Filarial nematode vaccines, polypeptides, and nucleic acids

09994624 ยท 2018-06-12

Assignee

Inventors

Cpc classification

International classification

Abstract

The present invention relates to vaccines comprising a ShK domain of a filarial nematode protein. These vaccines may be used for the prevention and/or treatment of filarial nematode infections. The invention also relates to novel proteins comprising a ShK domain of a filarial nematode protein and pharmaceutical compositions. The invention may be used for the prevention and/or treatment of filarial nematode infections in canine subjects, and also in human subjects.

Claims

1. A polypeptide, comprising at least one polypeptide including: at least one ShK domain of L. sigmoidontis protein nLs_04059 according to SEQ ID NO: 1; and/or at least one polypeptide sharing at least 70 percent identity with said at least one ShK domain, wherein the at least one polypeptide retains 6 cysteine residues with characteristic spacing of a ShK domain; wherein the polypeptide is a chimeric polypeptide comprising an additional antigen from a source other than the filarial nematode from which the Shk domain was obtained.

2. The polypeptide according to claim 1, comprising a plurality of the same ShK domain.

3. The polypeptide according to claim 1, comprising a plurality of different ShK domains.

4. The polypeptide according to claim 1, further comprising an artificial spacer separating the ShK domains.

5. The polypeptide according to claim 4, wherein the spacer comprises poly-L-lysine.

6. The polypeptide according to claim 1, wherein the at least one polypeptide sharing at least 70 percent identity with said at least one ShK domain is from a filarial nematode selected from group consisting of: L. sigmodontis, D. immitis, Wuchereria bancrofti, Brugia malayi, Brugia timori, Onchocerca volvulus, and Loa loa.

7. A nucleic acid, comprising: at least one nucleic acid encoding at least one polypeptide comprising at least one ShK domain of L. sigmoidontis protein nLs_04059 according to SEQ ID NO:I; and/or at least one nucleic acid encoding at least one polypeptide sharing at least 70 percent identity with said at least one Shk domain, wherein the at least one polypeptide retains 6 cysteine residues with characteristic spacing of a ShK domain; wherein the at least one polypeptide is a chimeric polypeptide comprising an additional antigen from a source other than the filarial nematode from which the Shk domain was obtained.

8. The nucleic acid according to claim 7, wherein said nucleic acid is part of an expression vector.

9. The nucleic acid according to claim 8, wherein said expression vector is for expression in E. coli.

10. The nucleic acid according to claim 7, wherein the at least one polypeptide sharing at least 70 percent identity with said at least one ShK domain is from a filarial nematode selected from group consisting of: L. sigmodontis, D. immitis, Wuchereria bancrofti, Brugia malayi, Brugia timori, Onchocerca volvulus, and Loa loa.

11. A method of treating or preventing a filarial nematode infection, comprising the steps of: providing to a subject a therapeutically effective amount of at least one polypeptide comprising at least one ShK domain of L. sigmoidontis protein nLs_04059 according to SEQ ID NO:I and/or at least one polypeptide sharing at least 70 percent identity with said at least one ShK domain, wherein the at least one polypeptide retains 6 cysteine residues with characteristic spacing of a ShK domain wherein the at least one polypeptide is a chimeric polypeptide comprising an additional antigen from a source other than the filarial nematode from which the Shk domain was obtained.

12. The method according to claim 11, further comprising the step of: administering the therapeutically effective amount of the at least one polypeptide.

13. The method according to claim 11, wherein the subject is a human or an animal.

14. The method according to claim 11, wherein the filarial nematode infection includes a disease selected from the group consisting of: lymphatic filariasis, onchocerciasis, and loiasis.

15. The method according to claim 11, wherein the subject is an animal and the filarial nematode infection is heartworm.

16. The method according to claim 11, wherein the at least one polypeptide sharing at least 70 percent identity with said at least one ShK domain is from a filarial nematode selected from group consisting of: L. sigmodontis, D. immitis, Wuchereria bancrofti, Brugia malayi, Brugia timori, Onchocerca volvulus, and Loa loa.

17. The method according to claim 11, wherein the at least one ShK domain and/or the at least one polypeptide sharing at least 70 percent identity with said at least one ShK domain is formulated as a pharmaceutical composition.

18. The method according to claim 11, further comprising the step of: administering a nucleic acid encoding the therapeutically effective amount of the at least one polypeptide.

19. The method according to claim 11, wherein the at least one polypeptide comprises a plurality of the same or different ShK domains.

20. The method according to claim 11, wherein the at least one polypeptide further comprises an artificial spacer separating the ShK domains.

21. The method according to claim 11, wherein the at least one polypeptide further comprises an additional vaccine antigen.

Description

(1) The invention will now be further described with reference to the following Experimental Results and Figures in which:

(2) FIG. 1a illustrates the difference in parasite burden between vaccinated and non-vaccinated mice in Study 1 below;

(3) FIG. 1b. Distribution of ESP proteins between life stages of L. sigmodontis. Venn diagram of the shared and stage-specific ESP proteins in each of the life stages examined.

(4) FIG. 2. Pfam enrichment analysis of ESP proteins against the complete theoretical proteome of L. sigmodontis. The fold-enrichment is displayed for each lifecycle stage; DUF290 represents the transthyretin-like protein family.

(5) FIG. 3. Relative abundance of L. sigmodontis ESP proteins compared to corresponding somatic extracts. ESP proteins (?2 peptides detected at p<0.05 and <1% FDR, present in ?2 biological replicates) were quantified by ion intensity (iBAQ) and compared to the iBAQ abundance of the same protein present in somatic extracts of intact nematodes (x-axis). Individual abundance values were normalised by dividing by the summed total abundance of that individual sample (life stage). The normalised abundance ratio was used as a guide to evaluate the enrichment of the protein (ESP/WBE). Note that as the data are normalised within each life stage dataset, comparing protein abundance directly between life stages is not valid.

(6) FIG. 4. Comparison of ESP protein abundance (iBAQ) in adult stages of L. sigmodontis. The top 35 most abundant proteins in each ES preparation (A, AM; B, GAF; C, PAF) are ranked by normalised iBAQ abundance (white bars); the corresponding abundance in WBE is displayed for comparison (striped bars) in a stacked format. Individual protein abundance values were normalised by the summed total abundance per sample. An asterisk indicates proteins with a predicted signal peptide, while predicted secretion through the non-classical pathway is indicated by a plus sign.

(7) FIG. 5. Comparison of ESP protein abundance (iBAQ) in larval stages of L. sigmodontis. Proteins in each ESP preparation (A, vL3; B, iMf) are ranked by normalised iBAQ abundance (grey bars); the corresponding abundance in WBE is displayed for comparison (black bars) in a stacked format. Individual protein abundance values were normalised by the summed total abundance per sample. An asterisk indicates proteins with a predicted signal peptide, while predicted secretion through the non-classical pathway is indicated by a plus sign.

(8) FIG. 6. The ShK domains from L. sigmodontis protein nLs_04059 and its orthologues in other filarial species have a distinct sequence signature. All ShK domains identified in the complete theoretical proteomes of L. sigmodontis, B. malayi, L. loa, W. bancrofti, O. ochengi, D. immitis, Acanthocheilonema viteae and Ascaris suum were extracted and aligned, and sequence logos derived from: (all ShK) all 531 domains, (04059) all domains from nLs_04059 and its orthologues, (1-6) the aligned orthologous domains 1 to 6 from nLs_04059 and its orthologues. No nLs_04059 orthologue was found in A. suum. As the nLs_04059 domains are relatively short, there are gaps in the sequence logos for the nLs_04059-derived domains. Numbering in all the panels is based on the full ShK alignment.

(9) FIG. 7. Number of adult ES proteins detected in published studies of B. malayi adults and comparison with orthologues present in the L. sigmodontis adult secretome. The study-specific and shared proteins represent combined data from both adult sexes. Note that protein identifications are those quoted by each individual study and statistical cut-offs have not been standardised. Brugia malayi orthologues of L. sigmodontis proteins were identified by reciprocal BLAST of the respective theoretical proteomes (bit score >50). The distribution of the orthologues in adult nematode ESP across three previously published studies (B. malayi) and the current study (L. sigmodontis) is displayed in (A), while the distribution of species-specific (non-orthologous) proteins is summarised in (B).

(10) FIG. 8: Heat-map of protein profiles for excretory-secretory preparations and whole body extracts of Litomosoides sigmodontis. Dendrograms shown in this Figure were generated by hierarchical clustering based on pair-wise distance. ESP, excretory-secretory products; WBE, whole body extracts; GAF, gravid adult females; PAF, pre-gravid adult females; AM, adult males; iMF, immature microfilariae; vL3, vector-derived third stage larvae.

(11) FIG. 9: Domain organisation of protein nLs_04059 from Litomosoides sigmodontis. Linear representation of the amino-acid sequence highlighting the signal peptide (italicised), six ShK toxin-like domains (open rectangles) containing six cysteine residues each (highlighted), and a predicted propeptide cleavage site (underlined). Domain six at the C-terminus is unique in containing two lysyltyrosine dyads (bold).

(12) FIG. 10: Amino-acid sequence alignment of L. sigmodontis protein nLs_03577 and its orthologues in other filarial nematodes. Homologues of nLs_03577 were identified by BLASTp search of protein databases from sequenced nematode genomes and a transcriptome assembly for Setaria labiatopapillosa (G. Koutsovoulos, B. Makepeace, M. Blaxter; unpublished). No homologues were found outside the filarial nematodes. The protein sequences were aligned with ClustalOmega, and identity is indicated by the scale (high identity is indicated in striped; lower identity is indicated in white).

(13) FIG. 11: Rooted phylogenetic tree of L. sigmodontis protein nLs_03577 and its orthologues in other filarial nematodes. Homologues of nLs_03577 were identified by BLASTP search of protein databases from sequenced nematode genomes and a transcriptome assembly for Setaria labiatopapillosa (G. Koutsovoulos, B. Makepeace, M. Blaxter; unpublished). No homologues were found outside the filarial nematodes. The protein sequences were aligned with ClustalOmega and the alignment subjected to phylogenetic analysis using MrBayes version 3.2. Every 100.sup.th generation from the final 1 million generations of a 2 million generation analysis were combined to derive the consensus shown. The tree is rooted with S. labiatopapillosa, in accordance with accepted systematics, and nuclear small subunit ribosomal RNA phylogeny.

(14) FIG. 12: Rooted phylogenetic tree of ShK domains among predicted proteins in filarial nematodes. The rooted subtrees for the six ShK domains from the nLs_04059 orthologues are shown. In B. malayi, domain 1 is represented by two distinct isoform clusters, one of which (Bm1) is found only in this species and in W. bancrofti.

(15) FIG. 13: Unrooted phylogenetic tree of ShK domains among predicted proteins in filarial nematodes and Ascaris suum. The numbers 1-6 identify the ShK domains of the L. sigmodontis protein nLs_04059.

(16) FIG. 14: Distribution of biotin in labelled and unlabelled specimens of adult Litomosoides sigmodontis. Fixed worm sections were incubated with streptavidin-FITC. A, Biotin-labelled works. B, An unlabelled control specimen.

EXPERIMENTAL RESULTS

(17) Study 1

(18) The ability of polypeptides comprising ShK domains of filarial nematode proteins to as vaccines conferring protective immunity in respect of filarial nematode infection, and the suitability of nucleic acids encoding such polypeptides to serve as vaccines, was demonstrated by the following study. The L. sigmodontis ShK domain containing protein used as an exemplary vaccine was designated LsShK for the purposes of this study.

(19) Immunisations and infections were performed with female BALB/c mice, starting at ages of 6-7 weeks, with five animals per experimental group. Mice were housed in individually ventilated cages and infected subcutaneously with 30 or 40 L. sigmodontis infective larvae (iL3). Na?ve, uninfected animals were maintained and sampled in parallel as controls for the immunological readouts.

(20) All cloning was carried out following the recommendations of the pcDNA 3.1 Directional TOPO Expression Kit (Invitrogen). LsShK (gene ID nLs.2.1.2.t04059-RA) was amplified from a cDNA preparation of adult L. sigmodontis using specific primers. Fusion constructs containing single-chain anti-DEC205 antibody (DEC) upstream of the LsShK sequence were produced from ready-made constructs kindly provided by Dr. Ralph Steinman. Briefly, PCR products of genes of interest were digested with NotI and XbaI (Neb laboratory, UK), then ligated into an NotI and XbaI-digested anti-mouse dec-205 single chain antibody-ovalbumin construct (DEC-OVA) or antibody control Ig-OVA to replace the fragment of OVA gene, respectively. All plasmids were sequenced to confirm identity.

(21) Plasmids were injected in the tibialis anterior muscle of the left leg with a 27G needle, immediately followed by electroporation with an ECM 830 generator+Tweezertrodes (BTX Harvard Apparatus) using as settings 8 pulses, 200 V/cm, 40 ms duration, 460 ms interval. Each mouse was immunised twice separated by 2 weeks interval with 40 ?g of DNA total made up by equal quantities of each plasmid species, delivered in 50 ?l PBS. As a consequence, the quantity of each individual plasmid was reduced as the number of different plasmids incorporated into the inoculums increased. However, the quantity of each one remained in excess of the minimal efficient dose.

(22) Parasite survival was determined at experiment endpoint. Adult filariae were isolated from the pleural cavity lavage fluid in 10 ml cold PBS, fixed in hot 70% ethanol and counted. Protection was calculated as:
(mean burden in primary infected animals?mean burden of vaccinated animals)/mean burden in primary infected animals.

(23) Microfilariae were counted in 30 ?l of blood after fixation in 570 ?l of BD FACS lysing solution (BD Biosciences) under an inverted microscope.

(24) Generalised linear models were used to compare the effects of different vaccine formulations on parasitological parameters as they allow more flexibility in specifying the distribution of response variables and better model fitting through Maximum Likelihood estimation.

(25) The results of this study are illustrated in FIG. 1.

