Modified nicotinic compounds and related methods
09994443 ยท 2018-06-12
Assignee
Inventors
Cpc classification
C08G73/0233
CHEMISTRY; METALLURGY
A61K47/59
HUMAN NECESSITIES
B82Y5/00
PERFORMING OPERATIONS; TRANSPORTING
A61K39/0013
HUMAN NECESSITIES
A61K47/60
HUMAN NECESSITIES
C07D401/04
CHEMISTRY; METALLURGY
International classification
B82Y5/00
PERFORMING OPERATIONS; TRANSPORTING
C07D401/04
CHEMISTRY; METALLURGY
A61K47/59
HUMAN NECESSITIES
A61K47/60
HUMAN NECESSITIES
A61K39/00
HUMAN NECESSITIES
Abstract
Provided herein are compounds and related composition and methods that may be used to raise an antibody response to nicotinic compounds, in some embodiments.
Claims
1. A compound comprising: ##STR00046## wherein: P.sub.1 is a polymer comprising monomeric residues of unsubstituted or substituted ethylene oxide, ethylene sulfide and/or ethyleneimine, and copolymers thereof, with the proviso that if R.sub.1 is covalently bound to a methyl residue present at the pyrrolidine nitrogen at position 1 of the nicotine residue, then P.sub.1 is not a polymer comprising 1-40 monomeric residues of unsubstituted ethylene oxide; G comprises oxygen, sulfur, or NR, wherein R comprises alkyl, substituted alkyl, acyl, aryl, or substituted aryl; Q comprises oxygen, sulfur, NH, or NR, wherein R comprises alkyl, substituted alkyl, acyl, aryl, or substituted aryl; R.sub.1 is a linker connecting any atom in the nicotine residue to polymer P.sub.1 through G, wherein R.sub.1 comprises substituted or unsubstituted C1-C18 alkene or alkane, substituted or unsubstituted C1-C18 alkoxy, substituted or unsubstituted alkylamino, substituted or unsubstituted alkylthio, substituted or unsubstituted aryl, substituted or unsubstituted alkylaryl, substituted or unsubstituted heterocycle or substituted or unsubstituted alkylheterocycle; P.sub.2 is a second polymer covalently attached to Q; and n is the number of polymeric moieties of [R.sub.1-G-P.sub.1-Q-P.sub.2] connected to the nicotine residue, wherein n is an integer ranging from 1 to 12, and wherein P.sub.1 and P.sub.2 are different.
2. A method comprising: administering the compound of claim 1 to a subject.
3. A vaccine comprising: the compound of claim 1, and a synthetic nanocarrier.
4. A method comprising: administering the vaccine of claim 3 to a subject.
5. A composition comprising the compound of claim 1 and a pharmaceutically acceptable excipient.
6. The compound of claim 1, wherein P.sub.1 comprises monomeric residues of unsubstituted or substituted ethylene oxide.
7. The compound of claim 6, wherein the ethylene oxide is substituted with C.sub.1-C.sub.6 alkyl or aryl.
8. The compound of claim 1, wherein P.sub.1 comprises monomeric residues of unsubstituted or substituted ethylene sulfide.
9. The compound of claim 8, wherein the ethylene sulfide is substituted with C.sub.1-C.sub.6 alkyl or aryl.
10. The compound of claim 1, wherein P.sub.1 comprises monomeric residues of unsubstituted or substituted ethyleneimine.
11. The compound of claim 10, wherein the ethyleneimine is substituted with C.sub.1-C.sub.6 alkyl or aryl.
12. The compound of claim 1, wherein P.sub.1 possesses a number average molecular weight ranging from 2 kilodalton to 10 kilodalton, as determined by nuclear magnetic resonance.
13. The compound of claim 1, wherein P.sub.2 comprises a biodegradable polymer.
14. The compound of claim 1, wherein P.sub.2 comprises polyester, polyamide, polycarbonates, polyanhydrides, polyketals or co-polymers thereof.
15. The compound of claim 14, wherein the polyester comprises polylactide, polyglycolide, polycaprolactone, polylactide-co-glycolide, or co-polymers thereof.
16. The compound of claim 14, wherein the polyamide comprises polycaprolactam.
17. The compound of claim 1, wherein P.sub.2 possesses a number average molecular weight ranging from 10 kilodaltons to 100 kilodaltons, as determined by nuclear magnetic resonance.
18. The compound of claim 1, wherein G comprises oxygen.
19. The compound of claim 1, wherein G comprises sulfur.
20. The compound of claim 1, wherein G comprises NR.
21. The compound of claim 1, wherein Q comprises oxygen.
22. The compound of claim 1, wherein Q comprises sulfur.
23. The compound of claim 1, wherein Q comprises nitrogen.
24. The compound of claim 1, wherein n is an integer ranging from 1 to 12.
25. The compound of claim 24, wherein n ranges from 1 to 5.
26. The compound of claim 25, wherein n ranges from 1 to 2.
27. The compound of claim 26, wherein n equals 1.
28. The compound of claim 1, wherein R.sub.1 comprises CH.sub.2, G and Q comprise oxygen, P.sub.1 comprises a polymer that comprises monomeric residues of unsubstituted ethylene oxide; P.sub.2 comprises polylactide, and n equals 1.
29. The compound of claim 1, wherein the nicotine residue comprises optically pure (+)-(2R, 3R) or ()-(2S, 3S)- hydroxylmethyl nicotine derivatives.
Description
DETAILED DESCRIPTION OF THE INVENTION
(1) Before describing the present invention in detail, it is to be understood that this invention is not limited to particularly exemplified materials or process parameters as such may, of course, vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments of the invention only, and is not intended to be limiting of the use of alternative terminology to describe the present invention.
(2) All publications, patents and patent applications cited herein, whether supra or infra, are hereby incorporated by reference in their entirety for all purposes.
(3) As used in this specification and the appended claims, the singular forms a, an and the include plural referents unless the content clearly dictates otherwise. For example, reference to a polymer includes a mixture of two or more such molecules or a mixture of differing molecular weights of a single polymer species, reference to a synthetic nanocarrier includes a mixture of two or more such synthetic nanocarriers or a plurality of such synthetic nanocarriers, reference to a DNA molecule includes a mixture of two or more such DNA molecules or a plurality of such DNA molecules, reference to an adjuvant includes a mixture of two or more such materials or a plurality of adjuvant molecules, and the like.
(4) As used herein, the term comprise or variations thereof such as comprises or comprising are to be read to indicate the inclusion of any recited integer (e.g. a feature, element, characteristic, property, method/process step or limitation) or group of integers (e.g. features, element, characteristics, properties, method/process steps or limitations) but not the exclusion of any other integer or group of integers. Thus, as used herein, the term comprising is inclusive and does not exclude additional, unrecited integers or method/process steps.
(5) In embodiments of any of the compositions and methods provided herein, comprising may be replaced with consisting essentially of or consisting of. The phrase consisting essentially of is used herein to require the specified integer(s) or steps as well as those which do not materially affect the character or function of the claimed invention. As used herein, the term consisting is used to indicate the presence of the recited integer (e.g. a feature, element, characteristic, property, method/process step or limitation) or group of integers (e.g. features, element, characteristics, properties, method/process steps or limitations) alone.
(6) The invention will be described in more detail below.
(7) A. Introduction
(8) The inventors have unexpectedly and surprisingly discovered that the problems and limitations noted above can be overcome by practicing the invention disclosed herein. In particular, the inventors have unexpectedly discovered that it is possible to provide compounds, and related methods, that comprise:
(9) ##STR00004##
wherein:
(10) R.sub.1 is a linker connecting any atom in the nicotine residue to G;
(11) G and Q are independently oxygen, sulfur, NH, or NR, wherein R comprises alkyl, substituted alkyl, acyl, aryl, or substituted aryl;
(12) R.sub.2, R.sub.3, R.sub.4, and R.sub.5, independently, are H or an alkyl group; or R.sub.2 and R.sub.3, independently, are oxygen and R.sub.4 and R.sub.5, independently, are H or an alkyl group; or R.sub.4 and R.sub.5, independently, are oxygen and R.sub.2 and R.sub.3, independently, are H or an alkyl group;
(13) m is an integer ranging from 1 to 500; with the proviso that if R.sub.1 is covalently bound to a methyl residue present at the pyrrolidine nitrogen at position 1 of the nicotine residue, then m is an integer ranging from 50-500; and
(14) n is the number of polymeric moieties of
(15) ##STR00005##
connected to the nicotine residue.
(16) In embodiments, R.sub.2, R.sub.3, R.sub.4, and/or R.sub.5, independently, comprise H, substituted or unsubstituted C1-C18 alkene or alkane, substituted or unsubstituted C1-C18 alkoxy, substituted or unsubstituted alkylamino, substituted or unsubstituted alkylthio, substituted or unsubstituted aryl, substituted or unsubstituted alkylaryl, substituted or unsubstituted heterocycle, or substituted or unsubstituted alkylheterocyclic.
(17) Additionally provided are compounds and related methods that comprise:
(18) ##STR00006##
wherein:
(19) P.sub.1 is a polymer comprising monomeric residues of unsubstituted, or C.sub.1-C.sub.6 alkyl or aryl substituted, ethylene oxide, ethylene sulfide and/or ethyleneimine, and copolymers thereof, with the proviso that if R.sub.1 is covalently bound to a methyl residue present at the pyrrolidine nitrogen at position 1 of the nicotine residue, then P.sub.1 is not a polymer comprising 1-40 monomeric residues of unsubstituted ethylene oxide;
(20) G and Q are independently oxygen, sulfur, NH, or NR, wherein R comprises alkyl, substituted alkyl, acyl, aryl, or substituted aryl;
(21) R.sub.1 is a linker connecting any atom in the nicotine residue to polymer P.sub.1 through G;
(22) P.sub.2 is a second polymer covalently attached to Q; and
(23) n is the number of polymeric moieties of [R.sub.1-G-P.sub.1-Q-P.sub.2] connected to the nicotine residue.
(24) Specific embodiments of these compounds, compositions that comprise the compounds, and related methods are disclosed in the Examples.
(25) The invention will now be described in more detail below.
(26) B. Definitions
(27) Adjuvant means an agent that does not constitute a specific antigen, but boosts the strength and longevity of immune response to a concomitantly administered antigen. Such adjuvants may include, but are not limited to stimulators of pattern recognition receptors, such as Toll-like receptors, RIG-1 and NOD-like receptors (NLR), mineral salts, such as alum, alum combined with monphosphoryl lipid (MPL) A of Enterobacteria, such as Escherihia coli, Salmonella minnesota, Salmonella typhimurium, or Shigella flexneri or specifically with MPL (AS04), MPL A of above-mentioned bacteria separately, saponins, such as QS-21, Quil-A, ISCOMs, ISCOMATRIX, emulsions such as MF59 Montanide ISA 51 and ISA 720, AS02 (QS21+squalene+MPL), liposomes and liposomal formulations such as AS01, synthesized or specifically prepared microparticles and microcarriers such as bacteria-derived outer membrane vesicles (OMV) of N. gonorrheae, Chlamydia trachomatis and others, or chitosan particles, depot-forming agents, such as Pluronic block co-polymers, specifically modified or prepared peptides, such as muramyl dipeptide, aminoalkyl glucosaminide 4-phosphates, such as RC529, or proteins, such as bacterial toxoids or toxin fragments.
(28) In embodiments, adjuvants comprise agonists for pattern recognition receptors (PRR), including, but not limited to Toll-Like Receptors (TLRs), specifically TLRs 2, 3, 4, 5, 7, 8, 9 and/or combinations thereof. In other embodiments, adjuvants comprise agonists for Toll-Like Receptors 3, agonists for Toll-Like Receptors 7 and 8, or agonists for Toll-Like Receptor 9; preferably the recited adjuvants comprise imidazoquinolines; such as R848; adenine derivatives, such as those disclosed in U.S. Pat. No. 6,329,381 (Sumitomo Pharmaceutical Company), US Published Patent Application 2010/0075995 to Biggadike et al., or WO 2010/018132 to Campos et al.; immunostimulatory DNA; or immunostimulatory RNA. In specific embodiments, synthetic nanocarriers incorporate as adjuvants compounds that are agonists for toll-like receptors (TLRs) 7 & 8 (TLR 7/8 agonists). Of utility are the TLR 7/8 agonist compounds disclosed in U.S. Pat. No. 6,696,076 to Tomai et al., including but not limited to imidazoquinoline amines, imidazopyridine amines, 6,7-fused cycloalkylimidazopyridine amines, and 1,2-bridged imidazoquinoline amines. Preferred adjuvants comprise imiquimod and resiquimod (also known as R848). In specific embodiments, an adjuvant may be an agonist for the DC surface molecule CD40. In certain embodiments, to stimulate immunity rather than tolerance, a synthetic nanocarrier incorporates an adjuvant that promotes DC maturation (needed for priming of naive T cells) and the production of cytokines, such as type I interferons, which promote antibody immune responses. In embodiments, adjuvants also may comprise immunostimulatory RNA molecules, such as but not limited to dsRNA, poly I:C or poly I:poly C12U (available as Ampligen, both poly I:C and poly I:C12U being known as TLR3 stimulants), and/or those disclosed in F. Heil et al., Species-Specific Recognition of Single-Stranded RNA via Toll-like Receptor 7 and 8 Science 303(5663), 1526-1529 (2004); J. Vollmer et al., Immune modulation by chemically modified ribonucleosides and oligoribonucleotides WO 2008033432 A2; A. Forsbach et al., Immunostimulatory oligoribonucleotides containing specific sequence motif(s) and targeting the Toll-like receptor 8 pathway WO 2007062107 A2; E. Uhlmann et al., Modified oligoribonucleotide analogs with enhanced immunostimulatory activity U.S. Pat. Appl. Publ. US 2006241076; G. Lipford et al., Immunostimulatory viral RNA oligonucleotides and use for treating cancer and infections WO 2005097993 A2; G. Lipford et al., Immunostimulatory G,U-containing oligoribonucleotides, compositions, and screening methods WO 2003086280 A2. In some embodiments, an adjuvant may be a TLR-4 agonist, such as bacterial lipopolysacccharide (LPS), VSV-G, and/or HMGB-1. In some embodiments, adjuvants may comprise TLR-5 agonists, such as flagellin, or portions or derivatives thereof, including but not limited to those disclosed in U.S. Pat. Nos. 6,130,082, 6,585,980, and 7,192,725. In specific embodiments, synthetic nanocarriers incorporate a ligand for Toll-like receptor (TLR)-9, such as immunostimulatory DNA molecules comprising CpGs, which induce type I interferon secretion, and stimulate T and B cell activation leading to increased antibody production and cytotoxic T cell responses (Krieg et al., CpG motifs in bacterial DNA trigger direct B cell activation. Nature. 1995. 374:546-549; Chu et al. CpG oligodeoxynucleotides act as adjuvants that switch on T helper 1 (Th1) immunity. J. Exp. Med. 1997. 186:1623-1631; Lipford et al. CpG-containing synthetic oligonucleotides promote B and cytotoxic T cell responses to protein antigen: a new class of vaccine adjuvants. Eur. J. Immunol. 1997. 27:2340-2344; Roman et al. Immunostimulatory DNA sequences function as T helper-1-promoting adjuvants. Nat. Med. 1997. 3:849-854; Davis et al. CpG DNA is a potent enhancer of specific immunity in mice immunized with recombinant hepatitis B surface antigen. J. Immunol. 1998. 160:870-876; Lipford et al., Bacterial DNA as immune cell activator. Trends Microbiol. 1998. 6:496-500; U.S. Pat. No. 6,207,646 to Krieg et al.; U.S. Pat. No. 7,223,398 to Tuck et al.; U.S. Pat. No. 7,250,403 to Van Nest et al.; or U.S. Pat. No. 7,566,703 to Krieg et al.
(29) In some embodiments, adjuvants may be proinflammatory stimuli released from necrotic cells (e.g., urate crystals). In some embodiments, adjuvants may be activated components of the complement cascade (e.g., CD21, CD35, etc.). In some embodiments, adjuvants may be activated components of immune complexes. The adjuvants also include complement receptor agonists, such as a molecule that binds to CD21 or CD35. In some embodiments, the complement receptor agonist induces endogenous complement opsonization of the synthetic nanocarrier. In some embodiments, adjuvants are cytokines, which are small proteins or biological factors (in the range of 5 kD-20 kD) that are released by cells and have specific effects on cell-cell interaction, communication and behavior of other cells. In some embodiments, the cytokine receptor agonist is a small molecule, antibody, fusion protein, or aptamer.
(30) In embodiments, at least a portion of the dose of adjuvant may be coupled to synthetic nanocarriers, preferably, all of the dose of adjuvant is coupled to synthetic nanocarriers. In other embodiments, at least a portion of the dose of the adjuvant is not coupled to the synthetic nanocarriers. In embodiments, the dose of adjuvant comprises two or more types of adjuvants. For instance, and without limitation, adjuvants that act on different TLR receptors may be combined. As an example, in an embodiment a TLR 7/8 agonist may be combined with a TLR 9 agonist. In another embodiment, a TLR 7/8 agonist may be combined with a TLR 4 agonist. In yet another embodiment, a TLR 9 agonist may be combined with a TLR 3 agonist.
(31) Administering or administration means providing a drug to a subject in a manner that is pharmacologically useful.
(32) Antigen means a B cell antigen or T cell antigen. In embodiments, antigens are coupled to the synthetic nanocarriers. In other embodiments, antigens are not coupled to the synthetic nanocarriers. In embodiments antigens are coadministered with the synthetic nanocarriers. In other embodiments antigens are not coadministered with the synthetic nanocarriers. Type(s) of antigens means molecules that share the same, or substantially the same, antigenic characteristics.
