaccatcaccaggttgatcgttg c/ca aaaaaaaagtaacaggtagcagactttcaactaac 235 MM371 ttgctgctattataagatgccaaaatcggcaaatcg ctggcatgaaagcttggattgtcactggtttgatt 4792_ gtcattcactcaaggattggacacaaga gttgctgctgctgttatgaaagctgtata CA-C Chr1C 1 acgttgcttaggtagcaccttgatttaatcaaatgc t/a ttgtacaggagtgtactacatccacatacaatgaa 236 MM393 tagctagttgatgccaggtggcacactgcggacgga cagtagtagtagcagcagctatatactccagttgc 1650_ tttgtttgtcagtttccctgcattacac ctagtcgtacacaaagtataattaatcaca A-T

(160) TABLE-US-00010 TABLE 8 TRAIT SOURCE RESISTANCE/ DESIG- TOLERANCE TO ATCC LINE NATION INHIBITORS DEPOSIT P1003 HPPD (NON- INDUCED) R0146 HPPD SENSITIVE ML0831266- HPPD PTA-13620 03093 (INDUCED + Mar. 19, 2013 NON-INDUCED) ML0831265- 09PM72399 ACCASE PTA-12933 01493 G2096S MUTATION May 31, 2012 ML0831265- ACCASE PTA-13619 02283 (UNKNOWN Mar. 19, 2013 MUTATION) PL1214418M2- ACCASE G2096S PTA-121398 73009 MUTATION Jul. 18, 2014 HPPD (INDUCED + NON-INDUCED) PL1214418M2- ACCASE G2096S PTA-121362 80048 MUTATION Jun. 30, 2014 HPPD (INDUCED + NON-INDUCED) PL1214418M2- ACCASE-G2096S 73001 HPPD (INDUCED) PL1214418M2- ACCASE-G2096S 73013 HPPD (NON- INDUCED)

(161) TABLE-US-00011 TABLE 9 Agronomic characteristics of two lines carrying both HPPD and ACCase resistance/tolerance. Days to 50% Designation Heading Plant Height Plant Type Pubesence Sheath Color Awns yield/plant PL1214418M2- range 56-94 range 57-80 erect to variation of variation None 13.39 gm 80048 cm intermediate glaborous between and smooth green and purple PL1214418M2- 85 range 84-108 erect to variation of variation None NA 73009 cm intermediate glaborous between and smooth green and purple

PUBLICATIONS

(162) All publications cited in this application are herein incorporated by reference Akira, Abe et al., Genome sequencing reveals agronomically important loci in rice using MutMap Nature Biotechnology 30, 174-178 (2012), Published online 22 Jan. 2012. Wright, Mark H. et al., Genome-wide association mapping reveals a rich genetic architecture of complex traits in Oryza sativa. Nat. Comm 2:467|DOI: 10.1038/ncomms1467, Published Online 13 Sep. 2011. The marker information can be accessed from The Rice Diversity Home Page and downloading the file 44K GWAS Data (http://www.ricediversity.org/index.cfm). Zhao, Keyan et al. (2011). Genome-wide association mapping reveals a rich genetic architecture of complex traits in Oryza sativa. Nat Comm 2:467|DOI: 10.1038/ncomms1467, Published Online 13 Sep. 2011