(26) The inventors found that at day 60 post-infection, the LsShK vaccine had a modest effect on adult worm burden (?40% reduction), though this was of borderline statistical significance (p=0.07). However, the vaccinated group had no microfilariae detected in the blood, whereas the primary infection group (which received empty plasmid vector only) exhibited a median microfilaraemia of ?830 parasites per ml (p=0.005). This suggests that the medical use of ShK domains as vaccines achieves its therapeutic use through sterilising the adult female worms, or by killing migrating microfilariae before they can reach the bloodstream.

(27) Study 2

(28) The invention may further be understood by the skilled person on consideration of the following details of a study undertaking quantitative secretome analysis of a model filarial nematode (Litomosoides sigmodontis) across the parasite life cycle.

(29) 2.1 Summary

(30) Filarial nematodes (superfamily Filarioidea) are responsible for an annual global health burden of approximately 6.3 million disability-adjusted life-years, which represents the greatest single component of morbidity attributable to helminths affecting humans. No vaccine exists for the major filarial diseases, lymphatic filariasis and onchocerciasis; in part because research on protective immunity against filariae has been constrained because the human-parasitic species cannot complete their lifecycles in laboratory mice. However, the rodent filaria Litomosoides sigmodontis has become a popular experimental model, as BALB/c mice are fully permissive for its development and reproduction. Here, we provide a comprehensive analysis of excretory-secretory products from L. sigmodontis across five lifecycle stages. Applying intensity-based quantification, we determined the abundance of 302 unique excretory-secretory proteins, of which 64.6% were present in quantifiable amounts only from gravid adult female nematodes. This lifecycle stage, together with immature first-stage larvae (microfilariae), released four proteins that have not previously been evaluated as vaccine candidates: a predicted 28.5 kDa filaria-specific protein, a zonadhesin and SCO-spondin-like protein, a vitellogenin, and a protein containing six metridin-like ShK toxin domains. Female nematodes also released two proteins derived from the obligate Wolbachia symbiont. Notably, excretory-secretory products from all parasite stages contained several uncharacterised members of the transthyretin-like protein family. Furthermore, biotin labelling revealed that redox proteins and enzymes involved in purinergic signalling were enriched on the adult nematode cuticle. Comparison of the L. sigmodontis adult secretome with that of the human-infective filarial nematode Brugia malayi (reported previously in three independent published studies) identified differences that suggest a considerable underlying diversity of potential immunomodulators. The molecules identified in L. sigmodontis excretory-secretory products show promise not only for vaccination against filarial infections, but for the amelioration of allergy and autoimmune diseases.

(31) 2.2 Introduction

(32) Filarial nematodes are the most important helminth parasites of humans in terms of overall impact on public health, with an annual global burden of ?6.3 million disability-adjusted life-years (1). Lymphatic filariasis (LF) or elephantiasis, which affects populations across Africa, South Asia, the Pacific, Latin America and the Caribbean, accounts for 92% of this toll. The remainder is caused by onchocerciasis or river blindness, primarily in sub-Saharan Africa. The major human filarial pathogens are Wuchereria bancrofti (responsible for 90% of LF cases), Brugia malayi and Brugia timori (geographically restricted causes of LF), and Onchocerca volvulus (the sole agent of human onchocerciasis). In addition, Loa loa affects ?13 million people in West and Central Africa. This parasite usually induces a relatively mild disease, but has been associated with severe and sometimes fatal adverse events following anthelmintic chemotherapy (2). Filarial parasites are primarily drivers of chronic morbidity, which manifests as disabling swelling of the legs, genitals and breasts in LF; or visual impairment and severe dermatitis in onchocerciasis. The filariae are also a major problem in small animal veterinary medicine, with ?0.5 million dogs in the USA alone infected with Dirofilaria immitis (3), the cause of potentially fatal heartworm disease. However, in domesticated ungulates, filarial infections are generally quite benign (4).

(33) Currently, control of human filarial diseases is almost entirely dependent on three drugs (ivermectin, diethylcarbamazine and albendazole). Prevention of heartworm also relies on prophylactic treatment of dogs and cats with ivermectin or other macrocyclic lactones. Reports of possible ivermectin resistance in O. volvulus (5) and D. immitis (6) have highlighted the importance of maintaining research efforts in vaccine development against filarial nematodes. However, rational vaccine design has been constrained for several decades (7) by the intrinsic complexity of these metazoan parasites and their multistage lifecycle. Moreover, many filarial species carry obligate bacterial endosymbionts (Wolbachia), which may also stimulate the immune response during infection (8). As part of global efforts to improve prevention and treatment of these diseases, large-scale projects have been undertaken, including sequencing of the nematodes (9-11) and their Wolbachia (10, 12, 13), and proteomic analyses of both whole organisms and excretory-secretory products (ESP) (14, 15). Additionally, two studies (both on B. malayi) have examined lifecycle stage-specific secretomes (16, 17). In the context of vaccine design, the identification of ESP proteins and determination of their expression in each major lifecycle stage can facilitate the prioritisation of candidates for efficacy screening in animal models.

(34) One barrier to the progression of research in the filarial field is our inability to maintain the full lifecycle of the human parasites in genetically tractable, inbred hosts. The filarial lifecycle involves uptake of the first-stage larvae (microfilariae, Mf) by a haematophagous arthropod, two moults in this vector, followed by transmission of third-stage larvae (L3) to a new vertebrate host. Two further moults occur in the definitive host before the nematodes mature as dioecious adults in a species-specific, parenteral predilection site. However, the complete lifecycle of the New World filaria Litomosoides sigmodontis can be maintained in laboratory rodents, including inbred mice (18). This species was first studied in its natural host (the cotton rat, Sigmodon hispidus) (19) [the previous designation of these isolates as L. carinii is taxonomically incorrect (20)]. Drawing on the full power of murine immunology, including defined knockout strains, this model has been address questions regarding the fundamental immunomodulatory mechanisms employed by filarial parasites (21), their susceptibility to different modes of vaccination, their ability to mitigate proinflammatory pathology and autoimmune disease (22), and the impact of various vaccine strategies on adult nematode burden and fecundity (23) (24). The L. sigmodontis model has also been central in defining the role of T-regulatory cells in filarial immune evasion (25).

(35) Using the resource of a newly-determined genome sequence, coupled with a derivative of intensity-based absolute quantification (iBAQ) proteomics, we have examined the stage-specific secretome of L. sigmodontis in vector-derived L3 (vL3), adult males (AM), pre-gravid adult females (PAF), gravid adult females (GAF), and immature Mf (iMf). In addition to identifying dynamic changes in the ESP profile through the lifecycle, we show important differences in the adult secretomes of L. sigmodontis and B. malayi, especially in the abundance of two novel proteins released by female L. sigmodontis that lack orthologues in B. malayi. As has been observed in other parasitic nematodes, we find transthyretin-like family (TTL) proteins to be particularly dominant in the ESP. Leakage of uterine fluid may account for the remarkable diversity of proteins that we detect in GAF ESP, and we highlight several novel proteins that warrant evaluation in vaccine trials and as anti-inflammatory mediators.

(36) 2.3 Experimental Procedures

(37) Ethical Considerations

(38) All experimental procedures on the animals required for vL3 production at the Museum National d'Histoire Naturelle were approved by the ethical committee Cuvier (n? 68-002) and carried out in strict accordance with EU Directive 2010/63/UE and the relevant national legislation (French D?cret n? 2013-118, 1 Feb. 2013). All other parasite stages were harvested from animals maintained at the University of Edinburgh in compliance with a UK Home Office Animals (Scientific Procedures Act) 1986 project licence and the recommendations of the local ethical review committee.

(39) Parasites and Protein Preparations

(40) The life cycle of L. sigmodontis was maintained in jirds (Meriones unguiculatus) infected with vL3 harvested from the mite vector Ornithonyssus bacoti. After 70-90 days, GAF and AM were recovered from the pleural cavity by lavage with serum-free RPMI 1640 medium (Life Technologies), whereas PAF were recovered 32 days post-challenge. To harvest iMf liberated in vitro, GAF culture medium was removed after 24 h and centrifuged at 1,900 g for 20 minutes (4? C.). Blood-derived microfilariae (bMf) were obtained by overlay of blood (from cardiac puncture of jirds >75 days post-infection) onto a 25% Percoll suspension, centrifugation at 1,900 g for 20 minutes (4? C.), and passage of the bMf fraction through a PD-10 desalting column (GE Healthcare) prior to culture. The vL3 larvae were dissected directly from the mite vector and washed three times in RPMI 1640 before transfer to culture vessels.

(41) To determine the relative abundance of proteins in the secretome of each parasite stage, ESP and whole body extracts (WBE) were extracted and analysed separately. All parasite stages were incubated in serum-free RPMI 1640 supplemented with 100 U/ml penicillin, 100 ?g/ml streptomycin and 1% glucose at 37? C. (5% CO.sub.2) in ultra-low attachment flasks (Corning), and were confirmed to be viable during incubation by microscopic examination. The medium was replaced every 24 h, and spent media recovered at 24 h and 48 h were centrifuged at 1,900 g for 20 minutes (4? C.) in low protein-binding Oak Ridge tubes (polypropylene copolymer; Thermo Scientific Nalgene) to remove debris. To purify proteins from the supernatant, hydroxylated silica slurry (StrataClean Resin, Agilent Technologies) was added at 30 ?l/ml and vortex-mixed at high speed for 2 min. Resin used for each 24 h incubation sample was reused for the respective 48 h sample to concentrate ESP prior to storage at ?80? C. Initial experiments using soluble WBE (used as a proxy for ESP, as limited amounts of the latter were available) displayed no visible differences in protein profiles by SDS-PAGE using resin-bound protein compared to equivalent unbound material (data not shown). Analyses were performed with separate ESP batches in quadruplicate for GAF, triplicate for AM, and duplicate for PAF, iMf and vL3.

(42) Soluble WBE was prepared by homogenisation in 25 mM ammonium bicarbonate, 1% RapiGest SF surfactant (Waters) and cOmplete Protease Inhibitor Cocktail (Roche) using a mini-pestle in a microcentrifuge tube. This was followed by 10 cycles of sonication on ice using a Vibra-Cell VCX130PB sonicator (Sonics & Materials, Inc.) with microprobe (10 sec sonication alternating with 30 sec incubation on ice). Homogenised samples were centrifuged at 13,000 g for 20 minutes (4? C.) and the supernatant retained. The WBE preparations were obtained from single pools of parasites for all stages except GAF and AM, where two biological replicates were available. Protein concentrations were determined using the Pierce Coomassie Plus (Bradford) Protein Assay (Thermo Scientific).

(43) Surface Biotinylation of Live Worms

(44) Samples of 10 adult male and five female nematodes were washed three times with pre-chilled PBS buffer and incubated for 30 min with 1 mM EZ-link Sulfo-NHS-SS-Biotin (Thermo scientific), or PBS only (negative control), at 4? C. with gentle agitation. The biotinylating solution was removed, and the reaction quenched with 100 mM glycine in PBS before washing the nematodes three times in PBS-glycine. Labelled nematodes were stored at ?80? C. Surface proteins were extracted by sequential incubations in PBS buffer alone, 1.5% octyl ?-D-glucopyranoside (Sigma), 0.5% SDS and then 4 M urea (all in PBS) for 1 h each (room temperature). Proteins released at each step were incubated with 30 ?l of high-capacity streptavidin-agarose beads (Thermo Scientific) for 2 h at room temperature with rotary mixing. To recover bound biotinylated proteins, the supernatant was removed and the beads were washed three times in PBS and three times in 25 mM ammonium bicarbonate prior to incubation in 50 mM DTT (Sigma), 25 mM ammonium bicarbonate at 50? C. for 30 min. The supernatant was removed and the DTT diluted tenfold before digestion with 0.2 ?g proteomic-grade trypsin (Sigma) overnight at 37? C. The resultant peptides were concentrated using C.sub.18 reverse-phase spin filters (Thermo Scientific) according to the manufacturer's instructions prior to MS analysis.

(45) To confirm efficient and specific labelling of the parasite surface, AM and GAF were fixed in 70% hot ethanol after subjection to biotin and control labelling as above. Paraffin-embedded sections (4 ?m) were deparaffinised, rehydrated and blocked in 1% BSA and 0.3% Triton X-100 in PBS (blocking buffer) for 1 h (room temperature), followed by two 5-min washes in PBS with gentle agitation. The sections were incubated with streptavidin-FITC (Sigma) at a 1/1,000 dilution in blocking buffer for 1 hr (room temperature), washed three times, and mounted with ProLong Gold anti-fade reagent (Life Technologies). Images were obtained on an Axio Imager.M2 fluorescence microscope (Zeiss) using Zen 2012 software (Zeiss), combining the FITC channel with brightfield illumination.

(46) Sample Preparation for Proteomics

(47) StrataClean Resin containing bound ESP was washed twice with 25 mM ammonium bicarbonate before suspension in 0.1% RapiGest SF, 25 mM ammonium bicarbonate. The resin samples were heated at 80? C. for 10 min, reduced with 3 mM DTT at 60? C. for 10 min, cooled, then alkylated with 9 mM iodoacetamide (Sigma) for 30 min (room temperature) protected from light. All steps were performed with intermittent vortex-mixing. The samples were then digested using 0.2 ?g proteomic-grade trypsin at 37? C. overnight with rotation, centrifuged at 13,000 g for 5 min, and the supernatant removed. The resin was washed twice with 0.1% RapiGest SF, 25 mM ammonium bicarbonate and the supernatants pooled. To remove RapiGest SF, the samples were precipitated using TFA (final concentration, 1%) at 37? C. for 2 h and centrifuged at 12,000 g for 1 hr (4? C.). The peptide supernatant was concentrated using C.sub.18 reverse-phase spin filters according to the manufacturer's instructions. The WBE samples were reduced and alkylated as above, digested with trypsin at a protein:trypsin ratio of 50:1 at 37? C. overnight, and precipitated to remove RapiGest SF as for the ESP preparations.