(33) B cell antigen means any antigen that is or recognized by and triggers an immune response in a B cell (e.g., an antigen that is specifically recognized by a B cell receptor on a B cell). In some embodiments, an antigen that is a T cell antigen is also a B cell antigen. In other embodiments, the T cell antigen is not also a B cell antigen. B cell antigens include, but are not limited to proteins, peptides, small molecules, and carbohydrates. In some embodiments, the B cell antigen comprises a non-protein antigen (i.e., not a protein or peptide antigen). In some embodiments, the B cell antigen comprises a carbohydrate associated with an infectious agent. In some embodiments, the B cell antigen comprises a glycoprotein or glycopeptide associated with an infectious agent. The infectious agent can be a bacterium, virus, fungus, protozoan, or parasite. In some embodiments, the B cell antigen comprises a poorly immunogenic antigen. In some embodiments, the B cell antigen comprises an abused substance or a portion thereof. In some embodiments, the B cell antigen comprises an addictive substance or a portion thereof. Addictive substances include, but are not limited to, nicotine, a narcotic, a cough suppressant, a tranquilizer, and a sedative. In some embodiments, the B cell antigen comprises a toxin, such as a toxin from a chemical weapon or natural sources. The B cell antigen may also comprise a hazardous environmental agent. In some embodiments, the B cell antigen comprises a self antigen. In other embodiments, the B cell antigen comprises an alloantigen, an allergen, a contact sensitizer, a degenerative disease antigen, a hapten, an infectious disease antigen, a cancer antigen, an atopic disease antigen, an autoimmune disease antigen, an addictive substance, a xenoantigen, or a metabolic disease enzyme or enzymatic product thereof.
(34) Couple or Coupled or Couples (and the like) means to chemically associate one entity (for example a moiety) with another. In some embodiments, the coupling is covalent, meaning that the coupling occurs in the context of the presence of a covalent bond between the two entities. In non-covalent embodiments, the non-covalent coupling is mediated by non-covalent interactions including but not limited to charge interactions, affinity interactions, metal coordination, physical adsorption, host-guest interactions, hydrophobic interactions, TT stacking interactions, hydrogen bonding interactions, van der Waals interactions, magnetic interactions, electrostatic interactions, dipole-dipole interactions, and/or combinations thereof. In embodiments, encapsulation is a form of coupling.
(35) Dosage form means a pharmacologically and/or immunologically active material in a medium, carrier, vehicle, or device suitable for administration to a subject.
(36) Encapsulate means to enclose at least a portion of a substance within a synthetic nanocarrier. In some embodiments, a substance is enclosed completely within a synthetic nanocarrier. In other embodiments, most or all of a substance that is encapsulated is not exposed to the local environment external to the synthetic nanocarrier. In other embodiments, no more than 50%, 40%, 30%, 20%, 10% or 5% is exposed to the local environment. Encapsulation is distinct from absorption, which places most or all of a substance on a surface of a synthetic nanocarrier, and leaves the substance exposed to the local environment external to the synthetic nanocarrier.
(37) Linker means a moiety that connects two chemical components together through either single covalent bonds or multiple covalent bonds.
(38) Maximum dimension of a synthetic nanocarrier means the largest dimension of a nanocarrier measured along any axis of the synthetic nanocarrier. Minimum dimension of a synthetic nanocarrier means the smallest dimension of a synthetic nanocarrier measured along any axis of the synthetic nanocarrier. For example, for a spheriodal synthetic nanocarrier, the maximum and minimum dimension of a synthetic nanocarrier would be substantially identical, and would be the size of its diameter. Similarly, for a cuboidal synthetic nanocarrier, the minimum dimension of a synthetic nanocarrier would be the smallest of its height, width or length, while the maximum dimension of a synthetic nanocarrier would be the largest of its height, width or length. In an embodiment, a minimum dimension of at least 75%, preferably at least 80%, more preferably at least 90%, of the synthetic nanocarriers in a sample, based on the total number of synthetic nanocarriers in the sample, is greater than 100 nm. In an embodiment, a maximum dimension of at least 75%, preferably at least 80%, more preferably at least 90%, of the synthetic nanocarriers in a sample, based on the total number of synthetic nanocarriers in the sample, is equal to or less than 5 m. Preferably, a minimum dimension of at least 75%, preferably at least 80%, more preferably at least 90%, of the synthetic nanocarriers in a sample, based on the total number of synthetic nanocarriers in the sample, is greater than 110 nm, more preferably greater than 120 nm, more preferably greater than 130 nm, and more preferably still greater than 150 nm. Aspects ratios of the maximum and minimum dimensions of inventive synthetic nanocarriers may vary depending on the embodiment. For instance, aspect ratios of the maximum to minimum dimensions of the synthetic nanocarriers may vary from 1:1 to 1,000,000:1, preferably from 1:1 to 100,000:1, more preferably from 1:1 to 1000:1, still more preferably from 1:1 to 100:1, and yet more preferably from 1:1 to 10:1. Preferably, a maximum dimension of at least 75%, preferably at least 80%, more preferably at least 90%, of the synthetic nanocarriers in a sample, based on the total number of synthetic nanocarriers in the sample is equal to or less than 3 m, more preferably equal to or less than 2 m, more preferably equal to or less than 1 m, more preferably equal to or less than 800 nm, more preferably equal to or less than 600 nm, and more preferably still equal to or less than 500 nm. In preferred embodiments, a maximum dimension of at least 75%, preferably at least 80%, more preferably at least 90%, of the synthetic nanocarriers in a sample, based on the total number of synthetic nanocarriers in the sample, is equal to or greater than 100 nm, more preferably equal to or greater than 120 nm, more preferably equal to or greater than 130 nm, more preferably equal to or greater than 140 nm, and more preferably still equal to or greater than 150 nm. Measurement of synthetic nanocarrier sizes is obtained by suspending the synthetic nanocarriers in a liquid (usually aqueous) media and using dynamic light scattering (DLS) (e.g. using a Brookhaven ZetaPALS instrument). For example, a suspension of synthetic nanocarriers can be diluted from an aqueous buffer into purified water to achieve a final synthetic nanocarrier suspension concentration of approximately 0.01 to 0.1 mg/mL. The diluted suspension may be prepared directly inside, or transferred to, a suitable cuvette for DLS analysis. The cuvette may then be placed in the DLS, allowed to equilibrate to the controlled temperature, and then scanned for sufficient time to aquire a stable and reproducible distribution based on appropriate inputs for viscosity of the medium and refractive indicies of the sample. The effective diameter, or mean of the distribution, is then reported.
(39) Pharmaceutically acceptable excipient means a pharmacologically inactive material used together with the recited synthetic nanocarriers to formulate the inventive compositions. Pharmaceutically acceptable excipients comprise a variety of materials known in the art, including but not limited to saccharides (such as glucose, lactose, and the like), preservatives such as antimicrobial agents, reconstitution aids, colorants, saline (such as phosphate buffered saline), and buffers.
(40) Release or Release Rate means the rate that an entrapped substance transfers from a synthetic nanocarrier into local environment, such as a surrounding release media. First, the synthetic nanocarrier is prepared for the release testing by placing into the appropriate release media. This is generally done by exchanging a buffer after centrifugation to pellet the synthetic nanocarrier and reconstitution of the synthetic nanocarriers under a mild condition. The assay is started by placing the sample at 37 C. in an appropriate temperature-controlled apparatus. A sample is removed at various time points.
(41) The synthetic nanocarriers are separated from the release media by centrifugation to pellet the synthetic nanocarriers. The release media is assayed for the substance that has been released from the synthetic nanocarriers. The substance is measured using HPLC to determine the content and quality of the substance. The pellet containing the remaining entrapped substance is dissolved in solvents or hydrolyzed by base to free the entrapped substance from the synthetic nanocarriers. The pellet-contained substance is then also measured by HPLC after dissolution or destruction of the pellet to determine the content and quality of the substance that has not been released at a given time point.
(42) The mass balance is closed between substance that has been released into the release media and what remains in the synthetic nanocarriers. Data are presented as the fraction released or as the net release presented as micrograms released over time.
(43) Subject means animals, including warm blooded mammals such as humans and primates; avians; domestic household or farm animals such as cats, dogs, sheep, goats, cattle, horses and pigs; laboratory animals such as mice, rats and guinea pigs; fish; reptiles; zoo and wild animals; and the like.
(44) Synthetic nanocarrier(s) means a discrete object that is not found in nature, and that possesses at least one dimension that is less than or equal to 5 microns in size. Albumin nanoparticles are generally included as synthetic nanocarriers, however in certain embodiments the synthetic nanocarriers do not comprise albumin nanoparticles. In embodiments, inventive synthetic nanocarriers do not comprise chitosan.
(45) A synthetic nanocarrier can be, but is not limited to, one or a plurality of lipid-based nanoparticles, polymeric nanoparticles, metallic nanoparticles, surfactant-based emulsions, dendrimers, buckyballs, nanowires, virus-like particles, peptide or protein-based particles (such as albumin nanoparticles) and/or nanoparticles that are developed using a combination of nanomaterials such as lipid-polymer nanoparticles. Synthetic nanocarriers may be a variety of different shapes, including but not limited to spheroidal, cuboidal, pyramidal, oblong, cylindrical, toroidal, and the like. Synthetic nanocarriers according to the invention comprise one or more surfaces. Exemplary synthetic nanocarriers that can be adapted for use in the practice of the present invention comprise: (1) the biodegradable nanoparticles disclosed in U.S. Pat. No. 5,543,158 to Gref et al., (2) the polymeric nanoparticles of Published US Patent Application 20060002852 to Saltzman et al., (3) the lithographically constructed nanoparticles of Published US Patent Application 20090028910 to DeSimone et al., (4) the disclosure of WO 2009/051837 to von Andrian et al., (5) the nanoparticles disclosed in Published US Patent Application 2008/0145441 to Penades et al, (6) the protein nanoparticles disclosed in Published US Patent Application 20090226525 to de los Rios et al., (7) the virus-like particles disclosed in published US Patent Application 20060222652 to Sebbel et al., (8) the nucleic acid coupled virus-like particles disclosed in published US Patent Application 20060251677 to Bachmann et al., (9) the virus-like particles disclosed in WO2010047839A1 or WO2009106999A2, or (10) the nanoprecipitated nanoparticles disclosed in P. Paolicelli et al., Surface-modified PLGA-based Nanoparticles that can Efficiently Associate and Deliver Virus-like Particles Nanomedicine. 5(6):843-853 (2010). In embodiments, synthetic nanocarriers may possess an aspect ratio greater than 1:1, 1:1.2, 1:1.5, 1:2, 1:3, 1:5, 1:7, or greater than 1:10.
(46) Synthetic nanocarriers according to the invention that have a minimum dimension of equal to or less than about 100 nm, preferably equal to or less than 100 nm, do not comprise a surface with hydroxyl groups that activate complement or alternatively comprise a surface that consists essentially of moieties that are not hydroxyl groups that activate complement. In a preferred embodiment, synthetic nanocarriers according to the invention that have a minimum dimension of equal to or less than about 100 nm, preferably equal to or less than 100 nm, do not comprise a surface that substantially activates complement or alternatively comprise a surface that consists essentially of moieties that do not substantially activate complement. In a more preferred embodiment, synthetic nanocarriers according to the invention that have a minimum dimension of equal to or less than about 100 nm, preferably equal to or less than 100 nm, do not comprise a surface that activates complement or alternatively comprise a surface that consists essentially of moieties that do not activate complement. In embodiments, synthetic nanocarriers exclude virus-like particles. In embodiments, when synthetic nanocarriers comprise virus-like particles, the virus-like particles comprise non-natural adjuvant (meaning that the VLPs comprise an adjuvant other than naturally occurring RNA generated during the production of the VLPs). In embodiments, synthetic nanocarriers may possess an aspect ratio greater than 1:1, 1:1.2, 1:1.5, 1:2, 1:3, 1:5, 1:7, or greater than 1:10.
(47) T cell antigen means any antigen that is recognized by and triggers an immune response in a T cell (e.g., an antigen that is specifically recognized by a T cell receptor on a T cell or an NKT cell via presentation of the antigen or portion thereof bound to a Class I or Class II major histocompatability complex molecule (MHC), or bound to a CD1 complex). In some embodiments, an antigen that is a T cell antigen is also a B cell antigen. In other embodiments, the T cell antigen is not also a B cell antigen. T cell antigens generally are proteins or peptides. T cell antigens may be an antigen that stimulates a CD8+ T cell response, a CD4+ T cell response, or both. The nanocarriers, therefore, in some embodiments can effectively stimulate both types of responses.
(48) In some embodiments the T cell antigen is a T helper cell antigen (i.e. one that can generate an enhanced response to a B cell antigen, preferably an unrelated B cell antigen, through stimulation of T cell help). In embodiments, a T helper cell antigen may comprise one or more peptides obtained or derived from tetanus toxoid, Epstein-Barr virus, influenza virus, respiratory syncytial virus, measles virus, mumps virus, rubella virus, cytomegalovirus, adenovirus, diphtheria toxoid, or a PADRE peptide (known from the work of Sette et al. U.S. Pat. No. 7,202,351). In other embodiments, a T helper cell antigen may comprise one or more lipids, or glycolipids, including but not limited to: -galactosylceramide (-GalCer), -linked glycosphingolipids (from Sphingomonas spp.), galactosyl diacylglycerols (from Borrelia burgdorferi), lypophosphoglycan (from Leishmania donovani), and phosphatidylinositol tetramannoside (PIM4) (from Mycobacterium leprae). For additional lipids and/or glycolipids useful as a T helper cell antigen, see V. Cerundolo et al., Harnessing invariant NKT cells in vaccination strategies. Nature Rev Immun, 9:28-38 (2009). In embodiments, CD4+ T-cell antigens may be derivatives of a CD4+ T-cell antigen that is obtained from a source, such as a natural source. In such embodiments, CD4+ T-cell antigen sequences, such as those peptides that bind to MHC II, may have at least 70%, 80%, 90%, or 95% identity to the antigen obtained from the source. In embodiments, the T cell antigen, preferably a T helper cell antigen, may be coupled to, or uncoupled from, a synthetic nanocarrier.
(49) Vaccine means a composition of matter that improves the immune response to a particular pathogen or disease. A vaccine typically contains factors that stimulate a subject's immune system to recognize a specific antigen as foreign and eliminate it from the subject's body. A vaccine also establishes an immunologic memory so the antigen will be quickly recognized and responded to if a person is re-challenged. Vaccines can be prophylactic (for example to prevent future infection by any pathogen), or therapeutic (for example a vaccine against a tumor specific antigen for the treatment of cancer). In embodiments, a vaccine may comprise dosage forms according to the invention.
(50) C. Inventive Compounds and Methods of Making and Using the Compounds
(51) In embodiments, the invention provides for compounds of Formula I:
(52) ##STR00007##
wherein:
(53) R.sub.1 is a linker connecting any atom in the nicotine residue to G;
(54) G and Q are independently oxygen, sulfur, NH, or NR, wherein R comprises alkyl, substituted alkyl, acyl, aryl, or substituted aryl;
(55) R2, R3, R4, and R5, independently, are H or an alkyl group; or R2 and R3, independently, are oxygen and R4 and R5, independently, are H or an alkyl group; or R4 and R5, independently, are oxygen and R2 and R3, independently, are H or an alkyl group;
(56) m is an integer ranging from 1 to 500; with the proviso that if R.sub.1 is covalently bound to a methyl residue present at the pyrrolidine nitrogen at position 1 of the nicotine residue, then m is an integer ranging from 50-500; and
(57) n is the number of polymeric moieties of
(58) ##STR00008##
connected to the nicotine residue.
(59) In embodiments, R.sub.1 is either absent or comprises substituted or unsubstituted C1-C18 alkene or alkane, substituted or unsubstituted C1-C18 alkoxy, substituted or unsubstituted alkylamino, substituted or unsubstituted alkylthio, substituted or unsubstituted aryl, substituted or unsubstituted alkylaryl, substituted or unsubstituted heterocycle or substituted or unsubstituted alkylheterocycle.
(60) In embodiments, R.sub.2, R.sub.3, R.sub.4, and/or R.sub.5, independently, comprise H, substituted or unsubstituted C1-C18 alkene or alkane, substituted or unsubstituted C1-C18 alkoxy, substituted or unsubstituted alkylamino, substituted or unsubstituted alkylthio, substituted or unsubstituted aryl, substituted or unsubstituted alkylaryl, substituted or unsubstituted heterocycle, or substituted or unsubstituted alkylheterocyclic.
(61) In embodiments, m ranges from 20 to 500, preferably m ranges from 50 to 500, more preferably m ranges from 100 to 500, and still more preferably m ranges from 200 to 500. Measurement of the polymeric portion molecular weight, and some effects of varying molecular weight, is generally discussed elsewhere herein. In embodiments, n is an integer ranging from 1 to 12, preferably n ranges from 1 to 5, more preferably n ranges from 1 to 2, and still more preferably n equals 1.
(62) In a preferred embodiment, an inventive compound of Formula I is contemplated, wherein R.sub.1 comprises C.sub.1-C.sub.6, G and Q comprise oxygen; R.sub.2, R.sub.3, R.sub.4, and R.sub.5 comprise hydrogen, m ranges from 45 to 180, and n equals 1.