(48) NanoLC MS ESI MS/MS Analysis

(49) Peptide solutions (2 ?l) were analysed by on-line nanoflow LC using the nanoACQUITY-nLC system (Waters) coupled to an LTQ-Orbitrap Velos (Thermo Scientific) MS as previously described (13, 26). Thermo RAW files were imported into Progenesis LC-MS (version 4.1, Nonlinear Dynamics) and spectral data were transformed to MGF files prior to export for peptide identification using the Mascot (version 2.3.02, Matrix Science) search engine as detailed previously (26). Tandem MS data were searched against the protein predictions from the L. sigmodontis genome and its Wolbachia symbiont, wLs [obtained from the online nematode genome of Litomosoides sigmodontis release nLs 2.1.2, 10,246 protein sequences (M. Blaxter, S. Kumar, G. Koutsovoulos; unpublished); and release wLs 2.0, 1,042 protein sequences (27)], together with predicted proteomes for the rodent host (Mus musculus, Uniprot release 2012_08, 16,626 protein sequences; and Meriones unguiculatus, Uniprot release 2012_08, 223 protein sequences) and a general contaminant database (GPMDB, cRAP version 2012.01.01, 115 protein sequences). Search parameters, allowable modifications and the false discovery rate were defined as reported previously (13, 26). Mascot search results were imported into Progenesis LC-MS as XML files and analysed according to the following criteria: at least two unique peptides were required for reporting protein identifications, and an individual protein had to be present in ?2 biological replicates to be included in the ESP dataset. Protein abundance was calculated by the iBAQ method; i.e., the sum of all peak intensities from the Progenesis output was divided by the number of theoretically observable tryptic peptides (28). For ESP and WBE, protein abundance was normalised by dividing the protein iBAQ value by the summed iBAQ values for the corresponding sample, and the reported abundance is the mean of the biological replicates. Normalised peptide intensities rather than iBAQ values were used to calculate fold-changes between control and biotinylated worm surface preparations. Mass spectrometric data have been deposited in the ProteomeXchange Consortium database via the PRIDE partner repository (29) with the dataset identifier XXXXXXXXX.

(50) In Silico Analyses of Proteins

(51) The domain content of proteins identified in the ESP assessed using Pfam (v. 27.0) with the gathering threshold as a cut-off. A hypergeometric test for enrichment of Pfam domains in ESP proteins compared with the complete predicted proteome of L. sigmodontis was performed using the phyper toolkit within the R programming environment (30). The Benjamini & Hochberg step-up FDR-controlling procedure was applied to the calculated, adjusted P-values (31). Structural homologues of abundant uncharacterised proteins were identified through comparison to the National Center for Biotechnology Information non-redundant protein database (DELTA-BLAST search; E-value cut-off 1.sup.?03) and to the UniProt database (PSI-BLAST search) via the Phyre.sup.2 protein fold recognition server (32). The conserved domain structure of selected, abundant ESP proteins was also interrogated in InterProScan 4 (33). Venn diagrams were created using VENNTURE (34), while for heat-maps, hierarchical cluster analysis was performed using the (1?r) distance metric in GENE-E. Prediction of classical N-terminal signal peptides, non-classical secretion signatures, mitochondrial targeting sequences, O-glycosylation sites and propeptide cleavage sites was performed using the SignalP 4.0 server (35), the SecretomeP 2.0 server (36), MitoProt (37), the NetOGlyc 4.0 server (38) and the ProP 1.0 server (39), respectively. Brugia malayi orthologues of L. sigmodontis proteins were determined using reciprocal BLAST with a bit score cut-off of 50.

(52) ShK domains were identified in the complete predicted proteomes of the filariae B. malayi (9), D. immitis (10), L. sigmodontis, Onchocerca ochengi, Acanthocheilonema viteae (draft unpublished genomes available online at the nematode genome database; Blaxter et al., unpublished), W. bancrofti and L. loa (11), plus the ascaridid nematode Ascaris suum (40) (which is an outgroup for the filarial species), using the Pfam hidden Markov model for the domain and hmmer (version3.1b.1). Each domain was excised and a total of 531 distinct domains identified, which were aligned using ClustalOmega (41). Inspection of the alignment revealed that a subset of domains were misaligned (and therefore did not have the six cysteine residues in register with the others); these were corrected manually. The alignment was analysed for phylogenetic signal using MrBayes (version 3.2) (42) and two runs of four chains each were run for two million generations. The first million generations were discarded as burn-in after inspection in Tracer (version 1.5; A. Rambaut) and a consensus tree was inferred from the remaining 10,000 samples taken every 100 generations. Sequence logos were generated for all 531 ShK domains, all domains from nLs_04059 and orthologues, and each of the six distinct sets of orthologous domains, using the WebLogo server (43).

(53) 2.4 Results

(54) Distribution of Proteins in ESP Across Parasite Lifecycle Stages

(55) We searched ?120,000 MS spectra per lifecycle stage against protein sequences predicted from the L. sigmodontis and wLs genome assemblies. A total of 302 quantifiable filarial proteins (i.e., represented by ?2 unique peptides in ?2 biological replicates) were detected in ESP across the five lifecycle stages. A majority of these (195 proteins, 64.6%) were uniquely identified in GAF (FIG. 1b). Hierarchical clustering of the proteomic profiles clearly separated ESP and WBE (FIG. 8). The vL3 ESP data profile was distinct; not only from that of the other ESP preparations, but also from vL3 WBE (FIG. 8). The closer clustering of iMf with PAF ESP rather than GAF ESP was surprising, but may reflect the much lower complexity of the PAF and iMf ESP datasets. Strikingly, excluding GAF, fewer than six stage-specific proteins each were observed in ESP (Table 1). In vL3, these stage-specific proteins included highly expressed vaccine candidates originally identified from L3 of other filarial species, including activation-associated secreted protein 1 (ASP-1) and abundant larval transcript protein 1 (ALT-1). The functional identities of proteins restricted to other lifecycle stages were unexpected. Thus, PAF released two cuticular proteins and two antioxidant proteins that were not observed in ESP from GAF (Table 1). The only wLs-derived proteins that were quantifiable in any ESP were two components of the GroELS chaperonin complex, which were found solely in preparations from PAF and GAF (Table 3).

(56) We explored functional distinctness of ESP from different lifecycle stages by determining protein domain overrepresentation relative to the complete predicted proteome of L. sigmodontis. The greatest fold-enrichment scores were observed in the AM ESP, which contained three proteins with a major sperm protein (MSP) fibre protein 2b (MFP2b) domain and 10 proteins with a TTL family domain (FIG. 2). The TTL family was also overrepresented in iMf (seven proteins) and PAF (nine proteins). Notably, PAF exhibited significant enrichment for intermediate filament and lamin-tail domains (three members each). The ESP from GAF was enriched for lamin-tail and immunoglobulin I-set domains, as well as two proteasome and two laminin families (FIG. 2). Overall, iMf, AM and PAF secreted a greater proportion of proteins with relatively low abundance in WBE than did vL3 and GAF (FIG. 3). However, all of the lifecycle stages exhibited secretomic profiles clearly distinct from WBE, in that proteins which were highly abundant in ESP tended to be rare in WBE and vice-versa (FIG. 4, FIG. 5). Identification of proteins in ESP was strongly correlated with sequence features suggesting secretion: 31.1% of ESP protein sequences were predicted to begin with a classical signal peptide, while a further 30.5% were predicted to contain an internal, non-classical secretion signature.

(57) Abundant Proteins Released by Adult Parasites

(58) The GAF ESP displayed the most complex composition, and the majority of the abundant proteins secreted by this stage were uncharacterised or contained conserved domains associated with very limited functional information (FIG. 4b). The dominant GAF ESP protein (nLs_03577) was unique to filarial nematodes and exhibited only very weak similarity to a bacterial P-type ATPase (Tables 4 and 5). Twelve distinct TTL family proteins were identified in GAF ESP (FIG. 4b), although only two were unique to this lifecycle stage. Another abundant GAF ESP protein (nLs_08836), also well-represented in PAF and iMf ESP, contained von Willebrand factor type-d (VWD) and cysteine-rich (C8) domains in its carboxy-terminal portion. The best match identified for nLs_08836 was an apolipophorin from A. suum, but nLs_08836 lacks the expected amino-terminal lipoprotein domain, and the carboxy-terminal portion displayed weak similarity to predicted zonadhesin-like or SCO-spondin proteins (Tables 4 and 5). A protein (nLs_04059) that contained six metridin-like ShK toxin domains, nLs_04059, was moderately abundant in GAF ESP and was also observed in PAF, AM and iMf secretomes (FIG. 9, 11, 12). While the ShK domain has a wide phylogenetic distribution, the particular pattern apparent in nLs_04059 is limited to filariae (Tables 4 and 5; see below for detailed analyses of this protein). Additional proteins present in GAF ESP were homologues of previously described ESP antigens from other filarial species. However, RAL-2 (44), SXP-1 (45), S3 (46) and CCG-1 (47) remain functionally obscure.

(59) Functionally defined components of the ESP included a small cysteine protease inhibitor [CPI (48)], the omega-class glutathione S-transferases [GST (49)], the MSPs (50), and the microfilarial sheath protein (51) (FIG. 4b). Additionally, L. sigmodontis homologues of Av33 and ES-62, proteins known to be abundant in the ESP from adult females of other filarial species, were identified. Av33 is similar to an aspartate protease inhibitor from A. suum (52), whereas ES-62 is a secreted leucyl aminopeptidase (53). A secreted acid phosphatase, which may be involved riboflavin metabolism and have a role in the hydrolysis of prosthetic groups such as flavin mononucleotide and/or pyridoxal 5-phosphate (54, 55), was prominent in PAF ESP. Three of the GAF ESP proteins had putative lipid-binding regions: ML-domain proteins have been reported to interact with cholesterol and lipid A (56, 57), the conserved filarial antigen Ov16 has a putative phosphatidylethanolamine-binding domain (58), and a novel and highly abundant vitellogenin (nLs_07321) contained an amino-terminal lipid transport domain.

(60) There was extensive overlap in the identities of the most abundant proteins in the ESP of PAF, AM and iMf compared with that of the particularly diverse GAF. These less complex ESP mixtures nevertheless contained dominant components overrepresented in individual stages. In PAF, abundant proteins included several glycolytic enzymes and two heat-shock proteins, as well as a galectin (?-galactoside-binding protein 1) and a highly unusual protein, nLs_03350, containing both C-type lectin and acetylcholine receptor domains (FIG. 4c). Abundant components of AM ESP included three isoforms of MFP2 (59) and proteins known to be highly expressed in sperm or seminal fluid, such as an extracellular superoxide dismutase (60) and a serine protease inhibitor (61) (FIG. 4a). However, AM ESP also contained several previously described but uncharacterised proteins, such as RAL-2 (44), nematode secreted protein 22U (62) and immunogenic protein 3 (63). A novel KH (RNA-binding) domain protein had homologues in other filarial species, but also weak homology to the Vasa DEAD-box helicase GLH-2 from Caenorhabditis elegans (Table 4), which is associated with spermatogenic chromatin (64).

(61) Abundant Proteins Released by Larval Parasites

(62) Characterisation of ESP from the bMf stage posed special challenges. Despite the two-stage purification process and prolonged culture in vitro, 92.4% (61 of 66) of proteins robustly quantified in bMf ESP were derived from the rodent host. The dominant serum components identified were fibronectin, complement C3, serum albumin, hemopexin, plasminogen and ceruloplasmin; while lower amounts of IgM were also detected (Table 6). Of the five quantifiable parasite-derived molecules, three were TTL proteins. To obtain characterise Mf-derived ESP in more depth, we harvested iMf from GAF cultures in vitro, separated them from the female nematodes, and proceeded with in vitro incubation. This procedure increased the detection of proteins of nematode origin to 36 (FIG. 5b), although as expected, the dominant proteins in iMf ESP closely mirrored the profile of GAF ESP (FIG. 4b). Interestingly, the two most abundant parasite ESP proteins observed in bMf, a TTL protein and a nematode-specific uncharacterised protein (nLs_03443), were not present in iMf ESP (Table 6). Non-unique but proportionally enriched proteins in iMf included two galectins (?-galactoside-binding proteins 1 and 2), a fatty acid and retinoid-binding protein (FAR-1), and a nucleoside diphosphate kinase (FIG. 5b), all of which are known to be expressed throughout the filarial lifecycle (65, 66). In addition, Ls110, which is secreted from the uterine epithelium during embryonic development (67), was detected in iMf ESP but not iMf WBE. Conversely, the major sheath proteins Shp1a and Shp4 were found in iMf WBE but were not secreted (supplemental Table Si). Another distinctive feature of the iMf ESP was the overrepresentation of two proteoglycan core proteins: a perlecan-like protein that exhibited moderate similarity to UNC-52 from C. elegans (Table 4 FIG. 5b) (68); and a chondroitin proteoglycan (CPG) containing six peritrophin-A chitin-binding domains, which was distantly related to C. elegans CPG-2 (69) (Tables 3 and 4). However, a large (?250 kDa predicted mass) plasminogen-apple-nematode (PAN) domain protein, which displayed weak similarity (Table 4) to the predicted mucin SRAP-1 from C. elegans (70), was more abundant than either of the proteoglycans in iMf ESP (FIG. 5b). Finally, an apparently novel peroxidasin-like protein with orthologues in other filarial nematodes and more distant relatives in A. suum and Caenorhabditis briggsae (Table 4) was also identified in iMf ESP (FIG. 5b).

(63) Although ESP from the vL3 stage was the least diverse dataset in our study, it showed a distinctive repertoire of highly abundant proteins. Thus, vL3 ESP was composed of previously characterised filarial proteins that are known to be uniquely expressed or enriched in this stage [such as ASP-1 (71), ALT-1 (72), and cathepsin-L-like protease (73)], and other antigens that were well represented in ESP from other stages (RAL-2, CPI-2, Ov16 and ?-galactoside-binding proteins) (FIG. 5a). The nematode secreted protein 22U was moderately abundant in the L. sigmodontis vL3 ESP preparations (FIG. 5a), but apparently is not expressed in vL3 of other filarial species (62). This stage may be relatively quiescent in terms of secretory activity until they adapt to the mammalian host and undergo the third moult. Analysis of ESP from moulting L3 identified fivefold more proteins than from vL3 ESP in B. malayi (17).

(64) Phylogenetics of Novel, Filaria-Specific ESP Proteins

(65) The most abundant protein in GAF ESP, nLs_03577, is an enigmatic, uncharacterised molecule with a predicted MW of 28.5 kDa and a lack of conserved domains, with the exception of a classical N-terminal signal peptide. Downstream of the signal peptide, moderate to high levels of sequence conservation were apparent across the Filarioidea in the N-terminal portion (FIG. 10). However, the C-terminal segment displayed low complexity and was highly variable between filariae, with two isoforms in B. malayi diverging in this region only (FIG. 10). The L. sigmodontis protein was predicted to contain six potential N-linked and 11 O-linked glycosylation sites, as well as propeptide cleavage sites at positions 31 and 147. The former cleavage site was absolutely conserved within the Filarioidea, despite some variation in the motif, whereas the latter (at position 154 of the consensus) was unique to L. sigmodontis. These observations suggest that several processed isoforms of nLs_03577 might be secreted by L. sigmodontis. Phylogenetic analysis of nLs_03577 orthologues confirmed that this protein is restricted to the Filarioidea, with no representatives in A. suum or other non-filarial nematodes. The base of the tree was poorly resolved due to the lack of signal in the C-terminal portion (FIG. 11). However, nLs_03577 clearly clustered with an orthologue in the rodent filaria, A. viteae, while orthologues in D. immitis and Onchocerca spp. formed the most distant grouping (FIG. 11).

(66) The ShK domain protein nLs_04059 was a particularly distinctive molecule identified in all ESP preparations except vL3. One other L. sigmodontis ShK domain protein, the astacin protease nLs_03368, was a rare component of GAF ESP only (Table 3). The ShK domain (or metridin-like toxin domain, also known as the SXC or six-cysteine domain) was first identified in cnidarian venoms, but is particularly abundant in nematode proteomes (74), where it is associated with secreted proteins. The prototypic ShK peptide (from the cnidarian Stichodactyla helianthus) is a type 1 toxin that blocks voltage-gated potassium channels, and synthetic analogues are currently under development as a therapy for autoimmune diseases, in which Kv1.3 channels expressed by effector memory T-lymphocytes are specifically targeted (75). Although nLs_04059 was not especially abundant in any ESP preparation, its presence in the secretomes of all mammalian-derived stages and its unusual domain structure (FIG. 9) suggest a potentially immunomodulatory role.

(67) The nLs_04059 protein has the largest number of ShK domains (six) of any protein in L. sigmodontis. We identified orthologous genes in all the other filarial nematode genomes, each containing six ShK domains (FIG. 12). The nLs_04059-like ShK domains form a distinct subset of all filarial and A. suum ShK domains (I FIGS. 12 and 13), with a striking pattern of conservation particularly around the last three universally-conserved cysteine residues (FIG. 6). A proline residue (at position 32 of the alignment, but residue 17 of the nLs_04095 domains) was also strikingly conserved in the nLs_04059 domains (FIG. 6), but not common in the full set of 531 domains. In nLs_04059 and its orthologues, the six ShK repeats are separated by five low-complexity spacers (27-104 amino acids) (FIG. 9). Some spacer domains were conserved, but others showed variation in the pattern and length of low complexity, serine-rich regions. The spacer domains have no clear similarity to other proteins, but by analogy to the ShK mucins of the ascaridid Toxocara canis (76), they could be recipients of O-linked glycan decorations. There are 65 potential O-glycosylation sites on nLs_04059. However, by geLC-MS we found that nLs_04059 migrated exclusively at the expected molecular weight of the unmodified mature protein (?52 kDa), ruling out a mucin-like structure (data not shown). This protein also contained two lysyltyrosine dyads located within the C-terminal ShK domain (FIG. 9). Since a lysyltyrosine dyad is essential for binding of type-1 cnidarian peptide toxins to potassium channels (77), this could be related to Kv1 channel-blocking activity. Notably, one lysyltyrosine dyad in ShK domain 6 is conserved in many (although not all) orthologues in other species (FIG. 6).

(68) Proteins Associated with the Adult Nematode Surface

(69) The nematode cuticle is the critical interface between the parasite and the immune system of its host (78). Surface-associated proteins may simply mirror ESP, perhaps by passive adsorption of released material, or comprise a distinct component of the exoproteome. Live AM and GAF nematodes were surface-labelled incubated with Sulfo-NHS-SS-Biotin and fractionated. Immunofluorescent imaging of fixed nematode sections confirmed that biotin labelling was largely confined to the cuticular layers (FIG. 14). Low levels of endogenous biotin were present within internal structures as expected. We identified five proteins that were present in biotin-labelled AM extracts but not unlabelled controls and 11 proteins in biotin-labelled GAF (Table 2). In addition, a further four (AM) and 39 (GAF) proteins were enriched by more than 50-fold in biotin-labelled samples relative to unlabelled controls (Table 7), suggesting that these molecules were abundant on the parasites' surface but may also be associated with endogenous biotin. There was considerable overlap between ESP and biotin-labelled protein profiles in both sexes. However, AM and GAF displayed two and 12 proteins, respectively, that were uniquely present in surface-labelled extracts (Table 2 Table 7). Conversely, many of the highly abundant ESP proteins, such as nLs_03577, the vitellogenin nLs_07321, uncharacterised protein S3 and ES-62 were not detected in biotin-labelled extracts.

(70) A striking feature of the surface-associated proteins was the presence of two ectoenzymes involved in purinergic signalling. These were an adenylate kinase predominant in AM extracts and a purine nucleoside phosphorylase found exclusively found in GAF extracts (79) (Table 2, Table 7). A homologue of complement component 1, q subcomponent-binding protein was identified in GAF surface-labelled extracts. Like the human homologue, the L. sigmodontis protein contained an N-terminal mitochondrial import signal sequence, although the former is expressed in a number of extramitochondrial locations, including on the surface of lymphocytes, endothelial cells, dendritic cells and platelets (80). These proteins may play a role in immunomodulation, as purinergic signalling is known to regulate lymphocyte trafficking (79), while the complement component 1q receptor is involved in vasodilation via the generation of bradykinin (80).

(71) Surface extracts from AM contained a homologue of the actin-binding protein, calponin, which has been localised to both striated muscle and the cuticle in adult O. volvulus (81). The GAF surface extracts contained two proteins, protein disulphide isomerase and a leucine-rich repeat family protein, both of which have previously been associated with cuticle synthesis in filariae and C. elegans (82, 83). Stress response-related proteins were also well represented on GAF (including thioredoxin peroxidase (84), aldehyde dehydrogenase, a thioredoxin-like protein and heat-shock proteins), as were several enzymes of pyruvate metabolism (Table 2 and Table 7). Notably, the endosymbiont-derived Wolbachia surface protein was found to be accessible to surface biotinylation in GAF.

(72) Comparison with the Secretome of Adult B. malayi

(73) The ESP from several lifecycle stages of B. malayi have been described previously (14, 16, 17). In these three studies, the only common stage was adult [with both sexes cultured together in (14)]. Of 297 proteins identified in adult L. sigmodontis ESP, 92.6% had an orthologue in B. malayi. However, the majority (61.6%) of these B. malayi orthologues were not observed in the B. malayi secretome (FIG. 7a). Analysis of Pfam domains failed to indicate any significant enrichment in this unique dataset (data not shown). Conversely, although each B. malayi study revealed a surprising number of study-specific secreted proteins, orthologues of the proteins reported in all three B. malayi secretomes were also detected in adult L. sigmodontis ESP (FIG. 7a). This common core included leucyl aminopeptidase, enolase, triosephosphate isomerase, ?-galactoside-binding protein 1, acetylcholine receptor protein, cyclophilin-5 and macrophage migration inhibitory factor-1. The 22 L. sigmodontis adult ESP proteins that lacked B. malayi orthologues (FIG. 7b) included two of the most highly abundant GAF ESP molecules (the vitellogenin nLs_07321 and the VWD protein nLs_08836), together with secretory protein Ls110 and two superoxide dismutase isoforms. Although the B. malayi secretome studies identified a total of 90 proteins that did not have orthologues in L. sigmodontis (FIG. 7b), only one (cuticular glutathione peroxidase) was observed in all three studies. Since standardised quantification methods were not used for our L. sigmodontis and the published B. malayi studies, it is difficult to determine whether adult B. malayi and L. sigmodontis differ in their levels of secretion for individual ESP proteins. However, in terms of rank abundance, triosephosphate isomerase, macrophage migration inhibitory factor-1, and ?-glutamyl transpeptidase were reported to be grossly overrepresented in adult B. malayi; whereas adult L. sigmodontis ESP was enriched for uncharacterised protein nLs_03577 (orthologous to Bm1_38495), TTL protein nLs_09750 (orthologous to Bm1_43635), and homologues of Av33 and S3 (Table 3). Proteins that were apparently equally abundant in relative terms between each species included leucyl aminopeptidase and homologues of CPI-2 and Ov16.

(74) 2.5 Discussion

(75) Quantifying the Secretomes of a Model Filarial Nematode

(76) Filarial nematodes exact a significant burden of morbidity in human populations and are important pathogens of companion animals. While efficacious anti-filarial drugs exist, the spectre of the evolution of genetic resistance to these is ever-present (5, 6), and alternative routes to treatment are required. It would be preferable to be able to prevent infection as well as treat patent disease, and thus an anti-filarial vaccine would be an extremely valuable addition to medical and veterinary treatment options (85). The ESP released by parasites into their hosts have been the target of vaccine development for decades, but the understanding of these molecules in filarial nematodes is limited. Whereas previous studies have catalogued the proteins inferred to be present in filarial ESP, quantitative assessments of their abundance have not been explored previously using an intensity-based approach. Using the model rodent filarial nematode L. sigmodontis, it is possible to prepare material from across the nematode lifecycle, and thus examine the different vertebrate-parasitic stages in detail. Applying semi-quantitative MS analysis of ESP, we identified secreted proteins and determined their abundance, limiting our analysis to 302 proteins that could be robustly quantified using ?2 unique peptides.

(77) The Secretome of Adult Nematodes

(78) In L. sigmodontis, GAF was responsible for the majority of ESP proteomic diversity. The other four lifecycle stages examined contributed only 11 proteins (3.6% of the total) that were not present in GAF ESP. This finding contrasts with a qualitative analysis of B. malayi secretomes comparing adults, Mf and L3, and incorporating data obtained from single-peptide hits, which found that Mf contributed the greatest proportion of unique proteins (17). However, an earlier assessment of the B. malayi GAF, AM and Mf secretomes concluded that GAF produced the greatest number of unique hits (16), suggesting that methodological differences may underlie these contrasting results. The diversity of GAF ESP is consistent with the material containing not only somatic adult ESP, but also proteins released from the reproductive tract that derive from the processes of oogenesis, fertilisation and embryonic development in utero (all filarial pathogens are ovoviviparous).

(79) Nematode sperm are acutely sensitive to aerobic damage (86). The AM ESP contained proteins suggestive of roles in protection of sperm against oxidants and other stressors, including superoxide dismutase, a serine protease inhibitor and a glutaredoxin-like protein. Glutaredoxins are thiol-containing antioxidant proteins, and C. elegans GLRX-21 plays a key role in mitigating selenium toxicity (87). Mammalian seminal fluid accumulates selenium, which if in excess, can impede sperm motility (88). A homologue of the serine protease inhibitor is secreted by A. suum during the acquisition of motility and contributes to sperm competition by inhibiting the activation of surrounding spermatids (89). Lysis of sperm during aerobic culture may account for the high levels of MSPs observed in AM ESP and in ESP obtained from PAF, GAF and iMf. Female nematodes are fertilised some weeks before the first Mf are produced (90), and the dominance of MSPs in PAF ESP indicates that leakage of sperm from the female reproductive tract occurs before parturition.

(80) Several unique antioxidant proteins (nucleoredoxin-like protein-2, glutathione reductase and translationally-controlled tumour protein) were found in PAF ESP, suggesting an enhanced requirement for protection during this stage. In B. malayi, homologues of the nucleoredoxin-like proteins, which resemble large thioredoxins (91), are present in ESP but do not exhibit stage-specific expression (92). Two unique cuticle biosynthesis related proteins were also released by PAF, suggesting that cuticular remodelling occurs during their final stages of growth. This may result in increased susceptibility to immune-driven oxidative stress or damage during copulation (93). Heat-shock proteins, which were overrepresented in PAF ESP, were detected previously in B. malayi adult nematode ESP (94).

(81) The Mature Microfilarial Secretome is Dominated by Host Proteins

(82) In many filarial nematodes, microfilariae are enclosed in a proteinaceous sheath comprising an inner layer that originates from the eggshell and an outer layer that is produced by secretions in the distal portion of the uterus. Five major structural proteins have been identified in the L. sigmodontis sheath, some of which are synthesised in the developing embryo and others in the uterine epithelium (51), but none of these were found in iMf ESP, indicating that they are stable components. Many host serum proteins were released from bMf in culture. These are likely to derive from specific interactions with the parasite surface, perhaps reflecting a tension between the nematode exploiting the host and the host immune system recognising the parasite. The finding of host at the Mf surface is not new, as five serum components were only proteins released by SDS extraction of L. sigmodontis Mf sheaths (95), and human serum albumin has been detected on the sheath surface of W. bancrofti Mf (96), but is generally not found on Brugia spp. Mf (97). The L. sigmodontis sheath is permeable to molecules of up to 70 kDa (98), and therefore might retain some host proteins after transfer to culture. However, several abundant serum proteins that we detected in bMf ESP are considerably larger than this (for example, ceruloplasmin and fibronectin) and thus must be either adsorbed onto the sheath surface or proteolytically processed prior to uptake. Hemopexin and ceruloplasmin have roles in heme and copper transport (99), respectively; hence, they may be exploited as a source of essential cofactors by the parasite.