(63) Compounds useful for initiating ring opening polymerization of epoxides, thioepoxides and ethyleneimines or oxazolines include, but are not limited to 1-hydroxyalkylnicotine such as 1-hydroxyethylnicotine, 1-hydroxybutylnicotine, 3-hydroxyalkylnicotine such as 3-hydroxymethylnicotine, 4-hydroxyalkylnicotine such as 4-hydroxymethylnicotine and 4-hydroxyethylnicotine, 5-hydroxyalkylnicotine such as 5-hydroxypropyl nicotine, 2-hydroxyalkylnicotine such as 2-hydroxymethylnicotine, 4-hydroxyalkylnicotine such as 4-hydroxymethylnicotine, 6-hydroxyalkylnicotine such as 6-hydroxymethylnicotine, 6-hydroxyethylnicotine, and 6-hydroxypropyl nicotine. The syntheses of these compounds are described in this application and in a paper by Seeman, et al, [Journal of Organic Chemistry, 51, 1548, (1986)]. In addition, the amino and mercapto analogs of these compounds can also function as initiators. In embodiments, the nicotine residue may comprise optically pure enantiomers, such as (+)-(2R, 3R) or ()-(2S, 3S)-hydroxylmethyl nicotine derivatives. In other embodiments, the nicotine residue may comprise a racemic mixture. The optically pure enantiomers may be separated from one another using chiral separation techniques, for instance using a chiral separation column such as a Chiral Daicel IC column.
(64) Many epoxides, thioepoxides, ethyleneimines and oxazolines will undergo ring opening polymerization when initiated, under various conditions known to those skilled in the art, by a hydroxyalkylnicotine, a thioalkylnicotine or aminoalkylnicotine. Commonly available epoxides suitable for polymerization in the practice of the present invention, include but are not limited to; ethylene oxide, propylene oxide glycidyl methyl ether, 2,2,3,3-tetramethyloxirane, 3,3,3-Trifluoro-1,2-epoxypropane, styrene oxide, cyclooctene oxide, 1,2-epoxyoctane, tert-Butyl glycidyl ether, 4-Fluorophenyloxirane, Glycidaldehyde diethyl acetal, Phenyl glycidyl ether, Benzyl glycidyl ether, cis, and trans-Stilbene oxide, and many others. Commonly available thiiranes suitable for polymerization in the practice of the present invention, include but are not limited to; ethylene sulfide, propylene sulfide, Cyclohexene sulfide, 1,2-Epithiooctane, 1,2-Epithiododecane, 4-phenoxyphenyl 2-thiiranylmethyl sulfone and many others. Commonly available ethyleneimines and oxazolines suitable for polymerization in the practice of the present invention, include but are not limited to; aziridine, 2-methylaziridine, 1-(benzylsulfonyl)aziridine, 1-(toluene-3-sulfonyl)aziridine, 2-phenylaziridine, 2,3-diphenylaziridine, 1-methylaziridine, 1-phenylaziridine, 2-ethyl-2-oxazoline, 2-methyl2-oxazoline 2-phenyl-2-oxazoline, 4,4-Dimethyl-2-phenyl-2-oxazoline, 3-(4,4-dimethyl-4,5-dihydro-1,3-oxazol-2-yl)pyridine, and many others.
(65) Polymers as covered by Formula I are made by ring opening polymerization of epoxides, thioepoxides, aziridines or 2-alkyl-2-oxazolines. The actual conditions used depend on the particular polymer of Formula I to be synthesized. For example, epoxide and thioepoxide polymerizations are typically initiated with an anionic compound. For compounds of Formula I, a nicotine compound with an alcohol containing substituent can be converted to the alkoxide by reaction with a strong base. This nicotine alkoxide may then used to initiate ring opening polymerization of an amount of epoxide or thioepoxide chosen to provide the nicotine substituted polyether or polythioether of a particular molecular weight. Polyacylethylenimines may be formed by ring opening polymerization of 2-alkyl-2-oxazolines using a cationic initiator or alkylating agent. For compounds of Formula I, a nicotine compound with an alcohol containing substituent may be converted to a halide or sulfonate ester. This alkylating agent may then be used to initiate ring opening polymerization of an amount of 2-alkyl-2-oxazoline chosen to provide the nicotine substituted polyacylethylenimines of a particular molecular weight.
(66) In embodiments, a compound of Formula II is provided:
(67) ##STR00009##
wherein:
(68) P.sub.1 is a polymer comprising monomeric residues of unsubstituted, or C.sub.1-C.sub.6 alkyl or aryl substituted, ethylene oxide, ethylene sulfide and/or ethyleneimine, and copolymers thereof, with the proviso that if R.sub.1 is covalently bound to a methyl residue present at the pyrrolidine nitrogen at position 1 of the nicotine residue, then P.sub.1 is not a polymer comprising 1-40 monomeric residues of unsubstituted ethylene oxide;
(69) G and Q are independently oxygen, sulfur, NH, or NR, wherein R comprises alkyl, substituted alkyl, acyl, aryl, or substituted aryl;
(70) R.sub.1 is a linker connecting any atom in the nicotine residue to polymer P.sub.1 through G;
(71) P.sub.2 is a second polymer covalently attached to Q; and
(72) n is the number of polymeric moieties of [R.sub.1-G-P.sub.1-Q-P.sub.2] connected to the nicotine residue.
(73) In embodiments, R.sub.1 is either absent or comprises substituted or unsubstituted C1-C18 alkene or alkane, substituted or unsubstituted C1-C18 alkoxy, substituted or unsubstituted alkylamino, substituted or unsubstituted alkylthio, substituted or unsubstituted aryl, substituted or unsubstituted alkylaryl, substituted or unsubstituted heterocycle or substituted or unsubstituted alkylheterocycle.
(74) In embodiments, P.sub.2 comprises a biodegradable polymer. In embodiments, the biodegradable polymer comprises polyester, polyamide, polycarbonates, polyanhydrides, polyketals or co-polymers thereof. In embodiments, the polyester comprises polylactide, polyglycolide, polycaprolactone, polylactide-co-glycolide, or co-polymers thereof; the polyamide comprises polycaprolactam.
(75) In embodiments, the molecular weight of the polymeric portions of compounds of Formula I or Formula II may be varied. In embodiments, the molecular weights of P.sub.1 and P.sub.2 may be adjusted to maximize the ability of the inventive compounds to self-assemble during a typical emulsion process and to form nanoparticles. In embodiments, P.sub.1 possesses a number average molecular weight ranging from 2 kilodaltons to 10 kilodaltons, preferably P.sub.1 possesses a number average molecular weight ranging from 3 kilodaltons to 6 kilodaltons, as determined by nuclear magnetic resonance. In embodiments, P.sub.2 possesses a number average molecular weight ranging from 10 kilodaltons to 100 kilodaltons, P.sub.2 possesses a number average molecular weight ranging from 15 kilodaltons to 30 kilodaltons, preferably as determined by nuclear magnetic resonance. For example, number average molecular weight can be determined by proton NMR wherein the ratio of the polymer repeating units to the end group is established and then multiplied by theoretical repeating unit molecular weight. Alternatively, in the case of a titratable (e.g., acid or base) end group polymer, a known weight concentration may be established and then titrated in the presence of an indicator dye with an appropriate neutralizing agent of known molar concentration to provide moles of end group per mass of polymer. Polymer number average molecular weights can also be determined using conventional NMR techniques, such as those generally explained at sigmaaldrich.com/materials-science/polymer-science/polymer-analysis.html. Any of the molecular weights of the polymers provided herein may be a number average molecular weight.
(76) In embodiments, n is an integer ranging from 1 to 12, preferably n ranges from 1 to 5, more preferably n ranges from 1 to 2, and still more preferably n equals 1.
(77) In a preferred embodiment, the invention provides a compound of Formula II, wherein R.sub.1 comprises CH.sub.2, G and Q comprise oxygen, P.sub.1 comprises a polymer that comprises monomeric residues of unsubstituted ethylene oxide; P.sub.2 comprises polylactide, and n equals 1.
(78) With respect to Formula II, compounds useful for initiating ring opening polymerization of epoxides, thioepoxides and ethyleneimines or oxazolines include, but are not limited to 1-hydroxyalkylnicotine such as 1-hydroxyethylnicotine, 1-hydroxybutylnicotine, 3-hydroxyalkylnicotine such as 3-hydroxymethylnicotine, 4-hydroxyalkylnicotine such as 4-hydroxymethylnicotine and 4-hydroxyethylnicotine, 5-hydroxyalkylnicotine such as 5-hydroxypropyl nicotine, 2-hydroxyalkylnicotine such as 2-hydroxymethylnicotine, 4-hydroxyalkylnicotine such as 4-hydroxymethylnicotine, 6-hydroxyalkylnicotine such as 6-hydroxymethylnicotine, 6-hydroxyethylnicotine, and 6-hydroxypropyl nicotine. The syntheses of these compounds are described in this application and in a paper by Seeman, et al, [Journal of Organic Chemistry, 51, 1548, (1986)]. In addition the amino and mercapto analogs of these compounds can also function as initiators. Many epoxides, thioepoxides, ethyleneimines and oxazolines will undergo ring opening polymerization when initiated, under various conditions known to those skilled in the art, by a hydroxyalkylnicotine, a thioalkylnicotine or aminoalkylnicotine. Commonly available epoxides, include but are not limited to; ethylene oxide, propylene oxide glycidyl methyl ether, 2,2,3,3-tetramethyloxirane, 3,3,3-Trifluoro-1,2-epoxypropane, styrene oxide, cyclooctene oxide, 1,2-epoxyoctane, tert-Butyl glycidyl ether, 4-Fluorophenyloxirane, Glycidaldehyde diethyl acetal, Phenyl glycidyl ether, Benzyl glycidyl ether, cis, and trans-Stilbene oxide, and many others. Commonly available thioepoxides, include but are not limited to; ethylene sulfide, propylene sulfide, Cyclohexene sulfide, 1,2-Epithiooctane, 1,2-Epithiododecane, 4-phenoxyphenyl 2-thiiranylmethyl sulfone and many others. Commonly available ethyleneimines, and oxazolines, include but are not limited to; aziridine, 2-methylaziridine, 1-(benzylsulfonyl)aziridine, 1-(toluene-3-sulfonyl)aziridine, 2-phenylaziridine, 2,3-diphenylaziridine, 1-methylaziridine, 1-phenylaziridine, 2-ethyl-2-oxazoline, 2-methyl2-oxazoline 2-phenyl-2-oxazoline, 4,4-Dimethyl-2-phenyl-2-oxazoline, 3-(4,4-dimethyl-4,5-dihydro-1,3-oxazol-2-yl)pyridine, and many others. The polymers comprising these monomers all are examples of nicotine-P.sub.1 conjugates of Formula I.
(79) The nicotine-P.sub.1 conjugates of Formula I can then be used to initiate polymerization of a second monomer to provide the compound of Formula II. Of interest are compounds of Formula II formed by ring opening polymerization of cyclic esters, lactones, anhydrides, carbonates, lactams, and N-carboxyanhydrides. Of particular interest are compounds of Formula II formed by ring opening polymerization of lactide, and caprolactone. The ring opening polymerization of these can be initiated by compounds of Formula I, often at elevated temperatures, under the influence of a catalyst such as tin (II) ethylhexanoate or an amine catalyst such as TBD (1,5,7-triazabicyclo[4,4,0]dec-5-ene), DBU (1,8-diazabicyclo[5,4,0]undec-7-ene), DMAP (dimethylaminopyridine) as well as other catalysts known to those skilled in the art.
(80) Compounds useful for initiating ring opening polymerization of epoxides, thioepoxides and ethyleneimines or oxazolines include, but are not limited to 1-hydroxyalkylnicotine such as 1-hydroxyethylnicotine, 1-hydroxybutylnicotine, 3-hydroxyalkylnicotine such as 3-hydroxymethylnicotine, 4-hydroxyalkylnicotine such as 4-hydroxymethylnicotine and 4-hydroxyethylnicotine, 5-hydroxyalkylnicotine such as 5-hydroxypropyl nicotine, 2-hydroxyalkylnicotine such as 2-hydroxymethylnicotine, 4-hydroxyalkylnicotine such as 4-hydroxymethylnicotine, 6-hydroxyalkylnicotine such as 6-hydroxymethylnicotine, 6-hydroxyethylnicotine, and 6-hydroxypropyl nicotine. The syntheses of these compounds are described in this application and in a paper by Seeman, et al, [Journal of Organic Chemistry, 51, 1548, (1986)]. In addition the amino and mercapto analogs of these compounds can also function as initiators. Many epoxides, thioepoxides, ethyleneimines and oxazolines will undergo ring opening polymerization when initiated, under various conditions known to those skilled in the art, by a hydroxyalkylnicotine, a thioalkylnicotine or aminoalkylnicotine. Commonly available epoxides, include but are not limited to; ethylene oxide, propylene oxide glycidyl methyl ether, 2,2,3,3-tetramethyloxirane, 3,3,3-Trifluoro-1,2-epoxypropane, styrene oxide, cyclooctene oxide, 1,2-epoxyoctane, tert-Butyl glycidyl ether, 4-Fluorophenyloxirane, Glycidaldehyde diethyl acetal, Phenyl glycidyl ether, Benzyl glycidyl ether, cis, and trans-Stilbene oxide, and many others. Commonly available thioepoxides, include but are not limited to; ethylene sulfide, propylene sulfide, Cyclohexene sulfide, 1,2-Epithiooctane, 1,2-Epithiododecane, 4-phenoxyphenyl 2-thiiranylmethyl sulfone and many others. Commonly available ethyleneimines, and oxazolines, include but are not limited to; aziridine, 2-methylaziridine, 1-(benzylsulfonyl)aziridine, 1-(toluene-3-sulfonyl)aziridine, 2-phenylaziridine, 2,3-diphenylaziridine, 1-methylaziridine, 1-phenylaziridine, 2-ethyl-2-oxazoline, 2-methyl2-oxazoline 2-phenyl-2-oxazoline, 4,4-Dimethyl-2-phenyl-2-oxazoline, 3-(4,4-dimethyl-4,5-dihydro-1,3-oxazol-2-yl)pyridine, and many others. The polymers comprising these monomers all are examples of nicotine-P.sub.1 conjugates of Formula I.
(81) The nicotine-P.sub.1 conjugates of Formula I can then be used to initiate polymerization of a second monomer to provide the compound of Formula II. Of interest are compounds of Formula II formed by ring opening polymerization of cyclic esters, lactones, anhydrides, carbonates, lactams, and N-carboxyanhydrides. Of particular interest are compounds of Formula II formed by ring opening polymerization of lactide, and caprolactone. The ring opening polymerization of these can be initiated by compounds of Formula I, often at elevated temperatures, under the influence of a catalyst such as tin (II) ethylhexanoate or an amine catalyst such as TBD (1,5,7-triazabicyclo[4,4,0]dec-5-ene), DBU (1,8-diazabicyclo[5,4,0]undec-7-ene), DMAP (dimethylaminopyridine) as well as other catalysts known to those skilled in the art.
(82) Compounds of Formula II may be produced by the ring opening polymerization of cyclic esters, carbonates or anhydrides wherein the polymerization is initiated by a polymer of Formula I. Typical catalysts for this process include metals such as tin(II) ethylhexanoate and organic bases such as 1,5,7-triazabicyclo[4,4,0]dec-5-ene (TBD), 1,8-diazabicyclo[5,4,0]undec-7-ene (DBU), or 4-dimethylaminopyridine (DMAP). The polymerization can be carried out without solvent at elevated temperature (100-200 C.), or in an inert solvent such as toluene at reflux temperature.
(83) D. Inventive Compositions
(84) The compounds of the present invention are particularly useful in the making of vaccines that generate an antibody response to the nicotine residue in subjects that are administered the inventive compounds. In embodiments, the recited compositions and/or vaccines may comprise one or more adjuvants, and one or more additional antigens, in addition to the inventive compounds. Formulation of vaccines that comprise the inventive compounds may be performed using conventional techniques. The inventive compounds may also be incorporated into synthetic nanocarriers. For example, the compounds may be adsorbed onto the surface of synthetic nanocarriers, preferably leaving the nicotine residue exposed where it could serve as a B cell antigen. Alternatively, the compounds may be covalently bound to a surface of synthetic nanocarriers, again preferably leaving the nicotine residue exposed where it could serve as a B cell antigen.
(85) Preferably, inventive compositions, and even more preferably inventive vaccines, may comprise synthetic nanocarriers that comprise the inventive compounds. A wide variety of synthetic nanocarriers can be used according to the invention. In some embodiments, synthetic nanocarriers are spheres or spheroids. In some embodiments, synthetic nanocarriers are flat or plate-shaped. In some embodiments, synthetic nanocarriers are cubes or cubic. In some embodiments, synthetic nanocarriers are ovals or ellipses. In some embodiments, synthetic nanocarriers are cylinders, cones, or pyramids. In some embodiments, it is desirable to use a population of synthetic nanocarriers that is relatively uniform in terms of size, shape, and/or composition so that each synthetic nanocarrier has similar properties. For example, at least 80%, at least 90%, or at least 95% of the synthetic nanocarriers, based on the total number of synthetic nanocarriers, may have a minimum dimension or maximum dimension that falls within 5%, 10%, or 20% of the average diameter or average dimension of the synthetic nanocarriers. In some embodiments, a population of synthetic nanocarriers may be heterogeneous with respect to size, shape, and/or composition.
(86) Synthetic nanocarriers can be solid or hollow and can comprise one or more layers. In some embodiments, each layer has a unique composition and unique properties relative to the other layer(s). To give but one example, synthetic nanocarriers may have a core/shell structure, wherein the core is one layer (e.g. a polymeric core) and the shell is a second layer (e.g. a lipid bilayer or monolayer). Synthetic nanocarriers may comprise a plurality of different layers.