(83) Several parasite-derived products were identified as secreted by iMf, including Ls110 [a protein localised in the uterine lumen and variably present on iMf, but absent from bMf (67)] and two possible proteoglycan core proteins. Accordingly, large glycoproteins (?200 kDa) have been described from B. malayi ESP (100). The closest C. elegans homologue of the perlecan-like proteoglycan, UNC-52, is a major component of the basement membrane of contractile tissues, including the pharynx and anus in developing embryos and subsequent stages (68). The L. sigmodontis iMf-derived CPG-like protein is predicted to have chitin-binding domains and may function in eggshell and sheath development. In C. elegans, CPGs form an inner layer that binds to the central chitinous layer of the eggshell, maintaining the perivitelline space around the embryo (101) forming a barrier to prevent polyspermy (102). In L. sigmodontis, chitin has been detected in the oocytes and zygotes, although it is absent from the iMf sheath (103). The degradation of chitin during Mf sheath development in utero may release the underlying CPG, which is highly soluble (101), into the surrounding milieu. The origin and roles two of the other novel proteins that were enriched in iMf ESP is less clear. The closest homologue in C. elegans of the PAN domain protein is SRAP-1, which is expressed in the hypodermis, central nervous system and vulva of developing larvae and is secreted onto the cuticle surface during moulting (104). In C. elegans, peroxidasin PXN-2 is located in the extracellular matrix and is required for late embryonic elongation, muscle attachment, and motoneuron axon guidance choice (105).

(84) The Abundant Uncharacterised Proteins Released by Gravid Adult Female Nematodes

(85) We identified four abundantly secreted or excreted proteins, found predominantly in GAF and iMf ESP, that had not been reported previously. Two have only marginal similarity to other proteins: nLs_03577, which displayed a significant match to a P-type ATPase (but lacked an ATPase domain), and nLs_08836, which showed some similarity to zonadhesin, a VWD protein located in the head of mammalian sperm (106). However, we note that nLs_08836 is not an orthologue of the C. elegans zonadhesin-domain protein, DEX-1 (107). The third novel protein, nLs_07321, is a vitellogenin. In C. elegans, vitellogenins are expressed exclusively in the intestine, where they bind cholesterol and transport it via the body cavity to the gonad (108).

(86) Subsequently, oocytes internalise the protein and its lipid cargo by receptor-mediated endocytosis and store it in yolk granules (108). Several vitellogenins have also been identified in ESP derived from adults of the oviparous gastrointestinal nematode, Heligmosomoides polygyrus (109). The fourth protein, the ShK domain protein nLs_04059, was distinct from other proteins containing this motif in nematodes, both in the number of domains and their specific sequence. Its relative abundance, distinctiveness and presence in all the filarial species surveyed suggest that it may be a viable vaccine candidate for both human filarial diseases and canine heartworm. Its role in vivo may be to interfere with the development of acquired immunity by inhibiting the Kv1 channels of memory T-cells in a manner analogous to the activity of cnidarian ShK toxins (75).

(87) The enigmatic TTL family has emerged as one of the most typical and widespread findings in ESP from both zoo- and phytoparasitic nematodes (110). In C. elegans, there are 63 transthyretin genes, many of which are secreted and apparently upregulated in response to infectious challenge, but only TTR-52 has been ascribed a physiological function [phagocytosis of apoptotic cells (111)]. In the phytoparasite Radopholus similis, Rs-ttl-2, which is closely similar to one of the most abundant L. sigmodontis TTL proteins (nLs_07576; found in ESP from all stages except vL3 in our study), was localised to the ventral nerve cord (112). A second R. similis TTL family member, Rs-ttl-1, was expressed only in the vulval region (112), and a homologue of this molecule (nLs_07332) was detected in iMf WBE only. Furthermore, in the ruminant parasite Ostertagia ostertagi, a TTL family (Oo-TTL-1) was a major component of ESP and could be immunolocalised to the pseudocoelomic fluid of adult worms (113). In our study, a L. sigmodontis homologue of Oo-TTL-1 (nLs_09750) was abundant in all ESP preparations except those of vL3.

(88) Uterine Fluid as a Source of Nematode and Endosymbiont Products

(89) Proteins excreted or secreted from filarial nematodes could be derived from a number of routes. In addition to oral secretions from the oesophageal glands and release of faecal material from the anus, nematodes also secrete material from the anterior sensory glands (amphids) (114) and the secretory pore, and may also void material from the genital openings during copulation and release of Mf. Proteins can also be released from the hypodermis through transcuticular secretion (115), especially during moulting, and exosome release may also be important (116). From our data, we suggest that vulval excretion is the main source of ESP proteins in GAF and PAF, and that the iMf are coated with proteins secreted by the uterine epithelium. This interpretation is supported not only by the abundance of MSPs and vitellogenin in GAF and PAF ESP, but by the presence of omega-class secreted GST isoforms exclusively in GAF ESP, which in O. volvulus are only produced by embryos at the morula stage (49). Similarly, ESP proteins in the male nematode probably originate primarily from seminal fluid. Immune sera from rodents infected with A. viteae react most strongly with male and female gonad tissues, including the fluid channels between developing embryos and on sperm in both the spermatheca and seminal vesicle (117).

(90) The role of the Wolbachia endosymbionts of filariae remains unclear: are they nutritional commensals, supporting the nematode through provision of energy or cofactors, or part of the immunological avoidance mechanisms of the parasite, or both (13)? It has been proposed that Wolbachia may be present in uterine fluid (118), inside degenerating embryos (119), or exit via the secretory pore (120). Additionally, they may secrete proteins into structures that lack bacterial cells, such as the cuticle (121). Wolbachia-derived proteins were present in very low amounts in B. malayi secreted products (17). We identified Wolbachia GroELS components in ESP of PAF and GAF, but not in other lifecycle stages. GroEL is the most abundant protein in Wolbachia (13, 15), and its detection in ESP may be through release of whole bacterial cells, for example in the female uterus from degenerating oocytes or embryos, or through secretion. GroEL, as a chaperonin, would be expected to be confined to the cytosol, although GroEL homologues have been reported to moonlight on the surface of some bacterial species (122). We also detected Wolbachia surface protein by surface labelling of adult L. sigmodontis, as has been reported in B. malayi (121). This protein is a putative ligand of Toll-like receptors 2 and 4 (119), and these findings support the hypothesis that Wolbachia modifies and perhaps misdirects the immune response to filariae (123). Whether Wolbachia GroEL also stimulates proinflammatory Toll-like receptors has not been evaluated, but a precedent exists in other bacteria (124), and antibodies against this protein are associated with pathology in LF (125).

(91) The L. sigmodontis Secretome and Vaccine Development for Filariases

(92) For several decades, vaccine development for human and veterinary filariases has focused on the L3 stage because irradiated L3 are highly efficacious at inducing protective immunity (23, 126) and strong anti-L3 immunity may block parasite establishment. Litomosoides is an excellent model for L3 vaccine research, as the L3 expresses a very similar repertoire of genes to the human and veterinary pathogens (127). Analyses of ESP from L3 of L. sigmodontis aid in defining a stereotypical secretomic profile for this stage. However, no defined parasite antigens (whether alone or in combination) have reproducibly attained an equivalent level of protection to irradiated L3 in any filarial system (7). Furthermore, since a single pair of adult nematodes can generate a patent infection, vaccines directed solely against L3 face a potentially insurmountable challenge.

(93) Targeting of Mf has the potential to block transmission, and in the case of onchocerciasis, to reduce disease pathology. Moreover, the Mf stage has been shown to be more vulnerable to protective immune responses than L3 in several vaccination trials (128-130). Vaccination with a combination of ALT-1 and CPI-2 delivered as a DNA vaccine reduced circulating Mf levels by up to 90% in L. sigmodontis. Importantly, this protection was only achieved if immunomodulatory domains of the antigens were ablated (by mutation or deletion of the coding sequence) and was maintained even when the adult nematode burden was not significantly reduced. This phenomenon was probably to be due to the immunomodulatory effects of the native (active) proteins, as transplantation of a single adult female worm is sufficient to prevent clearance of injected Mf in na?ve hosts (131). We suggest that it is likely that many of the other abundant molecules secreted by GAF may similarly have roles in facilitating Mf survival and could be targeted in an anti-fecundity vaccination strategy. Furthermore, the proteins identified by surface labelling of the GAF cuticle may also participate in generating a permissive environment (79, 80); thus, vaccination against these molecules, if sufficiently divergent from host homologues, might impede parasite establishment.

(94) 2.6 Conclusions

(95) We have shown that L. sigmodontis, especially the GAF stage, releases a remarkable diversity of proteins into the external milieu and the majority of these molecules are uncharacterised. Although many of these proteins may be involved in fundamental aspects of embryogenesis, a subset are likely to be active immunomodulatory agents that protect the nematodes (and especially the circulating Mf) from the host immune response. The abundant ESP protein, CPI, may represent an archetype for this dual functionality, as it plays fundamental roles in oogenesis and fertilisation not only in parasitic nematodes but also in C. elegans (132). This suggests that its immunomodulatory properties are an example of secondary adaptation to a radically different environment. Thus, the pharmacopeia released by GAF may provide the ideal set of molecule(s) to target for immunoprophylaxis and chemotherapy of filariases; moreover, it could provide new compounds to tackle proinflammatory and autoimmune diseases (22)

(96) TABLE-US-00001 TABLE 1 Proteins unique to the excretory-secretory products of individual lifecycle stages of Litomosoides sigmodontis Parasite stage ESP.sup.a Locus tag Annotation PAF nLs_02441 Epicuticlin nLs_07093 Nucleoredoxin-like protein-2 nLs_03968 Nematode cuticle collagen N-terminal domain containing protein nLs_06052 Translationally controlled tumor protein nLs_00526 Glutathione reductase AM nLs_07249 Glutaredoxin-like protein vL3 nLs_06400 Activation-associated secreted protein-1 nLs_09374 Abundant larval transcript-1 protein nLs_03087 Cathepsin L-like precursor nLs_06524 Calmodulin iMf nLs_02254 MSP domain-containing protein .sup.aData for excretory-secretory products unique to gravid adult females are not shown due to the large number of proteins (195) in this category (see Table 3). ESP, excretory-secretory products; PAF, pre-gravid adult female; AM, adult male; vL3, vector-derived third-stage larvae; iMf, immature microfilariae.

(97) TABLE-US-00002 TABLE 2 Putative surface-associated proteins detected in biotin-labelled adult worm whole body extracts that were absent from unlabelled controls Peptides Parasite used for Confidence Presence stage Treatment quantitation score Locus tag Annotation in ESP AM OG 7 857.06 nLs_06907 Adenylate No kinase isoenzyme 1 OG 4 417.27 nLs_09715 Major sperm Yes protein OG 2 186.68 nLs_01742 Filarial antigen No Av33 OG 2 297.13 nLs_08458 Filarial antigen Yes Ov16 SDS 2 308.12 nLs_07359 Calponin actin- No binding domain containing protein GAF OG 2 233.80 nLs_09095 Protein No disulphide isomerase SDS 2 86.22 nLs_08755 Leucine-rich No repeat family protein SDS 3 118.56 nLs_09715 Major sperm Yes protein SDS 2 99.43 nLs_02353 Complement No component 1, q subcomponent- binding, mitochondrial- like SDS 2 61.97 nLs_01344 Thioredoxin No peroxidase 1 SDS 2 108.87 nLs_07321 Vitellogenin Yes PBS 2 309.24 nLs_00851 DNA repair Yes protein Rad4- containing protein PBS 2 309.24 nLs_07061 Heat shock 70 kDa Yes protein PBS 2 309.24 nLs_09360 FMN-binding No domain protein PBS 3 463.79 nLs_01364 Transthyretin- Yes like protein, partial PBS 2 309.24 nLs_03263 Thioredoxin Yes domain- containing protein ESP, excretory-secretory products; AM, adult male; OG, octyl ?-D-glucopyranoside; GAF, gravid adult female; FMN, flavin mononucleotide.