(87) In some embodiments, synthetic nanocarriers may optionally comprise one or more lipids. In some embodiments, a synthetic nanocarrier may comprise a liposome. In some embodiments, a synthetic nanocarrier may comprise a lipid bilayer. In some embodiments, a synthetic nanocarrier may comprise a lipid monolayer. In some embodiments, a synthetic nanocarrier may comprise a micelle. In some embodiments, a synthetic nanocarrier may comprise a core comprising a polymeric matrix surrounded by a lipid layer (e.g., lipid bilayer, lipid monolayer, etc.). In some embodiments, a synthetic nanocarrier may comprise a non-polymeric core (e.g., metal particle, quantum dot, ceramic particle, bone particle, viral particle, proteins, nucleic acids, carbohydrates, etc.) surrounded by a lipid layer (e.g., lipid bilayer, lipid monolayer, etc.).
(88) In some embodiments, synthetic nanocarriers can comprise one or more polymers. In some embodiments, such a polymer can be surrounded by a coating layer (e.g., liposome, lipid monolayer, micelle, etc.). In some embodiments, various elements of the synthetic nanocarriers can be coupled with the polymer.
(89) In some embodiments, an immunofeature surface, targeting moiety, and/or oligonucleotide can be covalently associated with a polymeric matrix. In some embodiments, covalent association is mediated by a linker. In some embodiments, an immunofeature surface, targeting moiety, and/or oligonucleotide can be noncovalently associated with a polymeric matrix. For example, in some embodiments, an immunofeature surface, targeting moiety, and/or oligonucleotide can be encapsulated within, surrounded by, and/or dispersed throughout a polymeric matrix. Alternatively or additionally, an immunofeature surface, targeting moiety, and/or nucleotide can be associated with a polymeric matrix by hydrophobic interactions, charge interactions, van der Waals forces, etc.
(90) A wide variety of polymers and methods for forming polymeric matrices therefrom are known conventionally. In general, a polymeric matrix comprises one or more polymers. Polymers may be natural or unnatural (synthetic) polymers. Polymers may be homopolymers or copolymers comprising two or more monomers. In terms of sequence, copolymers may be random, block, or comprise a combination of random and block sequences. Typically, polymers in accordance with the present invention are organic polymers.
(91) Examples of polymers suitable for use in the present inventioneither as mixtures with the compounds of Formula I and/or II or useful as P.sub.2 in Formula II, include, but are not limited to, polyethylenes, polycarbonates (e.g. poly(1,3-dioxan-2one)), polyanhydrides (e.g. poly(sebacic anhydride)), polypropylfumerates, polyamides (e.g. polycaprolactam), polyacetals, polyethers, polyesters (e.g., polylactide, polyglycolide, polylactide-co-glycolide, polycaprolactone, polyhydroxyacid (e.g. poly(-hydroxyalkanoate))), poly(orthoesters), polycyanoacrylates, polyvinyl alcohols, polyurethanes, polyphosphazenes, polyacrylates, polymethacrylates, polyureas, polystyrenes, and polyamines, polylysine, polylysine-PEG copolymers, and poly(ethyleneimine), poly(ethylene imine)-PEG copolymers.
(92) In some embodiments, polymers in accordance with the present invention include polymers which have been approved for use in humans by the U.S. Food and Drug Administration (FDA) under 21 C.F.R. 177.2600, including but not limited to polyesters (e.g., polylactic acid, poly(lactic-co-glycolic acid), polycaprolactone, polyvalerolactone, poly(1,3-dioxan-2one)); polyanhydrides (e.g., poly(sebacic anhydride)); polyethers (e.g., polyethylene glycol); polyurethanes; polymethacrylates; polyacrylates; and polycyanoacrylates.
(93) In some embodiments, polymers can be hydrophilic. For example, polymers may comprise anionic groups (e.g., phosphate group, sulphate group, carboxylate group); cationic groups (e.g., quaternary amine group); or polar groups (e.g., hydroxyl group, thiol group, amine group). In some embodiments, a synthetic nanocarrier comprising a hydrophilic polymeric matrix generates a hydrophilic environment within the synthetic nanocarrier. In some embodiments, polymers can be hydrophobic. In some embodiments, a synthetic nanocarrier comprising a hydrophobic polymeric matrix generates a hydrophobic environment within the synthetic nanocarrier. Selection of the hydrophilicity or hydrophobicity of the polymer may have an impact on the nature of materials that are incorporated (e.g. coupled) within the synthetic nanocarrier.
(94) In some embodiments, polymers may be modified with one or more moieties and/or functional groups. A variety of moieties or functional groups can be used in accordance with the present invention. In some embodiments, polymers may be modified with polyethylene glycol (PEG), with a carbohydrate, and/or with acyclic polyacetals derived from polysaccharides (Papisov, 2001, ACS Symposium Series, 786:301). Certain embodiments may be made using the general teachings of U.S. Pat. No. 5,543,158 to Gref et al., or WO publication WO2009/051837 by Von Andrian et al. The inventive compounds may be used in the making of such embodiments, particularly if a B cell response against nicotine or nicotine-like compounds is desired.
(95) In some embodiments, polymers may be modified with a lipid or fatty acid group. In some embodiments, a fatty acid group may be one or more of butyric, caproic, caprylic, capric, lauric, myristic, palmitic, stearic, arachidic, behenic, or lignoceric acid. In some embodiments, a fatty acid group may be one or more of palmitoleic, oleic, vaccenic, linoleic, alpha-linoleic, gamma-linoleic, arachidonic, gadoleic, arachidonic, eicosapentaenoic, docosahexaenoic, or erucic acid.
(96) In some embodiments, polymers may be polyesters, including copolymers comprising lactic acid and glycolic acid units, such as poly(lactic acid-co-glycolic acid) and poly(lactide-co-glycolide), collectively referred to herein as PLGA; and homopolymers comprising glycolic acid units, referred to herein as PGA, and lactic acid units, such as poly-L-lactic acid, poly-D-lactic acid, poly-D,L-lactic acid, poly-L-lactide, poly-D-lactide, and poly-D,L-lactide, collectively referred to herein as PLA. In some embodiments, exemplary polyesters include, for example, polyhydroxyacids; PEG copolymers and copolymers of lactide and glycolide (e.g., PLA-PEG copolymers, PGA-PEG copolymers, PLGA-PEG copolymers, and derivatives thereof. In some embodiments, polyesters include, for example, poly(caprolactone), poly(caprolactone)-PEG copolymers, poly(L-lactide-co-L-lysine), poly(serine ester), poly(4-hydroxy-L-proline ester), poly[-(4-aminobutyl)-L-glycolic acid], and derivatives thereof.
(97) In some embodiments, a polymer may be PLGA. PLGA is a biocompatible and biodegradable co-polymer of lactic acid and glycolic acid, and various forms of PLGA are characterized by the ratio of lactic acid:glycolic acid. Lactic acid can be L-lactic acid, D-lactic acid, or D,L-lactic acid. The degradation rate of PLGA can be adjusted by altering the lactic acid:glycolic acid ratio. In some embodiments, PLGA to be used in accordance with the present invention is characterized by a lactic acid:glycolic acid ratio of approximately 85:15, approximately 75:25, approximately 60:40, approximately 50:50, approximately 40:60, approximately 25:75, or approximately 15:85.
(98) In some embodiments, polymers may be one or more acrylic polymers. In certain embodiments, acrylic polymers include, for example, acrylic acid and methacrylic acid copolymers, methyl methacrylate copolymers, ethoxyethyl methacrylates, cyanoethyl methacrylate, aminoalkyl methacrylate copolymer, poly(acrylic acid), poly(methacrylic acid), methacrylic acid alkylamide copolymer, poly(methyl methacrylate), poly(methacrylic acid anhydride), methyl methacrylate, polymethacrylate, poly(methyl methacrylate) copolymer, polyacrylamide, aminoalkyl methacrylate copolymer, glycidyl methacrylate copolymers, polycyanoacrylates, and combinations comprising one or more of the foregoing polymers. The acrylic polymer may comprise fully-polymerized copolymers of acrylic and methacrylic acid esters with a low content of quaternary ammonium groups.
(99) In some embodiments, polymers can be cationic polymers. In general, cationic polymers are able to condense and/or protect negatively charged strands of nucleic acids (e.g. DNA, or derivatives thereof). Amine-containing polymers such as poly(lysine) (Zauner et al., 1998, Adv. Drug Del. Rev., 30:97; and Kabanov et al., 1995, Bioconjugate Chem., 6:7), poly(ethylene imine) (PEI; Boussif et al., 1995, Proc. Natl. Acad. Sci., USA, 1995, 92:7297), and poly(amidoamine) dendrimers (Kukowska-Latallo et al., 1996, Proc. Natl. Acad. Sci., USA, 93:4897; Tang et al., 1996, Bioconjugate Chem., 7:703; and Haensler et al., 1993, Bioconjugate Chem., 4:372) are positively-charged at physiological pH, form ion pairs with nucleic acids, and mediate transfection in a variety of cell lines. In embodiments, the inventive synthetic nanocarriers may not comprise (or may exclude) cationic polymers.
(100) In some embodiments, polymers can be degradable polyesters bearing cationic side chains (Putnam et al., 1999, Macromolecules, 32:3658; Barrera et al., 1993, J. Am. Chem. Soc., 115:11010; Kwon et al., 1989, Macromolecules, 22:3250; Lim et al., 1999, J. Am. Chem. Soc., 121:5633; and Zhou et al., 1990, Macromolecules, 23:3399). Examples of these polyesters include poly(L-lactide-co-L-lysine) (Barrera et al., 1993, J. Am. Chem. Soc., 115:11010), poly(serine ester) (Zhou et al., 1990, Macromolecules, 23:3399), poly(4-hydroxy-L-proline ester) (Putnam et al., 1999, Macromolecules, 32:3658; and Lim et al., 1999, J. Am. Chem. Soc., 121:5633), and poly(4-hydroxy-L-proline ester) (Putnam et al., 1999, Macromolecules, 32:3658; and Lim et al., 1999, J. Am. Chem. Soc., 121:5633).
(101) The properties of these and other polymers and methods for preparing them are well known in the art (see, for example, U.S. Pat. Nos. 6,123,727; 5,804,178; 5,770,417; 5,736,372; 5,716,404; 6,095,148; 5,837,752; 5,902,599; 5,696,175; 5,514,378; 5,512,600; 5,399,665; 5,019,379; 5,010,167; 4,806,621; 4,638,045; and 4,946,929; Wang et al., 2001, J. Am. Chem. Soc., 123:9480; Lim et al., 2001, J. Am. Chem. Soc., 123:2460; Langer, 2000, Acc. Chem. Res., 33:94; Langer, 1999, J. Control. Release, 62:7; and Uhrich et al., 1999, Chem. Rev., 99:3181). More generally, a variety of methods for synthesizing certain suitable polymers are described in Concise Encyclopedia of Polymer Science and Polymeric Amines and Ammonium Salts, Ed. by Goethals, Pergamon Press, 1980; Principles of Polymerization by Odian, John Wiley & Sons, Fourth Edition, 2004; Contemporary Polymer Chemistry by Allcock et al., Prentice-Hall, 1981; Deming et al., 1997, Nature, 390:386; and in U.S. Pat. Nos. 6,506,577, 6,632,922, 6,686,446, and 6,818,732.
(102) In some embodiments, polymers can be linear or branched polymers. In some embodiments, polymers can be dendrimers. In some embodiments, polymers can be substantially cross-linked to one another. In some embodiments, polymers can be substantially free of cross-links. In some embodiments, polymers can be used in accordance with the present invention without undergoing a cross-linking step. It is further to be understood that inventive synthetic nanocarriers may comprise block copolymers, graft copolymers, blends, mixtures, and/or adducts of any of the foregoing and other polymers. Those skilled in the art will recognize that the polymers listed herein represent an exemplary, not comprehensive, list of polymers that can be of use in accordance with the present invention.
(103) In some embodiments, synthetic nanocarriers do not comprise a polymeric component. In some embodiments, synthetic nanocarriers may comprise metal particles, quantum dots, ceramic particles, etc. In some embodiments, a non-polymeric synthetic nanocarrier is an aggregate of non-polymeric components, such as an aggregate of metal atoms (e.g., gold atoms).
(104) In some embodiments, synthetic nanocarriers may optionally comprise one or more amphiphilic entities. In some embodiments, an amphiphilic entity can promote the production of synthetic nanocarriers with increased stability, improved uniformity, or increased viscosity. In some embodiments, amphiphilic entities can be associated with the interior surface of a lipid membrane (e.g., lipid bilayer, lipid monolayer, etc.). Many amphiphilic entities known in the art are suitable for use in making synthetic nanocarriers in accordance with the present invention. Such amphiphilic entities include, but are not limited to, phosphoglycerides; phosphatidylcholines; dipalmitoyl phosphatidylcholine (DPPC); dioleylphosphatidyl ethanolamine (DOPE); dioleyloxypropyltriethylammonium (DOTMA); dioleoylphosphatidylcholine; cholesterol; cholesterol ester; diacylglycerol; diacylglycerolsuccinate; diphosphatidyl glycerol (DPPG); hexanedecanol; fatty alcohols such as polyethylene glycol (PEG); polyoxyethylene-9-lauryl ether; a surface active fatty acid, such as palmitic acid or oleic acid; fatty acids; fatty acid monoglycerides; fatty acid diglycerides; fatty acid amides; sorbitan trioleate (Span85) glycocholate; sorbitan monolaurate (Span20); polysorbate 20 (Tween20); polysorbate 60 (Tween60); polysorbate 65 (Tween65); polysorbate 80 (Tween80); polysorbate 85 (Tween85); polyoxyethylene monostearate; surfactin; a poloxomer; a sorbitan fatty acid ester such as sorbitan trioleate; lecithin; lysolecithin; phosphatidylserine; phosphatidylinositol; sphingomyelin; phosphatidylethanolamine (cephalin); cardiolipin; phosphatidic acid; cerebrosides; dicetylphosphate; dipalmitoylphosphatidylglycerol; stearylamine; dodecylamine; hexadecyl-amine; acetyl palmitate; glycerol ricinoleate; hexadecyl sterate; isopropyl myristate; tyloxapol; poly(ethylene glycol)5000-phosphatidylethanolamine; poly(ethylene glycol)400-monostearate; phospholipids; synthetic and/or natural detergents having high surfactant properties; deoxycholates; cyclodextrins; chaotropic salts; ion pairing agents; and combinations thereof. An amphiphilic entity component may be a mixture of different amphiphilic entities. Those skilled in the art will recognize that this is an exemplary, not comprehensive, list of substances with surfactant activity. Any amphiphilic entity may be used in the production of synthetic nanocarriers to be used in accordance with the present invention.
(105) In some embodiments, synthetic nanocarriers may optionally comprise one or more carbohydrates. Carbohydrates may be natural or synthetic. A carbohydrate may be a derivatized natural carbohydrate. In certain embodiments, a carbohydrate comprises monosaccharide or disaccharide, including but not limited to glucose, fructose, galactose, ribose, lactose, sucrose, maltose, trehalose, cellbiose, mannose, xylose, arabinose, glucoronic acid, galactoronic acid, mannuronic acid, glucosamine, galatosamine, and neuramic acid. In certain embodiments, a carbohydrate is a polysaccharide, including but not limited to pullulan, cellulose, microcrystalline cellulose, hydroxypropyl methylcellulose (HPMC), hydroxycellulose (HC), methylcellulose (MC), dextran, cyclodextran, glycogen, hydroxyethylstarch, carageenan, glycon, amylose, chitosan, N,O-carboxylmethylchitosan, algin and alginic acid, starch, chitin, inulin, konjac, glucommannan, pustulan, heparin, hyaluronic acid, curdlan, and xanthan. In embodiments, the inventive synthetic nanocarriers do not comprise (or specifically exclude) carbohydrates, such as a polysaccharide. In certain embodiments, the carbohydrate may comprise a carbohydrate derivative such as a sugar alcohol, including but not limited to mannitol, sorbitol, xylitol, erythritol, maltitol, and lactitol.
(106) Compositions according to the invention comprise inventive synthetic nanocarriers in combination with pharmaceutically acceptable excipients, such as preservatives, buffers, saline, or phosphate buffered saline. The compositions may be made using conventional pharmaceutical manufacturing and compounding techniques to arrive at useful dosage forms. In an embodiment, inventive synthetic nanocarriers are suspended in sterile saline solution for injection together with a preservative.
(107) In embodiments, when preparing synthetic nanocarriers as carriers for adjuvants for use in vaccines, methods for coupling the adjuvants to the synthetic nanocarriers may be useful. If the adjuvant is a small molecule it may be of advantage to attach the adjuvant to a polymer prior to the assembly of the synthetic nanocarriers. In embodiments, it may also be an advantage to prepare the synthetic nanocarriers with surface groups that are used to couple the adjuvant to the synthetic nanocarrier through the use of these surface groups rather than attaching the adjuvant to a polymer and then using this polymer conjugate in the construction of synthetic nanocarriers.
(108) For detailed descriptions of available conjugation methods, see Hermanson G T Bioconjugate Techniques, 2nd Edition Published by Academic Press, Inc., 2008. In addition to covalent attachment the adjuvant can be coupled by absorption to a pre-formed synthetic nanocarrier or it can be coupled by encapsulation during the formation of the synthetic nanocarrier.
(109) D. Methods of Making and Using the Inventive Compositions and Related Methods
(110) Synthetic nanocarriers may be prepared using a wide variety of methods known in the art. For example, synthetic nanocarriers can be formed by methods as nanoprecipitation, flow focusing fluidic channels, spray drying, single and double emulsion solvent evaporation, solvent extraction, phase separation, milling, microemulsion procedures, microfabrication, nanofabrication, sacrificial layers, simple and complex coacervation, and other methods well known to those of ordinary skill in the art. Alternatively or additionally, aqueous and organic solvent syntheses for monodisperse semiconductor, conductive, magnetic, organic, and other nanomaterials have been described (Pellegrino et al., 2005, Small, 1:48; Murray et al., 2000, Ann. Rev. Mat. Sci., 30:545; and Trindade et al., 2001, Chem. Mat., 13:3843). Additional methods have been described in the literature (see, e.g., Doubrow, Ed., Microcapsules and Nanoparticles in Medicine and Pharmacy, CRC Press, Boca Raton, 1992; Mathiowitz et al., 1987, J. Control. Release, 5:13; Mathiowitz et al., 1987, Reactive Polymers, 6:275; and Mathiowitz et al., 1988, J. Appl. Polymer Sci., 35:755, and also U.S. Pat. Nos. 5,578,325 and 6,007,845; P. Paolicelli et al. Surface-modified PLGA-based Nanoparticles that can Efficiently Associate and Deliver Virus-like Particles. Nanomedicine. 5(6):843-853 (2010)).