(98) TABLE-US-00003 TABLE 3 Protein predictions from the WLS genome Normalised iBAQ values wLs acc Description GAF ESP GAF WBE PAF ES PAF WBE AM ESP wLs_340 co-chaperonin GroES 0.001135899 0.006317773 0.004180529 0.008366027 wLs_2830 molecular chaperone GroEL 0.000349505 0.001423155 0.000279378 0.013718142 wLs_3910 Outer surface protein Wsp 0.001218499 0.005119482 wLs_4630 hypothetical protein 0.000583035 0.001471599 ws_5240 hypothetical protein Wbm0603 0.000387749 0.001641741 wLs_1920 50S ribosomal protein L7/L12 0.000380102 wLs_9920 thioredoxin 0.000269733 wLs_930 Outer membrane protein, pal-like 0.000133493 0.000208532 wLs_4010 molecular chaperone DnaK 4.7978E?05 0.000214183 wLs_1320 hypothetical protein Wbm0010 3.3069E?05 0.000286269 wLs_5680 isoprenoid biosynthesis protein 9.91181E?06 0.000233577 with amidotransferase-like domain wLs_9580 elongation factor Tu 0.000538185 wLs_8490 hypothetical protein Wbm0655 0.000190391 wLs_5270 superoxide dismutase, SodA 0.000182807 wLs_1650 nucleoid DNA-binding protein 9.97899E?05 wLs_5000 heat shock protein 90 1.99158E?05 Normalised iBAQ values wLs acc Description AM WBE vL3 ESP vL3 WBE IMF ESP IMF WBE wLs_340 co-chaperonin GroES 0.000987231 0.004898528 0.007004044 wLs_2830 molecular chaperone GroEL 0.000305902 0.001431935 0.005708963 wLs_3910 Outer surface protein Wsp 0.000169721 0.003337764 0.002241786 wLs_4630 hypothetical protein 0.000104917 ws_5240 hypothetical protein Wbm0603 2.49886E?05 0.00097545 0.004069358 wLs_1920 50S ribosomal protein L7/L12 wLs_9920 thioredoxin wLs_930 Outer membrane protein, pal-like 3.65116E?05 0.000291644 wLs_4010 molecular chaperone DnaK 0.000236783 wLs_1320 hypothetical protein Wbm0010 1.90627E?06 1.60884E?05 0.000626075 wLs_5680 isoprenoid biosynthesis protein with amidotransferase-like domain wLs_9580 elongation factor Tu wLs_8490 hypothetical protein Wbm0655 wLs_5270 superoxide dismutase, SodA wLs_1650 nucleoid DNA-binding protein 0.00025721 wLs_5000 heat shock protein 90

(99) TABLE-US-00004 TABLE 4 Homologues of abundant Litomosoides sigmodontis excretory-secretory proteins identified by DELTA-BLAST (National Centre for Biotechnology Information) Identity Query cover Query Filter.sup.a Top annotated hit.sup.b [species] and accession Max. score (%) (%) E-value nLs_00113 AT PAN domain containing protein [Brugia malayi] XP_001900239.1 652 37 77 0.0 FE Flagellin [Salmonella enterica] WP_023208887.1 134 15 12 2.sup.?28 CO Protein SRAP-1, isoform a [C. elegans] NP_495398.3 114 26 56 3.sup.?24 nLs_01398 AT Protein UNC-52, isoform m [Caenorhabditis elegans] NP_001254444.1 1848 52 97 0.0 nLs_02001 AT KH domain-containing protein [Loa loa] EFO27012.2 513 75 58 2.sup.?174 FE Far upstream element-binding protein 1-like [Setaria italica] XP_004972470.1 97.4 18 65 5.sup.?18 CO RNA helicase GLH-2 [C. elegans] AAB03337.1 72.0 25 33 2.sup.?12 nLs_03577 AT Hypothetical protein Bm1_38495 [Brugia malayi] XP_001899152.1 128 60 100 2.sup.?31 FE Heavy metal translocating P-type ATPase [Dorea sp. 5-2] WP_016217557.1 63.5 29 74 2.sup.?08 CO Protein THOC-2 [C. elegans] NP_498392.2 42.0 27 55 1.sup.?03 nLs_04059 AT Hypothetical protein LOAG_17826 [Loa loa] EJD74931.1 262 51 87 7.sup.?80 FE A disintegrin and metalloproteinase with thrombospondin motifs 3-like 52.0 29 68 7.sup.?04 [Aplysia californica] XP_005091919.1 CO .sup.c nLs_05850 AT Hypothetical protein LOAG_04060 [Loa loa] XP_003139645.1 269 54 94 1.sup.?80 FE Chondroltin proteoglycan 2 [Ascaris suum] ERG86992.1 247 25 98 1.sup.?68 CO CBR-CPG-2 protein [C. briggsae] XP_002633936.1 218 20 93 8.sup.?63 nLs_08836 AT Apolipophorin [Ascaris suum] ERG86007.1 1535 42 99 0.0 FE Zonadhesin-like [Saccoglossus kowalevskii] XP_002738323.1 256 19 44 4.sup.?65 CO Protein VIT-4 [C. elegans] NP_508612.1 97.1 21 8 9.sup.?20 nLs_01626 AT Animal heme peroxidase [Loa loa] XP_003141164.1 1367 84 98 0.0 FE Peroxidasin-like protein [Ascaris suum] ERG87495.1 1308 72 98 0.0 CO CBR-PXN-2 protein [C. briggsae] XP_002644069.1 1093 47 99 0.0 AT, all taxa; FE, Filarloidea excluded; CO, Caenorhabditis only. .sup.aFilters were applied only where the top hit was to taxa other than Caenorhabditis spp. .sup.bOnly annotated hits are shown for non-filarial proteins. .sup.cThe only hits were to hypothetical proteins containing ShK domains.

(100) TABLE-US-00005 TABLE 5 Homologues of abundant Litomosoides sigmodontis excretory-secretory proteins identified by PSI-BLAST (Phyre.sup.2) Normalised UniRef50 identity Query Top annotated hit [species] ID Bits [%] E-value nLs_02001 Transcription elongation factor SPT5 P0CR70 135 14.9 3.sup.?30 [Crytococcus neoformans var. neoformans serotype D] nLs_04059 Sortilin-related receptor [Homo sapiens] Q92673 210 10.0 1.sup.?52 nLs_08836 SCO-spondin [Danio rerio] B3LF39 351 10.4 1.sup.?94

(101) TABLE-US-00006 Quantifiable proteins present in the excretory-secretory products of blood-derived microfilariae Peptides used for Confidence Normalised Accession | Gene name quantification score Description (species) iBAQ Q91X72|HEMO_MOUSE 7 898.19 Hemopexin (Mus musculus) 1.44.sup.?03 Q8VCM7|FIBG_MOUSE 8 1040.62 Fibrinogen ? chain (Mus musculus) 1.15.sup.?01 Q8K0E8|FIBB_MOUSE 9 1594.25 Fibrinogen ? chain (Mus musculus) 9.56.sup.?02 O35090|ALBU_MERUN 29 5013.66 Serum albumin (Meriones unguiculatus) 6.09.sup.?02 P70274||SEPP1_MOUSE 3 203.64 Selenoprotein P (Mus musculus) 5.76.sup.?02 Q61147|CERU_MOUSE 12 2215.19 Ceruloplasmin (Mus musculus) 5.56.sup.?02 P29788|VTNC_MOUSE 6 1035.62 Vitronectin (Mus musculus) 5.43.sup.?02 Q61702|ITIH1_MOUSE 7 1236.34 Inter-?-trypsin inhibitor heavy chain H1 (Mus musculus) 5.32.sup.?02 P11276|FINC_MOUSE 49 8184.33 Fibronectin (Mus musculus) 3.80.sup.?02 P01027|CO3_MOUSE 28 3368.39 Complement C3 (Mus musculus) 3.63.sup.?02 P01942|HBA_MOUSE 2 149.76 Hemoglobin subunit ? (Mus musculus) 3.60.sup.?02 P97515|FETUA_MERUN 6 665.57 ?-2-HS-glycoprotein (Meriones unguiculatus) 3.24.sup.?02 P20918|PLMN_MOUSE 13 2062.8 Plasminogen (Mus musculus) 3.13.sup.?02 P13020|GEL5_MOUSE 5 1587.22 Gelsolin (Mus musculus) 2.83.sup.?02 Q62577|AMBP_MERUN 6 1120.89 Protein AMBP (Meriones unguiculatus) 2.33.sup.?02 P01029|CO4B_MOUSE 11 1814.14 Complement C4-B (Mus musculus) 1.52.sup.?02 P05367|SAA2_MOUSE 4 820.91 Serum amyloid A-2 protein (Mus musculus) 1.34.sup.?02 Q61703|ITIH2_MOUSE 7 1223.42 Inter-?-trypsin inhibitor heavy chain H2 (Mus musculus) 9.20.sup.?03 nLs.2.1.2.t10069-RA 4 264.21 Transthyretin-like protein, partial (Litomosoides 9.11.sup.?03 sigmodontis) P04186|CFAB_MOUSE 6 361.74 Complement factor B (Mus musculus) 8.08.sup.?03 P52430|PON1_MOUSE 2 166.19 Serum paraoxonase/arylesterase 1 (Mus musculus) 7.36.sup.?03 Q02105|C1QC_MOUSE 2 292.88 Complement C1q subcomponent subunit C (Mus musculus) 6.31.sup.?03 P06909|CFAH_MOUSE 2 156.16 Complement factor H (Mus musculus) 5.81.sup.?03 P05017|GF1_MOUSE 2 458.52 Insulin-like growth factor I (Mus musculus) 5.69.sup.?03 P14105|C1QB_MOUSE 2 62.86 Complement C1q subcomponent subunit B (Mus musculus) 3.94.sup.?03 A6X935|ITIH4_MOUSE 4 301.36 Inter-?-trypsin inhibitor, heavy chain 4 (Mus musculus) 3.94.sup.?03 E7D4P4|E7D4P4_MERUN 9 1172.7 Apolipoprotein E (Meriones unguiculatus) 3.78.sup.?03 P97298|PEDF_MOUSE 5 420.63 Pigment epithelium-derived factor (Mus musculus) 3.31.sup.?03 P47878|IBP3_MOUSE 5 520.36 Insulin-like growth factor-binding protein 3 (Mus musculus) 3.10.sup.?03 P46412|GPX3_MOUSE 3 275.46 Glutathione peroxidase 3 (Mus musculus) 2.99.sup.?03 Q88H35|CO8B_MOUSE 4 586.84 Complement component C8 ? chain (Mus musculus) 2.99.sup.?03 Q64118|A1AT_MERUN 3 183.98 ?-1-antitrypsin (Meriones unguiculatus) 2.89.sup.?03 Q06890|CLUS_MOUSE 5 427.41 Clusterin (Mus musculus) 1.91.sup.?03 P70389|ALS_MOUSE 3 471.58 Insulin-like growth factor-binding protein complex acid 1.88.sup.?03 labile subunit (Mus musculus) P35441|TSP1_MOUSE 8 853.9 Thrombospondin-1 (Mus musculus) 1.81.sup.?03 P68033|ACTC_MOUSE 2 978.66 Actin, ? cardiac muscle 1 (Mus musculus) 1.64.sup.?03 Q00724|RET4_MOUSE 4 335.66 Retinol-binding protein 4 (Mus musculus) 1.63.sup.?03 P26262|KLKB1_MOUSE 5 625.92 Plasma kallikrein (Mus musculus) 1.52.sup.?03 Q61704|ITIH3_MOUSE 4 422.55 Inter-?-trypsin inhibitor heavy chain H3 (Mus musculus) 1.52.sup.?03 P19221|THRB_MOUSE 7 587.54 Prothrombin (Mus musculus) 1.45.sup.?03 P33434|MMP2_MOUSE 3 283.7 72 kDa type IV collagenase (Mus musculus) 1.42.sup.?03 Q9JHH6|CBPB2_MOUSE 3 367.6 Carboxypeptidase B2 (Mus musculus) 1.38.sup.?03 P32261|ANT3_MOUSE 2 306.33 Antithrombin-III (Mus musculus) 1.30.sup.?03 nLs.2.1.2.t03443-RA 3 366.35 Hypothetical protein, Bm1_50630 homolog (Litomosoides 1.18.sup.?03 sigmodontis) nLs.2.1.2.t01366-RA 2 269.78 Transthyretin-like protein, partial (Litomosoides 9.56.sup.?04 sigmodontis) P11680|PROP_MOUSE 2 36.41 Properdin (Mus musculus) 9.27.sup.?04 Q61645|HPT_MOUSE 3 236.91 Haptoglobin (Mus musculus) 8.65.sup.?04 Q9JM99|PRG4_MOUSE 5 683.96 Proteoglycan 4 (Mus musculus) 8.57.sup.?04 Q92111|TRFE_MOUSE 4 728.55 Serotransferrin (Mus musculus) 8.09.sup.?04 P28798|GRN_MOUSE 2 300.7 Granulins (Mus musculus) 7.86.sup.?04 P26928|HGFL_MOUSE 4 375.93 Hepatocyte growth factor-like protein (Mus musculus) 7.43.sup.?04 Q9UN5|CBPN_MOUSE 3 219.53 Carboxypeptidase N catalytic chain (Mus musculus) 7.01.sup.?04 P47879|IBP4_MOUSE 2 211.08 Insulin-like growth factor-binding protein 4 (Mus musculus) 6.96.sup.?04 Q07968|F13B_MOUSE 3 410.68 Coagulation factor XIII B chain (Mus musculus) 6.89.sup.?04 Q9DBD0|ICA_MOUSE 6 787.37 Inhibitor of carbonic anhydrase (Mus musculus) 5.99.sup.?04 P97290|IC1_MOUSE 4 387.11 Plasma protease C1 inhibitor (Mus musculus) 5.94.sup.?04 Q8K182|CO8A_MOUSE 2 332.91 Complement component C8 ? chain (Mus musculus) 5.78.sup.?04 Q70362|PHLD_MOUSE 2 100.85 Phosphatidylinositol-glycan-specific phospholipase D 4.92.sup.?04 (Mus musculus) P01872|IGHM_MOUSE 2 174.92 Ig ? chain C region secreted from (Mus musculus) 4.48.sup.?04 P06684|COS_MOUSE 2 338.69 Complement CS (Mus musculus) 4.07.sup.?04 Q8K0D2|HABP2_MOUSE 2 60.74 Hyaluronan-binding protein 2 (Mus musculus) 3.53.sup.?04 nLs.2.1.2.t01870-RA 2 196.87 ML domain-containing protein (Litomosoides sigmodontis) 3.44.sup.?04 nLs.2.1.2.t01365-RA 2 188.68 Transthyretin-like protein, partial (Litomosoides 2.74.sup.?04 sigmodontis) P28665|MUG1_MOUSE 3 312.94 Murinoglobulin-1 (Mus musculus) 2.05.sup.?04 Q08879|FBLN1_MOUSE 2 305.68 Fibulin-1 (Mus musculus) 1.90.sup.?04 Q8CG16|C1RA_MOUSE 2 102.86 Complement C1r-A subcomponent (Mus musculus) 1.04.sup.?04 IBAQ, intensity-based absolute quantification; AMBP, ?-1-microglobulin/bikunin precursor.

(102) TABLE-US-00007 TABLE 7 Putative surface-associated proteins exhibiting >50-fold enrichment in biotin-labelled adult worm whole body extracts relative to unlabelled controls Parasite Peptides used for Confidence Presence stage Treatment quantification score Fold-difference Locus tag Annotation in ESP AM SDS 4 316.19 1,769.5 nLs_09715 Major sperm protein Yes SDS 2 249.88 341.7 nLs_01747 Filarial antigen RAL-2 Yes SDS 6 873.95 62.2 nLs_06907 Adenylate kinase isoenzyme 1 No PBS 4 172.54 50.6 nLs_09625 Transthyretin-like protein 5 Yes GAF Urea 2 306.56 430.9 nLs_02969 Cysteine protease inhibitor-2 Yes Urea 2 180.49 149.4 nLs_08458 Filarial antigen Ov16 Yes Urea 2 302.26 65.2 nLs_09625 Transthyretin-like protein 5 Yes OG 2 233.80 60,617.8 nLs_09890 Purine nucleoside phosphorylase Yes OG 2 183.22 336.5 nLs_00852 Proliferating cell nuclear antigen domain protein No OG 2 224.62 271.9 nLs_04749 60S ribosomal protein L18 No OG 2 191.67 168.3 nLs_01364 Transthyretin-like protein, partial Yes OG 3 194.25 156.3 nLs_02023 Tetratricopeptide-repeat domain protein Yes OG 2 159.32 139.9 nLs_02001 KH domain-containing protein Yes OG 2 188.56 118.1 nLs_08084 Type I inositol-trisphosphate 5-phosphatase Yes OG 3 367.83 79.9 nLs_02969 Cysteine protease inhibitor-2 Yes OG 3 367.26 66.6 nLs_02463 FKBP-type peptidyl-prolyl cis-trans isomerase Yes OG 3 220.00 65.6 nLs_00523 KH domain containing protein Yes OG 3 376.34 59.0 wLs_3910 Wolbachia surface protein No OG 2 258.28 52.2 nLs_05241 Tetratricopeptide-repeat domain protein No SDS 2 50.67 1,059.7 nLs_07759 Cyclophilin Ovcyp-2 homologue Yes SDS 6 306.80 328.9 nLs_08458 Filarial antigen Ov16 Yes SDS 7 488.42 304.1 nLs_01747 Filarial antigen RAL-2 Yes SDS 4 156.74 262.8 nLs_05279 HSP20/?-crystallin family protein No SDS 2 144.16 242.7 nLs_08696 Lysozyme protein 8, partial Yes SDS 2 87.95 235.6 nLs_09890 Purine nucleoside phosphorylase Yes SDS 7 432.37 216.4 nLs_09625 Transthyretin-like protein 5 Yes SDS 2 82.06 202.7 nLs_2001 KH domain-containing protein Yes SDS 6 332.26 193.2 nLs_08148 Papilin Yes SDS 2 122.31 162.4 nLs_06907 Adenylate kinase isoenzyme 1 Yes SDS 2 44.96 162.1 nLs_00117 L-lactate dehydrogenase Yes SDS 3 144.30 148.4 nLs_05914 Pyruvate dehydrogenase E1 component, ?- Yes subunit SDS 2 77.92 115.1 nLs_09750 Transthyretin-like protein 45 Yes SDS 7 329.76 86.5 nLs_03034 p27 heat shock protein homologue Yes SDS 5 166.70 82.3 nLs_08836 von Willebrand factor type-d domain protein Yes SDS 3 138.70 71.7 nLs_03328 Myosin No SDS 2 89.16 67.5 nLs_01364 Transthyretin-like protein, partial Yes SDS 6 560.89 52.8 nLs_08415 Enolase Yes PBS 5 631.96 111.4 nLs_02378 Aldo/keto reductase family protein No PBS 2 309.24 104.0 nLs_03070 Atypical RIO/RIO2 protein kinase Yes PBS 3 372.59 93.5 nLs_00473 Aldehyde dehydrogenase 11 Yes PBS 6 1058.57 89.2 nLs_06488 Acid phosphatase Yes PBS 9 1570.87 69.9 nLs_01747 Filarial antigen RAL-2 Yes PBS 4 647.70 62.5 nLs_03174 Nematode secreted protein 22U Yes ESP, excretory-secretory products; AM, adult male; OG, octyl ?-D-glucopyranoside; GAF, gravid adult female; FKBP, FK506-binding protein; HSP, heat-shock protein