(111) Various materials may be encapsulated into synthetic nanocarriers as desirable using a variety of methods including but not limited to C. Astete et al., Synthesis and characterization of PLGA nanoparticles J. Biomater. Sci. Polymer Edn, Vol. 17, No. 3, pp. 247-289 (2006); K. Avgoustakis Pegylated Poly(Lactide) and Poly(Lactide-Co-Glycolide) Nanoparticles: Preparation, Properties and Possible Applications in Drug Delivery Current Drug Delivery 1:321-333 (2004); C. Reis et al., Nanoencapsulation I. Methods for preparation of drug-loaded polymeric nanoparticles Nanomedicine 2:8-21 (2006); P. Paolicelli et al. Surface-modified PLGA-based Nanoparticles that can Efficiently Associate and Deliver Virus-like Particles. Nanomedicine. 5(6):843-853 (2010). Other methods suitable for encapsulating materials, such as oligonucleotides, into synthetic nanocarriers may be used, including without limitation methods disclosed in U.S. Pat. No. 6,632,671 to Unger Oct. 14, 2003.
(112) In certain embodiments, synthetic nanocarriers are prepared by a nanoprecipitation process or spray drying. Conditions used in preparing synthetic nanocarriers may be altered to yield particles of a desired size or property (e.g., hydrophobicity, hydrophilicity, external morphology, stickiness, shape, etc.). The method of preparing the synthetic nanocarriers and the conditions (e.g., solvent, temperature, concentration, air flow rate, etc.) used may depend on the materials to be coupled to the synthetic nanocarriers and/or the composition of the polymer matrix.
(113) If particles prepared by any of the above methods have a size range outside of the desired range, particles can be sized, for example, using a sieve.
(114) Elements of the inventive synthetic nanocarriers (such as moieties of which an immunofeature surface is comprised, targeting moieties, polymeric matrices, antigens and the like) may be coupled to the overall synthetic nanocarrier, e.g., by one or more covalent bonds, or may be coupled by means of one or more linkers. Additional methods of functionalizing synthetic nanocarriers may be adapted from Published US Patent Application 2006/0002852 to Saltzman et al., Published US Patent Application 2009/0028910 to DeSimone et al., or Published International Patent Application WO/2008/127532 A1 to Murthy et al.
(115) Alternatively or additionally, synthetic nanocarriers can be coupled to immunofeature surfaces, targeting moieties, adjuvants, various antigens, and/or other elements directly or indirectly via non-covalent interactions. In non-covalent embodiments, the non-covalent coupling is mediated by non-covalent interactions including but not limited to charge interactions, affinity interactions, metal coordination, physical adsorption, host-guest interactions, hydrophobic interactions, TT stacking interactions, hydrogen bonding interactions, van der Waals interactions, magnetic interactions, electrostatic interactions, dipole-dipole interactions, and/or combinations thereof. Such couplings may be arranged to be on an external surface or an internal surface of an inventive synthetic nanocarrier. In embodiments, encapsulation and/or absorption are/is a form of coupling.
(116) In embodiments, the inventive synthetic nanocarriers can be combined with other adjuvants by admixing in the same vehicle or delivery system. Such adjuvants may include, but are not limited to mineral salts, such as alum, alum combined with monphosphoryl lipid (MPL) A of Enterobacteria, such as Escherihia coli, Salmonella minnesota, Salmonella typhimurium, or Shigella flexneri or specifically with MPL (AS04), MPL A of above-mentioned bacteria separately, saponins, such as QS-21, Quil-A, ISCOMs, ISCOMATRIX, emulsions such as MF59, Montanide ISA 51 and ISA 720, AS02 (QS21+squalene+MPL), liposomes and liposomal formulations such as AS01, synthesized or specifically prepared microparticles and microcarriers such as bacteria-derived outer membrane vesicles (OMV) of N. gonorrheae, Chlamydia trachomatis and others, or chitosan particles, depot-forming agents, such as Pluronic block co-polymers, specifically modified or prepared peptides, such as muramyl dipeptide, aminoalkyl glucosaminide 4-phosphates such as RC529, or proteins, such as bacterial toxoids or toxin fragments. The doses of such other adjuvants can be determined using conventional dose ranging studies.
(117) In embodiments, the inventive synthetic nanocarriers can be combined with an antigen different, similar or identical to those coupled to a nanocarrier (with or without adjuvant, utilizing or not utilizing another delivery vehicle) administered separately at a different time-point and/or at a different body location and/or by a different immunization route or with another antigen and/or adjuvant-carrying synthetic nanocarrier administered separately at a different time-point and/or at a different body location and/or by a different immunization route.
(118) Populations of synthetic nanocarriers may be combined to form pharmaceutical dosage forms according to the present invention using traditional pharmaceutical mixing methods. These include liquid-liquid mixing in which two or more suspensions, each containing one or more subset of nanocarriers, are directly combined or are brought together via one or more vessels containing diluent. As synthetic nanocarriers may also be produced or stored in a powder form, dry powder-powder mixing could be performed as could the re-suspension of two or more powders in a common media. Depending on the properties of the nanocarriers and their interaction potentials, there may be advantages conferred to one or another route of mixing.
(119) Typical inventive compositions that comprise synthetic nanocarriers may comprise inorganic or organic buffers (e.g., sodium or potassium salts of phosphate, carbonate, acetate, or citrate) and pH adjustment agents (e.g., hydrochloric acid, sodium or potassium hydroxide, salts of citrate or acetate, amino acids and their salts) antioxidants (e.g., ascorbic acid, alpha-tocopherol), surfactants (e.g., polysorbate 20, polysorbate 80, polyoxyethylene9-10 nonyl phenol, sodium desoxycholate), solution and/or cryo/lyo stabilizers (e.g., sucrose, lactose, mannitol, trehalose), osmotic adjustment agents (e.g., salts or sugars), antibacterial agents (e.g., benzoic acid, phenol, gentamicin), antifoaming agents (e.g., polydimethylsilozone), preservatives (e.g., thimerosal, 2-phenoxyethanol, EDTA), polymeric stabilizers and viscosity-adjustment agents (e.g., polyvinylpyrrolidone, poloxamer 488, carboxymethylcellulose) and co-solvents (e.g., glycerol, polyethylene glycol, ethanol).
(120) Compositions according to the invention comprise inventive synthetic nanocarriers in combination with pharmaceutically acceptable excipients. The compositions may be made using conventional pharmaceutical manufacturing and compounding techniques to arrive at useful dosage forms. Techniques suitable for use in practicing the present invention may be found in Handbook of Industrial Mixing: Science and Practice, Edited by Edward L. Paul, Victor A. Atiemo-Obeng, and Suzanne M. Kresta, 2004 John Wiley & Sons, Inc.; and Pharmaceutics: The Science of Dosage Form Design, 2nd Ed. Edited by M. E. Auten, 2001, Churchill Livingstone. In an embodiment, inventive synthetic nanocarriers are suspended in sterile saline solution for injection together with a preservative.
(121) It is to be understood that the compositions of the invention can be made in any suitable manner, and the invention is in no way limited to compositions that can be produced using the methods described herein. Selection of an appropriate method may require attention to the properties of the particular moieties being associated.
(122) In some embodiments, inventive synthetic nanocarriers are manufactured under sterile conditions or are terminally sterilized. This can ensure that resulting composition are sterile and non-infectious, thus improving safety when compared to non-sterile compositions. This provides a valuable safety measure, especially when subjects receiving synthetic nanocarriers have immune defects, are suffering from infection, and/or are susceptible to infection. In some embodiments, inventive synthetic nanocarriers may be lyophilized and stored in suspension or as lyophilized powder depending on the formulation strategy for extended periods without losing activity.
(123) The inventive compositions may be administered by a variety of routes of administration, including but not limited to parenteral (such as subcutaneous, intramuscular, intravenous, or intradermal), pulmonary, sublingual, oral, intranasal, transnasal, intramucosal, transmucosal, rectal, ophthalmic, transcutaneous, transdermal or by a combination of these routes.
(124) Doses of dosage forms contain varying amounts of populations of synthetic nanocarriers and varying amounts of the compounds of Formulas I or II, according to the invention. The amount of synthetic nanocarriers and/or antigens present in the inventive dosage forms can be varied according to the nature of the antigens, the therapeutic benefit to be accomplished, and other such parameters. In embodiments, dose ranging studies can be conducted to establish optimal therapeutic amount of the population of synthetic nanocarriers and the amount of antigens to be present in the dosage form. In embodiments, the synthetic nanocarriers and the antigens are present in the dosage form in an amount effective to generate an immune response to the antigens upon administration to a subject. It may be possible to determine amounts of the antigens effective to generate an immune response using conventional dose ranging studies and techniques in subjects. Inventive dosage forms may be administered at a variety of frequencies. In a preferred embodiment, at least one administration of the dosage form is sufficient to generate a pharmacologically relevant response. In more preferred embodiment, at least two administrations, at least three administrations, or at least four administrations, of the dosage form are utilized to ensure a pharmacologically relevant response.
(125) The compositions and methods described herein can be used to induce, enhance, suppress, modulate, direct, or redirect an immune response. The compositions and methods described herein can be used in the diagnosis, prophylaxis and/or treatment of conditions such as cancers, infectious diseases, metabolic diseases, degenerative diseases, autoimmune diseases, inflammatory diseases, immunological diseases, or other disorders and/or conditions. The compositions and methods described herein can also be used for the prophylaxis or treatment of an addiction, such as an addiction to nicotine or a narcotic. In preferred embodiments, the compounds of Formulas I or II are used in the prophylaxis or treatment of an addiction to nicotine. The compositions and methods described herein can also be used for the prophylaxis and/or treatment of a condition resulting from the exposure to a toxin, hazardous substance, environmental toxin, or other harmful agent.
EXAMPLES
Example 1
Preparation of Peg-Nicotine Conjugates by Grafting and Reduction: Amine Linkage to Nicotine at 3-Position. Molecular Weight of about 3.5 KD
(126) ##STR00010##
(127) Monoamino poly(ethylene glycol) from JenKem with a molecular weight of 3.5 KD (0.20 gm, 5.710.sup.5 moles) and an excess of trans-4-cotininecarboxylic acid (0.126 gm, 5.710.sup.4 moles) were dissolved in dimethylformamide (5.0 mL). The solution was stirred and dicyclohexylcarbodiimide (0.124 gm, 6.010.sup.4 moles) was added. This solution was stirred overnight at room temperature. Water (0.10 mL) was added and stirring was continued for an additional 15 minutes. The precipitate of dicyclohexyl urea was removed by filtration and the filtrates were evaporated under vacuum. The residue was dissolved in methylene chloride (4.0 mL) and this solution was added to diethyl ether (100 mL). The solution was cooled in the refrigerator for 2 hours and the precipitated polymer was isolated by filtration. After washing with diethyl ether, the solid white polymer was dried under high vacuum. The yield was 0.188 gm. This polymer was used without further purification for the next step.
(128) The cotinine/PEG polymer (0.20 gm, 5.710.sup.5 moles) was dissolved in dry tetrahydrofuran (10 mL) under nitrogen and the solution was stirred as a solution of lithium aluminum hydride in tetrahydrofuran (1.43 mL of 2.0M, 2.8510.sup.3 moles) was added. The addition of the lithium aluminum hydride caused the polymer to precipitate as a gelatinous mass. The reaction was heated to 80 C. under a slow stream of nitrogen and the tetrahydrofuran was allowed to evaporate. The residue was then heated at 80 C. for 2 hours. After cooling, water (0.5 mL) was cautiously added. Once the hydrogen evolution had stopped, 10% methanol in methylene chloride (50 mL) was added and the reaction mixture was stirred until the polymer had dissolved. This mixture was filtered through Celite and the filtrates were evaporated to dryness under vacuum. The residue was dissolved in methylene chloride (4.0 mL) and this solution was slowly added to diethyl ether (100 mL). The polymer separated as a white flocculent solid and was isolated by centrifugation. After washing with diethyl ether, the solid was dried under vacuum. The yield was 0.129 gm.
Example 2
Preparation of Peg-Nicotine Conjugates by Polymerization with Ethylene Oxide: Amine Linkage to Nicotine at 3-Position. Molecular Weight of about 2.2 KD
(129) ##STR00011##
(130) Trans-4-Cotininecarboxylic acid, methyl ester (7.1 gm, 3.0310.sup.2 moles) and ethanolamine (2.22 gm, 3.6410.sup.2 moles) were combined and heated at 150 C. for 45 minutes. The reaction mass was cooled to about 85 C. and boiling tetrahydrofuran (75 mL) was added. The mixture was stirred to provide a solution which was cooled on ice. The amide crystallized as a white solid and was isolated by filtration, washed with THF followed by ether and dried. The yield was 7.2 gm.
(131) ##STR00012##
(132) To a stirred suspension of the cotinine-amide (2.63 gm, 1.010.sup.2 moles) in THF (20 mL) under argon was added borane in THF (60 mL of 1.0 M solution, 6.010.sup.2 moles). The reaction was stirred at room temperature for 4 hours and then at 55 C. overnight. After cooling on ice, the reaction was treated with concentrated hydrochloric acid (6.0 mL) followed by methanol (100 mL) containing concentrated hydrochloric acid (6.0 mL). After stirring at room temperature for 4 hours, the reaction was slowly brought to reflux. A portion of the solvents (60 mL) was removed by distillation and the clear solution remaining was cooled and evaporated under vacuum. Additional methanol (100 mL) was added to the residue and the resulting solution was again evaporated under vacuum. The remaining oil was dissolved in water (50 mL) and this solution was treated with solid potassium carbonate which caused the amine to separate. The aqueous mixture was extracted with methylene chloride (250 mL) and the pooled extracts were dried over sodium sulfate. After filtration, the methylene chloride was evaporated under vacuum to provide the crude amine as a pale yellow oil in a yield of 2.7 gm. The amine was purified by chromatography on silica gel using 15% of 0.3N methanolic ammonia in methylene chloride (200 mL) followed by 20% of 0.6N methanolic ammonia in methylene chloride. The fractions containing the amine were pooled and evaporated to provide the purified amine as colorless oil in a yield of 1.23 gm.
(133) ##STR00013##
(134) 3-Hydroxyethylaminomethylnicotine (1.10 gm, 4.6710.sup.3 moles) was dissolved in dry dioxane (100 mL) in a pressure flask. A portion of the dioxane (25 mL) was removed by distillation to remove water via azeotropic distillation. This solution was cooled under argon on ice. Potassium hexamethyldisilazide (9.3 mL of 0.5M in toluene, 4.6510.sup.3 moles) was added via syringe and stirring was continued on ice for 15 minutes. To this solution was added ethylene oxide (25 mL, 22 gm, 0.50 moles) which had been condensed in a cooled graduated cylinder. The flask was sealed and the reaction was stirred at room temperature overnight. The reaction was then heated at 50 C. for 30 minutes before being cooled to room temperature. The flask was opened and concentrated hydrochloric acid (2.0 mL) was added. After stirring for 30 minutes the solvents were removed under vacuum.
(135) The viscous liquid residue was stirred with diethyl ether (500 mL) which caused the polymer to separate as a white powder. This was isolated by filtration, washed with ether and dried under vacuum. The polymer was obtained in a yield of 7.2 gm and had a molecular weight of 2200 as determined by NMR.
Example 3
Preparation of Peg-Nicotine Conjugates by Reductive Alkylation: Amine Linkage to Nicotine at 4-Position. Molecular Weight of about 3.5 KD
(136) ##STR00014##
(137) A solution of lithium diisopropylamide (3.23 mL of 2M, 6.4610.sup.3 moles) in dry THF (20 mL) was cooled in a dry ice bath under nitrogen. To this solution was added a solution of cotinine (1.0 gm 5.610.sup.3 moles) and tetramethylethylenediamine (968 L) in dry THF (10 mL) over 5 minutes. This solution was stirred at dry ice temperature for 15 minutes and at ice temperature for 10 minutes. The reaction was again cooled in a dry ice bath and 2-bromoethyl dioxane (1.26 gm, 6.4610.sup.3 moles) dissolved in dry THF (10 mL) was added. The reaction was stirred on ice for 30 minutes and then overnight at room temperature. To the reaction was added methanol (20 mL) and after stirring a few minutes, the solvents were removed under vacuum. The residue was partitioned between ethyl acetate (200 mL) and water (200 mL). To the aqueous portion sodium carbonate (20 gm) was added and once dissolved the solution was extracted with methylene chloride (200 mL). The combined ethyl acetate and methylene chloride extracts were dried over magnesium sulfate, filtered and evaporated under vacuum. The oily crude product was dried under high vacuum. The yield was 1.59 gm and was hydrolyzed to the aldehyde without purification.
(138) ##STR00015##
(139) The crude acetal (1.59 gm, 5.4810.sup.3 moles) was added to 0.20 M oxalic acid in water (20 mL) and this solution was heated at reflux for 2 hours. The reaction was cooled to room temperature and solid sodium carbonate was added with stirring to neutralize the oxalic acid. The oil which separated was extracted into methylene chloride (100 mL) and this solution was dried over magnesium sulfate. After filtration, the methylene chloride was removed under vacuum to provide the aldehyde as a pale brown oil in a yield of 0.89 gm. TLC (silica, 10% methanol in methylene chloride) showed that the product was about 85% pure. This was used without purification for the next step.
(140) ##STR00016##
(141) Monoamino poly(ethylene glycol)hydrochloride from JenKem with a molecular weight of 3.5 KD (350 mg, 1.010.sup.5 moles) was dissolved in chloroform (10 mL). To this solution was added the cotinine aldehyde (116 mg, 510.sup.4 moles) followed by acetic acid (60 mg, 1.010.sup.3 moles) and sodium triacetoxyborohydride (212 mg, 1.010.sup.3 moles). The reaction was stirred at room temperature overnight. Solid sodium bicarbonate (100 mg) was added and stirring was continued for 2 hours. The reaction mixture was centrifuged to remove a small amount of solids and the supernatant was placed on top of a silica column (110). The column was developed with 10% methanol in methylene chloride (200 mL) followed by 20% methanol in methylene chloride (500 mL). The fractions containing the polymer were pooled and evaporated. After drying under high vacuum the polymer was obtained as a white solid in a yield of 227 mg.
(142) ##STR00017##
(143) The cotinine polymer (200 mg) was dissolved in dry THF (10 mL) under nitrogen and a solution of lithium aluminum hydride (1.5 mL of 2.0 M in THF, 310.sup.3 moles) was added via syringe. The reaction was heated at 80 C. for 2 hours. After cooling, water (0.5 mL) was added followed by 10% methanol in methylene chloride (15 mL). After stirring for 15 minutes the slurry was filtered through a Celite pad which was washed with methylene chloride (10 mL). The combined filtrates were evaporated under vacuum to provide the nicotine polymer in a yield of 200 mg. NMR clearly showed the nicotine in a ratio of 2 nicotines per poly(ethylene) glycol.
Example 4
Preparation of Peg-Nicotine Conjugates by Reaction with Ethylene Oxide:Ether Linkage to Nicotine at 1-Position. Molecular Weight of about 2.0 KD
(144) ##STR00018##
(145) Nornicotine (1.48 gm, 0.01 moles) and succinic anhydride (1.00 gm, 0.01 moles) were combined in chloroform (15 mL). This mixture was brought to reflux causing the succinic anhydride to dissolve. The solution was then stirred at room temperature overnight. The chloroform was removed under vacuum and the residue was dried under high vacuum to give the amide as a tan foam in a yield of 2.4 gm.
(146) ##STR00019##
(147) The succinoylated nornicotine (2.4 gm, 9.710.sup.3 moles) was dissolved in dry THF (30 mL) and the solution was stirred on ice under an atmosphere of argon. A solution of lithium aluminum hydride in THF (11.0 mL of a 2.0M solution, 2.210.sup.2 moles) was slowly added. After the addition was complete, the hazy solution was heated at reflux for 2 hours. The pale yellow solution that had formed was stirred at room temperature overnight. After cooling on ice, the reaction was treated with water (0.83 mL) followed by 15% sodium hydroxide (0.83 mL) and then water again (2.5 mL). The resulting slurry was stirred at room temperature for 30 minutes and was then filtered to remove the aluminum salts. The solids were washed with THF (25 mL) and the combined filtrates were evaporated under vacuum. The crude product was purified by chromatography on silica using 15% methanol in methylene chloride as eluent. The fractions containing the product were pooled and evaporated under vacuum to provide the nicotine derivative as a pale yellow oil in a yield of 1.2 gm.
(148) ##STR00020##
(149) The nicotine alcohol (1.30 gm, 5.910.sup.3 moles) was dissolved in dry THF (120 mL) under a blanket of argon in a pressure bottle. Potassium hydride suspension in mineral oil (780 mg of a 30% oil dispersion, 5.810.sup.3 moles) was added and the reaction was stirred at room temperature for one hour when the hydrogen evolution had stopped and the potassium hydride had dissolved. This solution was cooled on ice and condensed ethylene oxide (23.6 gm, 0.535 moles) was added. The pressure flask was sealed and the reaction was stirred overnight at room temperature. The THF was removed under vacuum and the semi-solid residue was dissolved in chloroform (10 mL). This solution was added to diethyl ether (200 mL) and the mixture was cooled on ice which caused the polymer to separate as a powder. Most of the ether was removed by decantation and the solid polymer was then isolated by filtration of the remaining slurry. The solid was washed with ether and was then dried under vacuum to give the poly(ethylene)glycol conjugate as a white powder in a yield of 11.0 gm. The molecular weight, determined by NMR was 2 KD.
Example 5
Preparation of Peg-Nicotine Conjugates by Grafting: Amide Linkage to Nicotine at 1-Position. Molecular Weight of about 3.5 KD
(150) ##STR00021##
(151) Nornicotine (2.18 gm, 1.4710.sup.2 moles) and succinic semialdehyde (10 gm of a 15% solution in water, 1.5 gm, 1.4710.sup.2 moles) were dissolved in acetonitrile (50 mL). This solution was stirred at room temperature as sodium cyanoborohydride (0.92 gm, 1.4710.sup.2 moles) and acetic acid (0.88 gm, 1.4710.sup.2 moles) was added. The reaction was stirred at room temperature overnight. The solution was filtered to remove some solids and the filtrates were evaporated to dryness under vacuum. Methanol (250 mL) was added along with concentrated sulfuric acid (1.44 gm, 1.4710.sup.2 moles). Methanol (200 mL) was distilled from the reaction to remove boron. Additional methanol (100 mL) and sulfuric acid (5 gm) were added and the solution was stirred at room temperature overnight. Methanol (100 mL) was removed under vacuum and the remaining material was partitioned between methylene chloride (300 mL) and 10% potassium carbonate (200 mL). The methylene chloride phase was isolated and dried over magnesium sulfate. After filtering the solution free from the magnesium sulfate, the filtrates were evaporated under vacuum to provide the product as a pale yellow oil in a yield of 2.22 gm.
(152) ##STR00022##
(153) The methyl ester (248 mg, 1.010.sup.3 moles) was dissolved in THF (10 mL). Methanol (5 mL) and water (200 L) were treated with n-butyl lithium (500 L of 2.0M in hexanes, 1.010.sup.3 moles) and this solution was added to the THF solution of the methyl ester. The solution was refluxed for 30 minutes and was then left at room temperature overnight. The solvents were removed under vacuum and the solid residue was dried under vacuum. Ether (50 mL) was added and this mixture was stirred overnight. The solid which resulted was isolated by centrifugation and was washed with ether. After drying under vacuum the lithium salt was isolated as a white powder in a yield of 141 mg.
(154) ##STR00023##
(155) The nicotine carboxylic acid lithium salt (113 mg, 5.010.sup.4 moles) was stirred in DMF (2.0 mL) and hydrogen chloride dissolved in dioxane (4M) was added until an aliquot in water had a pH of 5.0 (250 L). To this solution was added N-hydroxysuccinimide (57.5 mg, 5.010.sup.4 moles) and dicyclohexyl carbodiimide (103 mg, 5.010.sup.4 moles). This solution was stirred at room temperature overnight. The resulting slurry was treated with a solution of aminopoly(ethylene)glycol hydrochloride (750 mg, 2.1410.sup.4 moles) and diisopropylethylamine (1.0 mL) in DMF (5.0 mL). This solution was stirred at room temperature overnight. The reaction was filtered free of solids and the filtrates were evaporated under vacuum. The residue was subjected to chromatography on silica gel using 15% methanol in methylene chloride as eluent. The fractions containing the product were pooled and evaporated to provide the polymer conjugate as a white waxy solid. This was dissolved in chloroform (5 mL) and the mixture was filtered free from a small amount of dicyclohexyl urea. The filtrates were added to diethyl ether (100 mL) and the precipitated polymer was isolated by centrifugation and dried under vacuum. The poly(ethylene)glycol/nicotine conjugate was isolated as a white powder in a yield of 480 mg.
Example 6
Preparation of Peg-Nicotine Conjugate by Reaction with Ethylene Oxide: Ether Linkage to Nicotine at Position 3-Position. Molecular Weight of about 5.0 KD. KHMDS as Base
(156) ##STR00024##
(157) A solution of 3-hydroxymethylnicotine (1.92 gm, 1.010.sup.2 moles) was prepared in dry dioxane (100 mL). This solution was brought to reflux and a portion of the dioxane (50 mL) was allowed to distill from the flask to remove water. The flask and contents were cooled to room temperature under argon. The solution was then cooled to 10 C. and a solution of potassium bis-trimethylsilylamide (20 mL, 0.5 M in toluene, 1.010.sup.2 moles) was added via syringe. This solution was kept at 10 C. under argon until needed for the next step.
(158) Dry THF (150 mL) was placed in a pressure flask which was cooled in a dry ice/acetone bath under argon. Ethylene oxide (50 gm, 56.7 mL, 1.14 moles) was condensed in a cooled graduated cylinder and this was added to the cooled THF. To this solution was added the alkoxide solution from step 1 and the pressure flask was sealed. The reaction was allowed to warm to room temperature and after about 1.5 hours an exothermic reaction began. When the temperature reached 50 C. the flask and contents were placed in a water bath set at 25 C. and the reaction was stirred at that temperature overnight. The flask was opened and acetic acid (0.6 gm, 1.010.sup.2 moles) was added. After stirring for an additional 30 minutes, the polymer was precipitated by addition to diethyl ether (1.5 L) with stirring. The solid polymer was isolated by filtration and was washed with ether before being dried under vacuum. The yield of polymer was 48 gm (96%) with a molecular weight of about 5000 by GPC.
Example 7
Preparation of Peg-Nicotine Conjugate by Reaction with Ethylene Oxide: Ether Linkage to Nicotine at 3-Position. Molecular Weight of about 4.7 KD. KH as Base
(159) ##STR00025##
(160) A solution of trans-3-hydroxymethylnicotine (1.92 gm, 1.010.sup.2 moles) was prepared in dry dioxane (100 mL). This solution was brought to reflux and a portion of the dioxane (50 mL) was allowed to distill from the flask to remove water. The flask and contents were cooled to room temperature under argon. The solution was then cooled to 10 C. and potassium hydride (1.34 gm, 1.49 mL of a 30% suspension in mineral oil, 1.010.sup.2 moles) was added via pipette. This solution was stirred at room temperature for an hour at which point hydrogen evolution had stopped.
(161) Dry THF (240 mL) was placed in a pressure flask which was cooled in an ice bath under argon. Ethylene oxide (50 gm, 56.7 mL, 1.14 moles) was condensed in a cooled graduated cylinder and this was added to the cooled THF. To this solution was added the alkoxide solution from above and the pressure flask was sealed. The reaction was allowed to warm to room temperature and the flask and contents were stirred at room temperature overnight. The flask was opened and acetic acid (0.6 gm, 1.010.sup.2 moles) was added. After stirring for an additional 30 minutes, the polymer was precipitated by addition to t-butyl methyl ether (1.0 L) with stirring. The solid polymer was isolated by filtration and was washed with TBME (2100 mL). The polymer was partially dried by vacuum under a rubber dam before being recrystallized from 2-propanol (150 mL). The polymer was isolated by filtration and was washed with 2-propanol (50 mL) followed by TBME (100 mL) before being dried under vacuum. The yield of polymer was 42.2 gm (81%) with a molecular weight of about 4700 by NMR.
Example 8
Preparation of Peg-Nicotine Conjugate by Reaction with Ethylene Oxide: Ether Linkage to Nicotine at Position 3-Position. Molecular Weight of about 4.9 KD. KH as Base
(162) ##STR00026##
(163) A solution of trans-3-hydroxymethylnicotine (1.92 gm, 1.010.sup.2 moles) was prepared in dry 2-methyltetrahydrofuran (100 mL). This solution was brought to reflux and a portion of the 2-methyltetrahydrofuran (50 mL) was allowed to distill from the flask to remove water. The flask and contents were cooled to room temperature under argon. The solution was then cooled to 0 C. and potassium hydride (1.34 gm, 1.49 mL of a 30% suspension in mineral oil 1.010.sup.2 moles) was added via pipette. This mixture was stirred at room temperature for 2 hours at which point hydrogen evolution had stopped.
(164) Dry 2-methyltetrahydrofuran (180 mL) was placed in a pressure flask which was cooled in an ice bath under argon. Ethylene oxide (50 gm, 56.7 mL, 1.14 moles) was condensed in a cooled, dry graduated cylinder and this was added to the cooled 2-methyl-tetrahydrofuran. To this solution was added the alkoxide solution from step 1 and the pressure flask was sealed. The reaction was allowed to warm to room temperature. After a period of about 2 hours an exothermic reaction commenced and the temperature rose to 55 C. over the course of 45 minutes. At this point a water bath was used to keep the temperature between 40-50 C. After another 30 minutes the temperature began to fall and the flask and contents were stirred at room temperature overnight. During this period a solid mass had formed and the reaction was heated to 50 C. to provide a pale yellow solution. The flask was opened and acetic acid (0.6 gm, 1.010.sup.2 moles) was added. After stirring for an additional 30 minutes a thin slurry had formed and this was added to t-butyl methyl ether (TBME, 1.0 L) with stirring. The solid polymer which separated was isolated by filtration and was washed with TBME (2100 mL). The polymer was partially dried by vacuum under a rubber dam before being recrystallized from 2-propanol (200 mL). The polymer was isolated by filtration and was washed with 2-propanol (50 mL) followed by TBME (250 mL) before being dried under vacuum at 30 C. The yield of polymer was 42.7 gm (82.3%) with a molecular weight of about 4900 by NMR.
Example 9
Preparation of Peg-Nicotine Conjugate by Reaction with Ethylene Oxide: Ether Linkage to Nicotine at Position 3-Position. Molecular Weight of about 0.6 KD. KH as Base
(165) ##STR00027##
(166) A solution of trans-3-hydroxymethylnicotine (3.85 gm, 2.010.sup.2 moles) was prepared in dry 2-methyltetrahydrofuran (200 mL). This solution was brought to reflux and a portion of the 2-methyltetrahydrofuran (100 mL) was allowed to distill from the flask to remove water. The flask and contents were cooled in an ice bath under argon. The solution was then treated with potassium hydride (2.68 gm, 3.0 mL of a 30% suspension in mineral oil, 2.010.sup.2 moles) was added via pipette. This mixture was stirred at room temperature for 1 hour at which point hydrogen evolution had stopped. After cooling on ice again ethylene oxide (8.8 gm, 9.9 mL, 0.20 moles) was condensed in a cooled, dry graduated cylinder. The ethylene oxide was added to the cooled reaction and the pressure flask was sealed. The reaction was warmed to 55 C. in an oil bath which caused an exothermic reaction to begin and the temperature rose to 65 C. At this point a water bath was used to keep the temperature between 40-50 C. and the flask and contents were stirred at room temperature overnight. The flask was opened and acetic acid (3.6 gm, 6.010.sup.2 moles) was added. After stirring for an additional 30 minutes the hazy solution was decanted through a cotton plug and the 2-methyltetrahydrofuran was removed under vacuum. The residual oil was dissolved in methylene chloride and was washed with 10% potassium carbonate solution (200 mL). After drying over magnesium sulfate the solution was filtered and evaporated under vacuum. The residual oil was washed by decantation with hexane (350 mL) to remove mineral oil and was then purified by chromatography on silica gel using 10% methanol in methylene chloride as eluent. The fractions containing the product were pooled and evaporated to give the polymer as a pale yellow oil. The yield of polymer was 10.5 gm (83%) with a molecular weight of about 600 by NMR.
Example 10
Preparation of Peg-Nicotine Conjugate by Reaction with Ethylene Oxide: Ether Linkage to Nicotine at Position 3-Position. Molecular Weight of about 2 KD. KH as Base
(167) ##STR00028##
(168) A solution of trans-3-hydroxymethylnicotine (3.85 gm, 2.010.sup.2 moles) was prepared in dry 2-methyltetrahydrofuran (300 mL). This solution was brought to reflux and a portion of the 2-methyltetrahydrofuran (100 mL) was allowed to distill from the flask to remove water. The flask and contents were cooled in an ice bath under argon. The solution was then treated with potassium hydride (2.68 gm, 3.0 mL of a 30% suspension in mineral oil, 2.010.sup.2 moles) was added via pipette. This mixture was stirred at room temperature for 2 hours at which point hydrogen evolution had stopped. After cooling on ice again ethylene oxide (40 gm, 44.9 mL, 0.91 moles) was condensed in a cooled, dry graduated cylinder. The ethylene oxide was added to the cooled reaction and the pressure flask was sealed. The flask and contents were stirred at room temperature overnight. The flask was opened and acetic acid (1.8 gm, 3.010.sup.2 moles) was added. After stirring for an additional 30 minutes the hazy solution was decanted through a cotton plug and was added to diethyl ether (1.0 L) with vigorous stirring. After settling, the solid polymer was isolated by filtration and was washed with ether before being dried under vacuum. The solid polymer was dissolved in boiling tetrahydrofuran (300 mL) and, after cooling, the solution was filtered through a thin pad of Celite to remove insoluble material. The clear filtrates were diluted with diethyl ether (600 mL) and this solution was cooled on ice for 2 hours with stirring. The polymer which had separated was isolated by filtration and was washed with ether before being dried under vacuum. The yield of polymer was 30 gm (68%) with a molecular weight of about 2 KD by NMR.
Example 11
Preparation of a PolylactideBlock Poly(Ethylene)Glycol Nicotine Conjugate Using the Poly(Ethylene)Glycol Nicotine Conjugate from Example 1
(169) ##STR00029##
(170) A 100 mL round bottom flask, equipped with a stir bar and reflux condenser was charged with the PEG/nicotine polymer (0.081 gm, 2.210.sup.5 moles) from example 1, D/L lactide (0.410 gm, 2.8510.sup.3 moles) and anhydrous sodium sulfate (0.380 gm). This was dried under vacuum at 55 C. for 8 hours. The flask was cooled and flushed with argon and then dry toluene (10 mL) was added. The flask was placed in an oil bath set at 120 C., and once the lactide had dissolved, tin ethylhexanoate (5.5 mg, 1.3610.sup.5 moles) was added. The reaction was allowed to proceed at 120 C. for 16 hours. After cooling to room temperature, water (15 mL) was added and stirring was continued for 30 minutes. Methylene chloride (200 mL) was added, and after agitation in a separatory funnel, the phases were allowed to settle. The methylene chloride layer was isolated and dried over anhydrous magnesium sulfate. After filtration to remove the drying agent, the filtrates were evaporated under vacuum to give the polymer as a colorless foam. The polymer was dissolved in tetrahydrofuran (10 mL) and this solution was slowly added to water (150 mL) with stirring. The precipitated polymer was isolated by centrifugation and the solid was dissolved in methylene chloride (10 mL). The methylene chloride was removed under vacuum and the residue was dried under vacuum. The yield was 0.38 gm.
Example 12
Preparation of a PolylactideBlock Poly(Ethylene)Glycol Nicotine Conjugate Using the Poly(Ethylene)Glycol Nicotine Conjugate from Example 3
(171) ##STR00030##
(172) The poly(ethylene)glycolnicotine conjugate made as described in Example 2 (190 mg, 4.8610.sup.5 moles), D/L lactide (911 mg, 6.310.sup.3 moles), and sodium sulfate (844 mg) were dried under vacuum at 50 C. for 8 hours. To the dried mixture was added dry toluene (20 mL). The flask was purged with nitrogen and heated to 120 C. After stirring for 10 minutes, tin (II) ethylhexanoate (10 L) was added and the reaction was stirred at 120 C. overnight under nitrogen. After cooling water (10 mL) was added and stirring was continued for 15 minutes. Methylene chloride (100 mL) was added along with additional water (20 mL). After agitation, the layers were settled and the organic layer was isolated and dried over magnesium sulfate. The solution was filtered and evaporated under vacuum to give the product as a pale brown waxy solid in a yield of 880 mg.
Example 13
Preparation of a PolylactideBlock Poly(Ethylene)Glycol Nicotine Conjugate Using the Poly(Ethylene)Glycol Nicotine Conjugate from Example 4
(173) ##STR00031##
(174) The PEG-nicotine conjugate (5.0 gm, 2.510.sup.3 moles) made as described in Example 4 and D/L lactide (15 gm, 0.104 moles) were combined in toluene (300 mL). The mixture was heated to reflux and toluene (30 mL) was allowed to distill from the flask to remove water. After cooling slightly, tin (II) ethylhexanoate (300 L) was added. Heating at 120 C. was continued overnight. After cooling the toluene was removed under vacuum and the residue was dissolved in chloroform (200 mL). This solution was washed with water (200 mL) and then dried over magnesium sulfate. After filtering the solution free from the magnesium sulfate, the filtrates were evaporated under vacuum to a volume of about 40 mL. This solution was stirred as 2-propanol (300 mL) was slowly added. After stirring for 5 minutes, the 2-propanol was decanted from the polymer mass and the polymer was dried under vacuum. The product was obtained as a light brown waxy solid in a yield of 14.8 gm. Molecular weight by NMR was about 9 KD.
Example 14
Preparation of a PolylactideBlock Poly(Ethylene)Glycol Nicotine Conjugate Using the Poly(Ethylene)Glycol Nicotine Conjugate from Example 6
(175) ##STR00032##
(176) A 1000 mL round bottom flask, equipped with a stir bar and reflux condenser was charged with the PEG/nicotine polymer (5.0 gm, 1.010.sup.3 moles) described in example 6, D/L lactide (18.7 gm, 0.13 moles) and toluene (400 mL). A portion of the toluene (50 mL) was distilled from the flask to remove any water present and the solution was then cooled to about 100 C. and flushed with argon. The flask was placed in an oil bath set at 120 C. and tin ethylhexanoate (250 L) was added. The reaction was allowed to proceed at 120 C. for 16 hours under argon with stirring. After cooling to room temperature the toluene was removed under vacuum and the remaining polymer was dissolved in methylene chloride (250 mL). Water (250 mL) was added and this mixture was shaken in a separatory funnel. The phases were allowed to settle and the methylene chloride layer was isolated and dried over anhydrous sodium sulfate. After filtration to remove the drying agent, the filtrates were evaporated under vacuum to a volume of approximately 50 mL. This solution was stirred as 2-propanol (300 mL) was added which caused the polymer to precipitate as a sticky mass. The precipitated polymer was isolated by decantation of the 2-propanol which was a milky fluid. Any remaining 2-propanol was removed under vacuum before the polymer was dried under high vacuum. The polymer was isolated as an off white solid in a yield of 17 gm (72%).
(177) By NMR, the polymer had a lactide CH to PEG CH.sub.2CH.sub.2 ratio of 2.1/4. If the PEG has a molecular weight of 5000 then the PLA has a molecular weight of 17,200.
Example 15
Preparation of a PolylactideBlock Poly(Ethylene)Glycol Nicotine Conjugate Using the Poly(Ethylene)Glycol Nicotine Conjugate from Example 7
(178) ##STR00033##
(179) A 500 mL round bottom flask, equipped with a stir bar and reflux condenser was charged with the PEG/nicotine polymer (5.0 gm, 1.010.sup.3 moles), D/L lactide (18.7 gm, 0.13 moles) and toluene (100 mL). A portion of the toluene (50 mL) was distilled from the flask to remove any water present and the solution was then cooled to about 100 C. and flushed with argon. The flask was placed in an oil bath set at 120 C. and tin ethylhexanoate (200 L) was added. The reaction was allowed to proceed at 120 C. for 16 hours under argon with stirring. After cooling to room temperature methylene chloride (250 mL) was added along with water (200 mL) and this mixture was shaken in a separatory funnel. The phases were allowed to settle and the methylene chloride layer was isolated and dried over anhydrous sodium sulfate. After filtration by decantation through a cotton plug to remove the drying agent, the filtrates were evaporated under vacuum to a volume of approximately 50 mL. This solution was stirred as 2-propanol (300 mL) was added which caused the polymer to precipitate as a sticky mass. The precipitated polymer was isolated by decantation of the 2-propanol which was a milky fluid. After washing with 2-propanol (50 mL) by decantation, any remaining 2-propanol was removed under vacuum before the polymer was dried under high vacuum. The polymer was isolated as an off white solid in a yield of 18 gm (76%).
(180) By NMR, assuming that the PEG has a molecular weight of 5000 then the PLA has a molecular weight of 21,500 (theoretical PLA Mw=18,700).
Example 16
Preparation of a PolylactideBlock Poly(Ethylene)Glycol Nicotine Conjugate Using the Poly(Ethylene)Glycol Nicotine Conjugate from Example 8
(181) ##STR00034##
(182) A 1.0 liter round bottom flask, equipped with a stir bar and reflux condenser was charged with the PEG/nicotine polymer (25.0 gm, 5.010.sup.3 moles) prepared as described in Example 8, D/L lactide (93.7 gm, 0.65 moles) and toluene (350 mL). A portion of the toluene (100 mL) was distilled from the flask to remove any water present and the solution was then cooled to about 100 C. and flushed with argon. The flask was placed in an oil bath set at 120 C. and tin ethylhexanoate (1.0 mL) was added. The reaction was allowed to proceed at 120 C. for 16 hours under argon with stirring. After cooling to room temperature, 2-propanol (500 mL) was added with vigorous stirring. After stirring for 15 minutes, the polymer mass was isolated by decantation of the liquid supernatant. To the polymer was added additional 2-propanol (500 mL). This mixture was heated to 65 C. with stirring to provide a hazy solution. The solution was cooled on ice to a temperature of 20 C. which caused the polymer to separate as a viscous mass. The supernatant was decanted from the polymer mass and remaining 2-propanol was removed under vacuum on a rotary evaporator before the polymer was dried under high vacuum at 30 C. for 3 days. The polymer was isolated as a white solid in a yield of 95 gm (80%).
(183) By NMR, assuming that the PEG had a molecular weight of 5000 then the PLA had a molecular weight of 21,200. Remaining lactide was 1.2% by weight.
Example 17
Preparation of a PolylactideBlock Poly(Ethylene)Glycol Nicotine Conjugate Using Organic Base Catalyzed Ring Opening Polymerization
(184) ##STR00035##
Step-1. Polymerization of dl-lactide with HO-PEG-Nic:
(185) A 100 mL round bottom flask, equipped with a stir bar, an azeotrope collector with a reflux condenser with drying tube on top was charged with HO-PEG-Nic (2.5 gm, 0.0005 mol) prepared as in Example 8, dl-lactide recrystallized from EtOAc (9.4 gm, 0.065 mol) and anhydrous toluene (50 mL). A portion of the toluene (25-26 mL) was distilled from the flask to remove any water present (oil bath temperature is ca. 150 C.; it takes about 30 min to collect 25 mL of toluene and the distillate was not allowed to return to flask). The oil bath temperature was then lowered to ca. 105-110 C. while the azeotrope collector was removed and the drying tube on top of the condenser was replaced with argon balloon (or dry inert gas inlet). Once the oil bath temperature reached ca. 100 C., 1,5,7-triazabicyclo[4.4.0]dec-5-ene (TBD, 0.07 gm, 0.0005 mol) was added to the hot solution which was stirred overnight (17 h) under argon at oil bath temperature of 100 C. The oil bath was removed and the clear pale yellow solution was then cooled to RT (ice water was used for rapid cooling). The dense solution was then added to a solution of 2-propanol (100 mL) with vigorous stirring and a sticky gel-like polymer precipitated out of the solution (the reaction flask was rinsed with ca. 10 mL of 2-propanol to transfer the residue solution. Stirring could be difficult and gentle shaking could be applied). The mixture was stirred or shaken for ca. 10 min and then allowed to settle. The top milky 2-propanol supernatant was then decanted (residue 2-propanol could be removed on a Rotavap). The residue polymer was then dissolved in 30 mL of EtOAc and transferred to an additional funnel (the flask is rinsed with ca. 5 mL of EtOAc, total volume was about 55 mL).
(186) Step-2. Isolation of PLA-PEG-NIC polymer:
(187) A 500 mL RB flask equipped a stirring bar was charged with 250 mL of hexane and cooled with dry ice-acetone bath to <50 C under dry condition (bath temperature 78 C.). With vigorous stirring, the polymer solution in EtOAc from Step-1 was added drop wise into the cold hexane from the addition funnel. Polymers precipitated out of the solution as lumpy solids during the addition. After the addition was complete, the cooling bath was removed and the resulting mixture was allowed to warm to room temperature. The lumpy solid polymers were collected by filtration on a Buchner funnel equipped with a Grade-3 filter paper. The flask and the polymers were rinsed with ca. 20 mL of hexane. After drying under vacuum at ambient temperature to remove residue solvent, PLA-PEG-NIC was isolated as white granular solids (11.0 g, 92.4%) (GPC: MW=24430, Mn=12600, PDI=1.9).
Example 18
Preparation of a PolylactideBlock Poly(Ethylene)Glycol Nicotine Conjugate Using Organic Base Catalyzed Ring Opening Polymerization
(188) ##STR00036##
Step-1. Polymerization of dl-lactide with HO-PEG-Nic:
(189) A 200 mL round bottom flask, equipped with a stir bar, an azeotrope collector with a reflux condenser with drying tube on top was charged with HO-PEG-Nic (MW: 5800 by GPC, 2.5 gm, 0.00043 mol), dl-lactide (9.4 gm, 0.065 mol) and anhydrous toluene (50 mL). A portion of the toluene (25 mL) was distilled from the flask to remove any water present (oil bath temperature was ca. 150 C.). The oil bath temperature was then lowered to ca. 100 C. while the azeotrope collector was removed and the drying tube on top of the condenser was replaced with argon balloon (or dry inert gas inlet). Once the oil bath temperature reached ca. 100 C., 1,8-Diazabicyclo[5.4.0]undec-7-ene (DBU, 0.065 gm, 0.00043 mol) was added to the hot solution which was stirred overnight (18 h) under argon at oil bath temperature of 100 C. The oil bath was removed and the clear pale yellow solution was then cooled to RT (ice water was used for rapid cooling). 2-propanol (100 mL) was then added to the solution with vigorous stirring and a sticky gel-like polymer precipitated out of the solution. The mixture was stirred for ca. 10 min and then allowed to settle. The top milky 2-propanol supernatant was then decanted. The residue polymer was then dissolved in 25 mL of EtOAc and transferred to an additional funnel (the flask was rinsed with ca. 5 mL of EtOAc, total volume was about 57 mL).
(190) Step-2. Isolation of PLA-PEG-NIC polymer:
(191) A 500 mL RB flask equipped a stirring bar was charged with 250 mL of heptane and cooled with dry ice-acetone bath to <50 C. under dry condition (bath temperature 78 C.). With vigorous stirring, the polymer solution in EtOAc from Step-1 was added drop wise into the cold heptane from the addition funnel. Polymers precipitated out the solution as hard solids during the addition. After the addition was complete, cooling bath was removed and the resulting mixture was allowed to warm to room temperature. The hard solid polymers were collected by filtration on a Buchner funnel equipped with a Grade-3 filter paper. The flask and the polymers were rinsed with ca. 50 mL of heptane. After drying under vacuum at ambient temperature to remove residue solvent, PLA-PEG-NIC was isolated as white granular solids (11.1 g, 94%) (GPC: MW=24680, PDI=1.4).
Example 19
Preparation of (2S, 3S)- and (2R, 3R)-hydroxylmethylnicotine
(192) ##STR00037##
Preparation of racemic trans-4-cotininecarboxylic acid
(193) A one liter flask was charged with 3-pyridinecarboxaldehyde (107 g, 1.0 mol, 97%) and 400 mL of toluene (ACS reagent grade). The solution was cooled with ice water and a solution of methylamine in methanol (33 wt %, 185 mL, 1.5 mol) was added via an addition funnel. The resulting solution was stirred at rt for 1 h. K2CO3 (50 g) was added and the mixture was stirred at rt for 1 h and then 30 g of anhydrous MgSO4 was added. The mixture was filtered and the solid was washed with 250 L of toluene. The filtrate was then refluxed for about 1 h. The solution was then concentrated and azeotroped with toluene or heptane to dryness to give crude N-3-pyridylidenemethylamine which was used without further purification (H NMR).
(194) The crude imine was then dissolved in m-xylene (120 mL) and succinic anhydride (100 g, 1.0 mol, 1.0 eq) was added. The resulting mixture was heated at reflux for 22-30 h (a dark brown heavy mixture). The mixture was cooled to rt and the crude product solidified at bottom of the flask. m-Xylene was then decanted away (although not tried, m-xylene could be left in the flask during the workup) and the residue solids were carefully dissolved with 10% aq. NaHCO3 (1.6 L) with cooling (release of CO2) to ca. pH 8.5. The aqueous mixture (remaining m-xylene could be removed at this step) was washed with DCM (2350 mL) and then de-colorized with activated carbon (10 g) (solution was still brown in color).
(195) The pH of the aqueous solution was then adjusted to 4.7 with conc. H3PO4 with cooling to precipitate the product. The mixture was cooled overnight. The white solids were collected and washed with cold water until no color in washes. The solids were dried at 40 C. under vacuum until constant weight as trans-4-cotininecarboxylic acid (103 g). The combined aqueous filtrates (ca. 2 L) were further concentrated to ca. 300 mL and cooled to precipitate out more products (21 g). Total recovery was 124 g (56% yd, H NMR). The product was used without further purification.
(196) Preparation of racemic trans-3-hydroxymethylnicotine
(197) An dried 2-L three neck flask equipped with a thermometer, an addition funnel and a reflux condenser was charged with trans-4-cotininecarboxylic acid from procedure-(1) (36 g, 0.16 mol, 1.0 eq) and dry THF (200 mL) under argon. The white suspension was cooled with ice water (internal temperature 5-10 C). BH3.THF (1.0 M in THF, 800 mL, 0.8 mol, 5 eq) was added drop-wise through the funnel while maintaining the internal temperature at 10-20 C (gas evolution during addition). After addition, the resulting mixture was heated to reflux for 40 h (a clear solution was formed. The product forms a strong complex with borane. In order to check the reaction, an aliquot was quenched with 6 N HCl with heating and then basified with NaOH and extracted with DCM. On TLC (20% MeOH in DCM), the original less polar borane complex was converted to the more polar product). The solution was cooled with ice water and MeOH (200 mL) was added drop wise at 10-20 C. with caution to destroy excess BH3.THF (gas evolution). The mixture was stirred at rt for 1 h and was concentrated to ca. 150 mL in volume. The concentrate was cooled and conc. HCl (36%, 12 N, 130 mL, 1.6 mol) was added with caution. The solution was warmed to rt and concentrated to remove most of the MeOH. The residual aq. solution was heated at reflux overnight (ca. 14 h) to destroy the borane-product complex and then cooled with ice water. DCM (300 mL) was added and solid NaOH (ca. 40 g) (the product is soluble in water and minimum amount of aq. phase is maintained) was added in small portions with caution (exotherm) to adjust pH to 10-11 (a thick slurry was formed due to salt formation). The mixture was filtered to remove the solids and the filter cake was washed with DCM (250 mL). The DCM phase was separated from the combined filtrates. The aq. phase was extracted with 3100 mL of DCM. The combined DCM phase was dried over Na2SO4 and concentrated to dryness to give crude trans-3-hydroxymethylnicotine as a yellow liquid (ca. 30 g). The crude product was further purified by vacuum distillation to give pure trans-3-hydroxymethylnicotine (bp 145-155 C/3-4 torr; recovery: 23.4 g from 30 g crude, 76%). Alternatively, the crude product can also be purified by chromatography on silica gel eluting with MeOH in DCM.
(198) Preparation of Optically Pure (+)-(2R, 3R) or ()-(2S, 3S)-hydroxymethylnicotine by Chiral Resolution of Optically Racemic trans-3-hydroxymethylnicotine
(199) Racemic trans-3-hydroxymethylnicotine prepared from above procedure is subjected to chiral separation on a Chiral Daicel IC column (21250 mm, 5 m). The detailed conditions are as follows:
(200) Column: Chiral Daicel IC, 21250 mm, 5 m
(201) Mobile phase: CO2/MeOH (0.5% Diethylamine)=70:30
(202) Flow rate: 50 mL/min
(203) Injection amount: 1.2 mL (100 mg)
(204) Temperature: 40 C.
(205) Wave length: 254 nm
(206) Sample preparation: 27 g of racemic trans-3-hydroxymethylnicotine is dissolved in 324 mL MeOH (containing 0.5% diethylamine).
(207) Operational Procedure: A preparative SFC80 (Waters) instrument is set-up using stack-injection program (1.2 mL per injection, 100 mg compound, total 270 injections). A binary pump is used to deliver CO2 (liquid) and MeOH (with total 0.5% DEA). Each cycle is set-up for 4 min. The Peak #1 is collected during 2.05-2.25 min and Peak #2 is collected during 2.30-2.55 min. After the completion, CO2 is evaporated, all Peak #1 and Peak #2 fractions are combined separately. The residues are concentrated at 35-45 C./5-10 mmHg until dryness.
(208) Thus, from 27 g of racemic trans-3-hydroxymethylnicotine, 10.1 g of ()-(2S, 3S)-hydroxymethylnicotine (Peak #1. Chemical purity: 99.8%, ee: 98.76%, Optical rotation: [].sub.D25=42.678, c=2.14% in MeOH) and 8.3 g of (+)-(2R, 3R)-hydroxymethylnicotine (Peak #2. Chemical purity: 99.9%, ee: 99.9%, Optical rotation: [].sub.D.sup.25=+42.689 c=2.12% in MeOH) are obtained.
(209) The absolute configurations are determined by X-ray crystallography on the ester derivative of ()-3-hydroxymethylnicotine (Peak #1) with 6-S-methoxynaphthalinyl-2-propanoic acid which confirmed that ()-3-hydroxymethylnicotine has the (2S, 3S)-configuration and (+)-3-hydroxymethylnicotine has the (2R, 3R)-configuration.
Example 20
Preparation of (2S, 3S)- and (2R, 3R)-PEG-Nic by Reaction with Ethylene Oxide
(210) Following Example 8, (2R, 3R)-PEG-Nic with MW of 5580 or (2S, 3S)-PEG-Nic with MW of 4280 was prepared by ring opening polymerization of ethylene oxide with the corresponding (+)-(2R, 3R) or ()-(2S, 3S)-hydroxymethylnicotine from Example 19.
Example 21
Preparation of PEG-Nicotine Conjugates: Nicotine Linker at 6-Position. Molecular Weight of about 3.5 KD. (Prophetic)
(211) ##STR00038##
(212) 6-substituted (S)-nicotine ((S)-trans-4-[3-(5-(1-methyl-2-pyrrolidnyl)-2-pyridinyl)propyl]cyclohexanecarboxylic acid) is prepared according to procedures as described in PCT WO 01/70730 A1 (165 mg, 0.5 mmol, 1.1 eq) and HO-PEG-NH2.HCl (MW 3500, 1.6 g, 0.45 mmol, 1.0 eq) are dissolved in dry DCM (10 mL). EDC.HCl (115 mg, 0.6 mmol, 1.2 eq) and N-hydroxysuccinimide (NHS) (70 mg, 0.6 mmol, 1.2 eq) are added, followed by triethylamine (0.2 mL). The mixture is stirred at ambient temperature overnight under nitrogen. The solution is concentrated and the residue is precipitated out from 100 mL diethyl ether. After washing with 10% MeOH in diethyl ether (100 mL) and diethyl ether (50 mL), the resulting PEG-(S)-Nicotine conjugate is dried under vacuum as a white solid (1.5 g, MW ca. 3500).
Example 22
Preparation of a PolylactideBlock Poly(Ethylene)Glycol Nicotine Conjugate Using the Poly(Ethylene)Glycol Nicotine Conjugate from Example 21 (Prophetic)
(213) ##STR00039##
(214) A mixture of PEG-(S)-Nicotine conjugate from Example 21 (1.5 g, 0.4 mmol, 1.0 eq) and dl-lactide (7.9 g, 59 mmol, 138 eq) in 60 mL dry toluene is heated to reflux while ca. 20 mL of toluene is collected via azeotrope distillation to remove residual water in the reaction. The resulting solution is cooled to ca. 90 C and Sn(Oct)2 (81 mg, 0.2 mmol) is added. The solution is then heated to reflux under argon overnight (15-18 h) and cooled with ice water to ambient temperature. The cooled solution is then added to 300 mL of 2-propanol with vigorous stirring and a gel-like polymer is formed. The mixture is stirred or shaken for 20 min and allowed to settle. The top 2-propanol layer is decanted and the residue is washed sequentially with 2-propanol (50 mL) and t-butyl methylether (50 mL). The gel-like polymer is then dried under vacuum at 35 C to constant weight to give PLA-PEG-(S)-nicotine conjugate as a white solid (ca. 8 g recovery, Mn by H NMR is 23,000).
Example 23
Preparation of Polypropylenesulfide-Nicotine Conjugates by Reaction with Propylene Sulfide: Thioether Linkage to Nicotine at Position 6. DBU Catalysis (Prophetic)
(215) ##STR00040##
(216) 6-hydroxypropylnicotine is prepared according to the literature preparation [Seeman et al, Journal of Organic Chemistry 51, 1548, (1986)]. This compound is converted to the mercaptan by reaction with thiourea in the presence of concentrated hydrochloric acid [Buter and Kellogg, Organic Syntheses, Collective Volume 8, 592, (1993)]. This mercaptan is used to initiate ring opening polymerization of propylene sulfide in the following manner.
(217) A solution of 6-mercaptopropylnicotine (4.73 gm, 2.010.sup.2 moles) is prepared in dry 2-methyltetrahydrofuran (300 mL). This solution is brought to reflux and a portion of the 2-methyltetrahydrofuran (100 mL) is allowed to distill from the flask to remove water. The flask and contents are cooled in an ice bath and the flask is flushed with argon. The solution is then treated with DBU (1,8-diazabicyclo[5,4,0]undec-7-ene, 3.04 gm, 2.010.sup.2 moles). This mixture is stirred at room temperature for 1 hour and is then cooled on ice again. Propylene sulfide (66.7 gm, 70 mL, 0.90 moles) is added to the cooled reaction and the flask is sealed under argon. The flask and contents are stirred at room temperature for 4 hours after which 2-bromoethanol (3.1 gm, 1.77 mL, 2.510.sup.2 moles) is added. Stirring at room temperature is continued overnight. The resulting solution is evaporated under vacuum and the oily residue is dissolved in methylene chloride (300 mL) and this solution is washed with water (2100 mL). After drying over sodium sulfate, the solution is filtered and evaporated under vacuum. After drying under high vacuum there is obtained 51.8 gm (70%) of a polypropylene sulfide (PPS) conjugate of nicotine terminated with an alcohol function.
Example 24
Preparation of a PolycaprolactoneBlock Polypropylene Sulfide-Nicotine Conjugate Using the Polypropylene Sulfide-Nicotine Conjugate from Example 21 (Prophetic)
(218) ##STR00041##
(219) The PPS-nicotine conjugate (9.24 gm, 2.510.sup.3 moles), made as described in Example 21, and -caprolactone (11.9 gm, 0.104 moles) are combined in toluene (300 mL). The mixture is heated to reflux and toluene (30 mL) is allowed to distill from the flask to remove water. After cooling slightly, tin (II) ethylhexanoate (300 L) is added. Heating at 120 C. is continued overnight. After cooling the toluene is removed under vacuum and the residue is dissolved in chloroform (200 mL). This solution is washed with water (200 mL) and then dried over magnesium sulfate. After filtering the solution free from the magnesium sulfate, the filtrates are evaporated under vacuum to a volume of about 40 mL. This solution is stirred as 2-propanol (300 mL) is slowly added. After stirring for 5 minutes, the 2-propanol is decanted from the polymer mass and the polymer is dried under vacuum. The product was obtained as a light brown waxy solid in a yield of 16 gm (76%).
Example 25
Preparation of Polyethyloxazoline-Nicotine Conjugate by Reaction with 2-ethyl-2-oxazoline: Amine Linkage to Nicotine at Position 3. (Prophetic)
(220) ##STR00042##
(221) The toluenesulfonate ester of 3-hydroxymethylnicotine is prepared by the literature method [Sanderson et al, International Immunopharmacology, 3, 137, (2003)].
(222) A solution of the toluenesulfonate ester of 3-hydroxymethylnicotine (1.68 gm, 5.010.sup.3 moles) and 2-ethyl-2-oxazoline (24.8 gm, 0.25 moles) in acetonitrile (75 mL) is heated in a sealed pressure flask under argon at 100 C. for 24 hours. After cooling to room temperature, the flask is opened and a solution of potassium hydroxide in methanol (1.0 N, 10 mL). After stirring for 30 minutes, the solution is filtered through a pad of silica and the filtrate is added to diethyl ether (1.0 L) to precipitate the polymer. The solid polymer is isolated by filtration and dried under vacuum.
Example 26
Preparation of Polyethyleneimine-Nicotine Conjugate by Hydrolysis of Polyethyloxazoline-Nicotine: Amine Linkage to Nicotine at Position 3. (Prophetic)
(223) ##STR00043##
(224) To a mixture of ethanol (100 mL) and concentrated hydrochloric acid (50 mL) is added the polyethyloxazoline-nicotine conjugate from above (10.0 gm). This mixture is stirred under argon and heated at reflux for 24 hours. After cooling, the ethanol and excess hydrochloric acid are removed under vacuum. The residue is stirred in ethanol (100 mL) and a solution of potassium hydroxide (5.6 gm, 0.10 moles) in ethanol (100 mL) is slowly added with stirring. After the addition is complete, the potassium chloride is removed by filtration and the filtrates are evaporated under vacuum. The residual polymer is dried under high vacuum.
Example 27
Preparation of a polylactide-co-glycolideBlock Ethyloxazoline-Nicotine Conjugate Using the Polyoxazoline-Nicotine Conjugate from Example 24. (Prophetic)
(225) ##STR00044##
(226) A 500 mL round bottom flask, equipped with a stir bar and reflux condenser is charged with the polyethyloxazoline-nicotine polymer (5.0 gm, 1.010.sup.3 moles) from example 24, D/L lactide (14.4 gm, 0.10 moles), glycolide (3.48 gm, 0.03 moles) and toluene (100 mL). A portion of the toluene (50 mL) is distilled from the flask to remove any water present and the solution is then cooled to about 100 C. and flushed with argon. The flask is placed in an oil bath set at 120 C. and tin ethylhexanoate (200 L) is added. The reaction is allowed to proceed at 120 C. for 16 hours under argon with stirring. After cooling to room temperature methylene chloride (250 mL) is added along with water (200 mL) and this mixture is shaken in a separatory funnel. The phases are allowed to settle and the methylene chloride layer is isolated and dried over anhydrous sodium sulfate. After filtration by decantation through a cotton plug to remove the drying agent, the filtrates are evaporated under vacuum to a volume of approximately 50 mL. This solution is stirred as 2-propanol (300 mL) is added which causes the polymer to precipitate as a sticky mass. The precipitated polymer is isolated by decantation of the 2-propanol. After washing with 2-propanol (50 mL) by decantation, any remaining 2-propanol is removed under vacuum before the polymer is dried under high vacuum.
Example 28
Preparation of Amide-Nicotine Conjugates by Polymerization of an Amino Acid N-carboxyanhydride: Amine Linkage to Nicotine at Position 1. (Prophetic)
(227) ##STR00045##
(228) A solution of nornicotine (0.74 gm, 5.010.sup.3 moles) and 2,5-oxazolidinedione
(229) (25.3 gm, 0.25 moles) in dry dichloromethane (100 mL) is stirred under argon at room temperature for 5 days. The resulting solution is slowly poured into diethyl ether (1 L) with vigorous stirring. The polymer which separates is isolated by filtration, washed with ether and dried under vacuum.
Example 29
Synthetic Nanocarriers, Containing the Adjuvant Resiquimod and a Protein, using the Inventive Compound of Example 16
(230) Resiquimod (aka R848) was synthesized according to the synthesis provided in Example 99 of U.S. Pat. No. 5,389,640 to Gerster et al. A PLA-PEG-nicotine conjugate was prepared at Selecta Biosciences using the method of example 16. PLA was prepared by a ring opening polymerization using D,L-lactide (MW=approximately 15 KD18 KD). The PLA-PEG-nicotine and PLA structures were confirmed by NMR and the molecular weights were determined by GPC. The polyvinyl alcohol (Mw=11 KD31 KD, 85% hydrolyzed) was purchased from VWR scientific. These were used to prepare the following solutions: 1. Resiquimod in methylene chloride @ 7.5 mg/mL 2. PLA-PEG-nicotine in methylene chloride @ 100 mg/mL 3. PLA in methylene chloride @ 100 mg/mL 4. Peptide in water @ 10 mg/mL, the peptide having the sequence:
(231) TABLE-US-00001 SEQIDNO.1 ILMQYIKANSKFIGIPMGLPQSIALSSLMVAQ 5. Polyvinyl alcohol in water @50 mg/mL.
(232) Solution #1 (0.4 mL), solution #2 (0.4 mL), solution #3 (0.4 mL) and solution #4 (0.1 mL) were combined in a small vial and the mixture was sonicated at 50% amplitude for 40 seconds using a Branson Digital Sonifier 250. To this emulsion was added solution #5 (2.0 mL) and sonication at 35% amplitude for 40 seconds using the Branson Digital Sonifier 250 formed the second emulsion. This was added to a beaker containing water (30 mL) and this mixture was stirred at room temperature for 2 hours to form the nanoparticles. A portion of the nanoparticle dispersion (1.0 mL) was diluted with water (14 mL) and this was concentrated by centrifugation in an Amicon Ultra centrifugal filtration device with a membrane cutoff of 100 KD. When the volume was about 250 L, water (15 mL) was added and the particles were again concentrated to about 250 L using the Amicon device. A second washing with phosphate buffered saline (pH=7.5, 15 mL) was done in the same manner and the final concentrate was diluted to a total volume of 1.0 mL with phosphate buffered saline. This provided a final nanoparticle dispersion of about 2.7 mg/mL in concentration. These nanoparticles contained both resiquimod and a protein encapsulated within the nanoparticle with nicotine displayed on the surface of the nanoparticle.
Example 30
Synthetic Nanocarriers Containing the Adjuvant Resiquimod, Using the Inventive Compound of Example 13
(233) Resiquimod (aka R848) was synthesized according to the synthesis provided in Example 99 of U.S. Pat. No. 5,389,640 to Gerster et al and was attached to PLA using HOBT as condensing agent. The PLA-PEG-nicotine conjugate was prepared at Selecta Biosciences using the method of Example 13. PLA was prepared by a ring opening polymerization using D,L-lactide (MW=approximately 15 KD-18 KD). The PLA-PEG-nicotine and PLA structures were confirmed by NMR and the molecular weights were determined by GPC. The polyvinyl alcohol (Mw=11 KD-31 KD, 85% hydrolyzed) was purchased from VWR scientific. These were used to prepare the following solutions: 1. PLA-R848 conjugate @ 100 mg/mL in methylene chloride 2. PLA-PEG-nicotine in methylene chloride @ 100 mg/mL 3. PLA in methylene chloride @ 100 mg/mL 4. Polyvinyl alcohol in water @50 mg/mL.
(234) Solution #1 (0.25 to 0.75 mL), solution #2 (0.25 mL), and solution #3 (0.25 to 0.5 mL) were combined in a small vial and the mixture was sonicated at 50% amplitude for 40 seconds using a Branson Digital Sonifier 250. To this emulsion was added solution #4 (2.0 mL) and sonication at 35% amplitude for 40 seconds using the Branson Digital Sonifier 250 formed the second emulsion. This was added to a beaker containing phosphate buffer solution (30 mL) and this mixture was stirred at room temperature for 2 hours to form the nanoparticles. To wash the particles a portion of the nanoparticle dispersion (7.0 mL) was transferred to a centrifuge tube and spun at 5,300 g for one hour, supernatant was removed, and the pellet was re-suspended in 7.0 mL of phosphate buffered saline. The centrifuge procedure was repeated and the pellet was re-suspended in 2.2 mL of phosphate buffered saline for a final nanoparticle dispersion of about 10 mg/mL. These nanoparticles contained the adjuvant, resiquimod, covalently attached to PLA situated in the interior of the nanoparticle with nicotine displayed on the surface of the nanoparticle.
Example 31
Immunization with Synthetic Nanocarriers from Example 29 or 30.(Prophetic)
(235) Groups of five mice were immunized three times (subcutaneously, hind limbs) at 2-week intervals (days 0, 14 and 28) with 100 g of synthetic nanocarriers from Example 29 or 30 and serum anti-nicotine antibodies were then measured on days 26, 40 and 54. EC50 for anti-nicotine antibodies are measured with a standard ELISA assay.