REFERENCES

(103) 1. Mathers, C. D., Ezzati, M., and Lopez, A. D. (2007) Measuring the burden of neglected tropical diseases: the global burden of disease framework. PLoS Negl. Trop. Dis. 1, e114 2. Gardon, J., Gardon-Wendel, N., Demanga, N., Kamgno, J., Chippaux, J. P., and Boussinesq, M. (1997) Serious reactions after mass treatment of onchocerciasis with ivermectin in an area endemic for Loa loa infection. Lancet 350, 18-22 3. McCall, J. W., Genchi, C., Kramer, L. H., Guerrero, J., and Venco, L. (2008) Heartworm disease in animals and humans. Adv. Parasitol. 66, 193-285 4. Wahl, G., Achukwi, M. D., Mbah, D., Dawa, O., and Renz, A. (1994) Bovine onchocercosis in north Cameroon. Vet. Parasitol. 52, 297-311 5. Osei-Atweneboana, M. Y., Eng, J. K., Boakye, D. A., Gyapong, J. O., and Prichard, R. K. (2007) Prevalence and intensity of Onchocerca volvulus infection and efficacy of ivermectin in endemic communities in Ghana: a two-phase epidemiological study. Lancet 369, 2021-2029 6. Bourguinat, C., Keller, K., Bhan, A., Peregrine, A., Geary, T., and Prichard, R. (2011) Macrocyclic lactone resistance in Dirofilaria immitis. Vet. Parasitol. 181, 388-392 7. Morris, C. P., Evans, H., Larsen, S. E., and Mitre, E. (2013) A comprehensive, model-based review of vaccine and repeat infection trials for filariasis. Clin. Microbiol. Rev. 26, 381-421 8. Tamarozzi, F., Halliday, A., Gentil, K., Hoerauf, A., Pearlman, E., and Taylor, M. J. (2011) Onchocerciasis: the role of Wolbachia bacterial endosymbionts in parasite biology, disease pathogenesis, and treatment. Clin. Microbiol. Rev. 24, 459-468 9. Ghedin, E., Wang, S., Spiro, D., Caler, E., Zhao, Q., Crabtree, J., Allen, J. E., Delcher, A. L., Guiliano, D. B., Miranda-Saavedra, D., Angiuoli, S. V., Creasy, T., Amedeo, P., Haas, B., EI-Sayed, N. M., Wortman, J. R., Feldblyum, T., Tallon, L., Schatz, M., Shumway, M., Koo, H., Salzberg, S. L., Schobel, S., Pertea, M., Pop, M., White, O., Barton, G. J., Carlow, C. K., Crawford, M. J., Daub, J., Dimmic, M. W., Estes, C. F., Foster, J. M., Ganatra, M., Gregory, W. F., Johnson, N. M., Jin, J., Komuniecki, R., Korf, I., Kumar, S., Laney, S., Li, B. W., Li, W., Lindblom, T. H., Lustigman, S., Ma, D., Maina, C. V., Martin, D. M., McCarter, J. P., McReynolds, L., Mitreva, M., Nutman, T. B., Parkinson, J., Peregrin-Alvarez, J. M., Poole, C., Ren, Q., Saunders, L., Sluder, A. E., Smith, K., Stanke, M., Unnasch, T. R., Ware, J., Wei, A. D., Weil, G., Williams, D. J., Zhang, Y., Williams, S. A., Fraser-Liggett, C., Slatko, B., Blaxter, M. L., and Scott, A. L. (2007) Draft genome of the filarial nematode parasite Brugia malayi. Science 317, 1756-1760 10. Godel, C., Kumar, S., Koutsovoulos, G., Ludin, P., Nilsson, D., Comandatore, F., Wrobel, N., Thompson, M., Schmid, C. D., Goto, S., Bringaud, F., Wolstenholme, A., Bandi, C., Epe, C., Kaminsky, R., Blaxter, M., and Maser, P. (2012) The genome of the heartworm, Dirofilaria immitis, reveals drug and vaccine targets. FASEB J. 26, 4650-4661 11. Desjardins, C. A., Cerqueira, G. C., Goldberg, J. M., Dunning Hotopp, J. C., Haas, B. J., Zucker, J., Ribeiro, J. M., Saif, S., Levin, J. Z., Fan, L., Zeng, Q., Russ, C., Wortman, J. R., Fink, D. L., Birren, B. W., and Nutman, T. B. (2013) Genomics of Loa loa, a Wolbachia-free filarial parasite of humans. Nat. Genet. 45, 495-500 12. Foster, J., Ganatra, M., Kamal, I., Ware, J., Makarova, K., Ivanova, N., Bhattacharyya, A., Kapatral, V., Kumar, S., Posfai, J., Vincze, T., Ingram, J., Moran, L., Lapidus, A., Omelchenko, M., Kyrpides, N., Ghedin, E., Wang, S., Goltsman, E., Joukov, V., Ostrovskaya, O., Tsukerman, K., Mazur, M., Comb, D., Koonin, E., and Slatko, B. (2005) The Wolbachia genome of Brugia malayi: endosymbiont evolution within a human pathogenic nematode. PLoS Biol. 3, e121 13. Darby, A. C., Armstrong, S. D., Bah, G. S., Kaur, G., Hughes, M. A., Kay, S. M., Koldkjaer, P., Rainbow, L., Radford, A. D., Blaxter, M. L., Tanya, V. N., Trees, A. J., Cordaux, R., Wastling, J. M., and Makepeace, B. L. (2012) Analysis of gene expression from the Wolbachia genome of a filarial nematode supports both metabolic and defensive roles within the symbiosis. Genome Res. 22, 2467-2477 14. Hewitson, J. P., Harcus, Y. M., Curwen, R. S., Dowle, A. A., Atmadja, A. K., Ashton, P. D., Wilson, A., and Maizels, R. M. (2008) The secretome of the filarial parasite, Brugia malayi: proteomic profile of adult excretory-secretory products. Mol. Biochem. Parasitol. 160, 8-21 15. Bennuru, S., Meng, Z., Ribeiro, J. M., Semnani, R. T., Ghedin, E., Chan, K., Lucas, D. A., Veenstra, T. D., and Nutman, T. B. (2011) Stage-specific proteomic expression patterns of the human filarial parasite Brugia malayi and its endosymbiont Wolbachia. Proc. Natl. Acad. Sci. U. S. A 108, 9649-9654 16. Moreno, Y., and Geary, T. G. (2008) Stage- and gender-specific proteomic analysis of Brugia malayi excretory-secretory products. PLoS Negl. Trop. Dis. 2, e326 17. Bennuru, S., Semnani, R., Meng, Z., Ribeiro, J. M., Veenstra, T. D., and Nutman, T. B. (2009) Brugia malayi excreted/secreted proteins at the host/parasite interface: stage- and gender-specific proteomic profiling. PLoS Negl. Trop. Dis. 3, e410 18. Petit, G., Diagne, M., Marechal, P., Owen, D., Taylor, D., and Bain, O. (1992) Maturation of the filaria Litomosoides sigmodontis in BALB/c mice; comparative susceptibility of nine other inbred strains. Ann. Parasitol. Hum. Comp 67, 144-150 19. Hoffmann, W., Petit, G., Schulz-Key, H., Taylor, D., Bain, O., and LeGoff, L. (2000) Litomosoides sigmodontis in mice: reappraisal of an old model for filarial research. Parasitol. Today 16, 387-389 20. Bain, O., Petit, G., and Diagne, M. (1989) [Litomosoides, parasites of rodents; taxonomic consequences]. Ann. Parasitol. Hum. Comp 64, 268-289 21. Pfaff, A. W., Schulz-Key, H., Soboslay, P. T., Taylor, D. W., MacLennan, K., and Hoffmann, W. H. (2002) Litomosoides sigmodontis cystatin acts as an immunomodulator during experimental filariasis. Int. J. Parasitol. 32, 171-178 22. Hubner, M. P., Shi, Y., Torrero, M. N., Mueller, E., Larson, D., Soloviova, K., Gondorf, F., Hoerauf, A., Killoran, K. E., Stocker, J. T., Davies, S. J., Tarbell, K. V., and Mitre, E. (2012) Helminth protection against autoimmune diabetes in nonobese diabetic mice is independent of a type 2 immune shift and requires TGF-beta. J. Immunol. 188, 559-568 23. LeGoff, L., Martin, C., Oswald, I. P., Vuong, P. N., Petit, G., Ungeheuer, M. N., and Bain, O. (2000) Parasitology and immunology of mice vaccinated with irradiated Litomosoides sigmodontis larvae. Parasitology 120 (Pt 3), 271-280 24. Babayan, S. A., Luo, H., Gray, N., Taylor, D. W., and Allen, J. E. (2012) Deletion of parasite immune modulatory sequences combined with immune activating signals enhances vaccine mediated protection against filarial nematodes. PLoS Negl. Trop. Dis. 6, e1968 25. Taylor, M. D., LeGoff, L., Harris, A., Malone, E., Allen, J. E., and Maizels, R. M. (2005) Removal of regulatory T cell activity reverses hyporesponsiveness and leads to filarial parasite clearance in vivo. J. Immunol. 174, 4924-4933 26. Darby, A. C., Christina, G. A., Armstrong, S. D., Hartley, C. S., Xia, D., Wastling, J. M., and Makepeace, B. L. (2013) Integrated transcriptomic and proteomic analysis of the global response of Wolbachia to doxycycline-induced stress. ISME. J. doi:10.1038/ismej.2013.192 27. Comandatore, F., Sassera, D., Montagna, M., Kumar, S., Koutsovoulos, G., Thomas, G., Repton, C., Babayan, S. A., Gray, N., Cordaux, R., Darby, A., Makepeace, B., and Blaxter, M. (2013) Phylogenomics and analysis of shared genes suggest a single transition to mutualism in Wolbachia of nematodes. Genome Biol. Evol. 5, 1668-1674 28. Schwanhausser, B., Busse, D., Li, N., Dittmar, G., Schuchhardt, J., Wolf, J., Chen, W., and Selbach, M. (2011) Global quantification of mammalian gene expression control. Nature 473, 337-342 29. Vizcaino, J. A., Cote, R. G., Csordas, A., Dianes, J. A., Fabregat, A., Foster, J. M., Griss, J., Alpi, E., Birim, M., Contell, J., O'Kelly, G., Schoenegger, A., Ovelleiro, D., Perez-Riverol, Y., Reisinger, F., Rios, D., Wang, R., and Hermjakob, H. (2013) The PRoteomics IDEntifications (PRIDE) database and associated tools: status in 2013. Nucleic Acids Res. 41, D1063-D1069 30. R Development Core Team. (2013) R: A Language and Environment for Statistical Computing, The R Foundation for Statistical Computing, Vienna, Austria 31. Benjamini, Y., and Hochberg, Y. (1995) Controlling the False Discovery RateA Practical and Powerful Approach to Multiple Testing. Journal of the Royal Statistical Society Series B-Methodological 57, 289-300 32. Kelley, L. A., and Sternberg, M. J. (2009) Protein structure prediction on the Web: a case study using the Phyre server. Nat. Protoc. 4, 363-371 33. Quevillon, E., Silventoinen, V., Pillai, S., Harte, N., Mulder, N., Apweiler, R., and Lopez, R. (2005) InterProScan: protein domains identifier. Nucleic Acids Res. 33, W116-W120 34. Martin, B., Chadwick, W., Yi, T., Park, S. S., Lu, D., Ni, B., Gadkaree, S., Farhang, K., Becker, K. G., and Maudsley, S. (2012) VENNTUREa novel Venn diagram investigational tool for multiple pharmacological dataset analysis. PLoS One 7, e36911 35. Petersen, T. N., Brunak, S., von, H. G., and Nielsen, H. (2011) SignalP 4.0: discriminating signal peptides from transmembrane regions. Nat. Methods 8, 785-786 36. Bendtsen, J. D., Jensen, L. J., Blom, N., von, H. G., and Brunak, S. (2004) Feature-based prediction of non-classical and leaderless protein secretion. Protein Eng Des Sel 17, 349-356 37. Claros, M. G., and Vincens, P. (1996) Computational method to predict mitochondrially imported proteins and their targeting sequences. Eur. J. Biochem. 241, 779-786 38. Steentoft, C., Vakhrushev, S. Y., Joshi, H. J., Kong, Y., Vester-Christensen, M. B., Schjoldager, K. T., Lavrsen, K., Dabelsteen, S., Pedersen, N. B., Marcos-Silva, L., Gupta, R., Bennett, E. P., Mandel, U., Brunak, S., Wandall, H. H., Levery, S. B., and Clausen, H. (2013) Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology. EMBO J. 32, 1478-1488 39. Duckert, P., Brunak, S., and Blom, N. (2004) Prediction of proprotein convertase cleavage sites. Protein Eng Des Sel 17, 107-112 40. Jex, A. R., Liu, S., Li, B., Young, N. D., Hall, R. S., Li, Y., Yang, L., Zeng, N., Xu, X., Xiong, Z., Chen, F., Wu, X., Zhang, G., Fang, X., Kang, Y., Anderson, G. A., Harris, T. W., Campbell, B. E., Vlaminck, J., Wang, T., Cantacessi, C., Schwarz, E. M., Ranganathan, S., Geldhof, P., Nejsum, P., Sternberg, P. W., Yang, H., Wang, J., Wang, J., and Gasser, R. B. (2011) Ascaris suum draft genome. Nature 479, 529-533 41. Sievers, F., and Higgins, D. G. (2014) Clustal Omega, accurate alignment of very large numbers of sequences. Methods Mol. Biol. 1079, 105-116 42. Ronquist, F., Teslenko, M., van der Mark, P., Ayres, D. L., Darling, A., Hohna, S., Larget, B., Liu, L., Suchard, M. A., and Huelsenbeck, J. P. (2012) MrBayes 3.2: efficient Bayesian phylogenetic inference and model choice across a large model space. Syst. Biol. 61, 539-542 43. Crooks, G. E., Hon, G., Chandonia, J. M., and Brenner, S. E. (2004) WebLogo: a sequence logo generator. Genome Res. 14, 1188-1190 44. Gallin, M. Y., Tan, M., Kron, M. A., Rechnitzer, D., Greene, B. M., Newland, H. S., White, A. T., Taylor, H. R., and Unnasch, T. R. (1989) Onchocerca volvulus recombinant antigen: physical characterization and clinical correlates with serum reactivity. J. Infect. Dis. 160, 521-529 45. Dissanayake, S., Xu, M., and Piessens, W. F. (1992) A cloned antigen for serological diagnosis of Wuchereria bancrofti microfilaremia with daytime blood samples. Mol. Biochem. Parasitol. 56, 269-277 46. Hunter, S. J., Thompson, F. J., Tetley, L., and Devaney, E. (2001) Temperature is a cue for gene expression in the post-infective L3 of the parasitic nematode Brugia pahangi. Mol. Biochem. Parasitol. 112, 1-9 47. Gare, D., Boyd, J., and Connolly, B. (2004) Developmental regulation and secretion of nematode-specific cysteine-glycine domain proteins in Trichinella spiralis. Mol. Biochem. Parasitol. 134, 257-266 48. Lustigman, S., Brotman, B., Huima, T., Prince, A. M., and McKerrow, J. H. (1992) Molecular cloning and characterization of onchocystatin, a cysteine proteinase inhibitor of Onchocerca volvulus. J. Biol. Chem. 267, 17339-17346 49. Liebau, E., Hoppner, J., Muhlmeister, M., Burmeister, C., Luersen, K., Perbandt, M., Schmetz, C., Buttner, D., and Brattig, N. (2008) The secretory omega-class glutathione transferase OvGST3 from the human pathogenic parasite Onchocerca volvulus. Febs Journal 275, 3438-3453 50. Scott, A. L., Dinman, J., Sussman, D. J., and Ward, S. (1989) Major sperm protein and actin genes in free-living and parasitic nematodes. Parasitology 98 Pt 3, 471-478 51. Zahner, H., Hobom, G., and Stirm, S. (1995) The Microfilarial Sheath and Its Proteins. Parasitology Today 11, 116-120 52. Willenbucher, J., Hofle, W., and Lucius, R. (1993) The filarial antigens Av33/Ov33-3 show striking similarities to the major pepsin inhibitor from Ascaris suum. Mol. Biochem. Parasitol. 57, 349-351 53. Harnett, W., Houston, K. M., Tate, R., Garate, T., Apfel, H., Adam, R., Haslam, S. M., Panico, M., Paxton, T., Dell, A., Morris, H., and Brzeski, H. (1999) Molecular cloning and demonstration of an aminopeptidase activity in a filarial nematode glycoprotein. Mol. Biochem. Parasitol. 104, 11-23 54. Makinen, P. L., and Makinen, K. K. (1981) Purification and properties of rat skin acid phosphatases. Int. J. Pept. Protein Res. 18, 352-369 55. Fukushige, T., Goszczynski, B., Yan, J., and McGhee, J. D. (2005) Transcriptional control and patterning of the pho-1 gene, an essential acid phosphatase expressed in the C. elegans intestine. Dev. Biol. 279, 446-461 56. Ao, J. Q., Ling, E., Rao, X. J., and Yu, X. Q. (2008) A novel ML protein from Manduca sexta may function as a key accessory protein for lipopolysaccharide signaling. Mol. Immunol. 45, 2772-2781 57. Storch, J., and Xu, Z. (2009) Niemann-Pick C2 (NPC2) and intracellular cholesterol trafficking. Biochim. Biophys. Acta 1791, 671-678 58. Erttmann, K. D., and Gallin, M. Y. (1996) Onchocerca volvulus: identification of cDNAs encoding a putative phosphatidyl-ethanolamine-binding protein and a putative partially processed mRNA precursor. Gene 174, 203-207 59. Grant, R. P., Buttery, S. M., Ekman, G. C., Roberts, T. M., and Stewart, M. (2005) Structure of MFP2 and its function in enhancing MSP polymerization in Ascaris sperm amoeboid motility. J. Mol. Biol. 347, 583-595 60. Ou, X., Tang, L., McCrossan, M., Henkle-Duhrsen, K., and Selkirk, M. E. (1995) Brugia malayi: localisation and differential expression of extracellular and cytoplasmic CuZn superoxide dismutases in adults and microfilariae. Exp. Parasitol. 80, 515-529 61. Ford, L., Guiliano, D. B., Oksov, Y., Debnath, A. K., Liu, J., Williams, S. A., Blaxter, M. L., and Lustigman, S. (2005) Characterization of a novel filarial serine protease inhibitor, Ov-SPI-1, from Onchocerca volvulus, with potential multifunctional roles during development of the parasite. J. Biol. Chem. 280, 40845-40856 62. Frank, G. R., Wisnewski, N., Brandt, K. S., Carter, C. R., Jennings, N. S., and Selkirk, M. E. (1999) Molecular cloning of the 22-24 kDa excretory-secretory 22U protein of Dirofilaria immitis and other filarial nematode parasites. Mol. Biochem. Parasitol. 98, 297-302 63. Gnanasekar, M., Padmavathi, B., and Ramaswamy, K. (2005) Cloning and characterization of a novel immunogenic protein 3 (NIP3) from Brugia malayi by immuno screening of a phage-display cDNA expression library. Parasitol. Res. 64. Chu, D. S., Liu, H., Nix, P., Wu, T. F., Ralston, E. J., Yates, J. R., III, and Meyer, B. J. (2006) Sperm chromatin proteomics identifies evolutionarily conserved fertility factors. Nature 443, 101-105 65. Joseph, G. T., Huima, T., Klion, A., and Lustigman, S. (2000) A novel developmentally regulated galectin of Onchocerca volvulus. Mol. Biochem. Parasitol. 106, 187-195 66. Garofalo, A., Klager, S. L., Rowlinson, M. C., Nirmalan, N., Klion, A., Allen, J. E., Kennedy, M. W., and Bradley, J. E. (2002) The FAR proteins of filarial nematodes: secretion, glycosylation and lipid binding characteristics. Mol. Biochem. Parasitol. 122, 161-170 67. Dafa'alla, T. H., Taubert, A., Hobom, G., Beck, E., and Zahner, H. (2000) Molecular characterization of a Litomosoides sigmodontis protein involved in the development of the microfilarial sheath during embryogenesis. Mol. Biochem. Parasitol. 106, 37-50 68. Rogalski, T. M., Mullen, G. P., Bush, J. A., Gilchrist, E. J., and Moerman, D. G. (2001) UNC-52/perlecan isoform diversity and function in Caenorhabditis elegans. Biochem. Soc. Trans. 29, 171-176 69. Olson, S. K., Bishop, J. R., Yates, J. R., Oegema, K., and Esko, J. D. (2006) Identification of novel chondroitin proteoglycans in Caenorhabditis elegans: embryonic cell division depends on CPG-1 and CPG-2. J. Cell Biol. 173, 985-994 70. Jones, M. R., Rose, A. M., and Baillie, D. L. (2012) Oligoarray comparative genomic hybridization-mediated mapping of suppressor mutations generated in a deletion-biased mutagenesis screen. G3. (Bethesda.) 2, 657-663 71. Murray, J., Gregory, W. F., Gomez-Escobar, N., Atmadja, A. K., and Maizels, R. M. (2001) Expression and immune recognition of Brugia malayi VAL-1, a homologue of vespid venom allergens and Ancylostoma secreted proteins. Mol. Biochem. Parasitol. 118, 89-96 72. Gregory, W. F., Blaxter, M. L., and Maizels, R. M. (1997) Differentially expressed, abundant trans-spliced cDNAs from larval Brugia malayi. Mol. Biochem. Parasitol. 87, 85-95 73. Guiliano, D. B., Hong, X., McKerrow, J. H., Blaxter, M. L., Oksov, Y., Liu, J., Ghedin, E., and Lustigman, S. (2004) A gene family of cathepsin L-like proteases of filarial nematodes are associated with larval molting and cuticle and eggshell remodeling. Mol. Biochem. Parasitol. 136, 227-242 74. Blaxter, M. (1998) Caenorhabditis elegans is a nematode. Science 282, 2041-2046 75. Beeton, C., Pennington, M. W., and Norton, R. S. (2011) Analogs of the sea anemone potassium channel blocker ShK for the treatment of autoimmune diseases. Inflamm. Allergy Drug Targets. 10, 313-321 76. Loukas, A., Hintz, M., Linder, D., Mullin, N. P., Parkinson, J., Tetteh, K. K., and Maizels, R. M. (2000) A family of secreted mucins from the parasitic nematode Toxocara canis bears diverse mucin domains but shares similar flanking six-cysteine repeat motifs. J. Biol. Chem. 275, 39600-39607 77. Yamaguchi, Y., Hasegawa, Y., Honma, T., Nagashima, Y., and Shiomi, K. (2010) Screening and cDNA cloning of Kv1 potassium channel toxins in sea anemones. Mar. Drugs 8, 2893-2905 78. Blaxter, M. L., and Robertson, W. M. (1998) The cuticle, In: Perry, R. N., and Wright, D. J. (eds), The physiology and biochemistry of free-living and plant-parasitic nematodes, pp. 25-48, CABI Publishing, Wallingford, Oxon. 79. Yegutkin, G. G. (2008) Nucleotide- and nucleoside-converting ectoenzymes: Important modulators of purinergic signalling cascade. Biochim. Biophys. Acta 1783, 673-694 80. Peerschke, E. I., and Ghebrehiwet, B. (2007) The contribution of gC1qR/p33 in infection and inflammation. Immunobiology 212, 333-342 81. Irvine, M., Huima, T., Prince, A. M., and Lustigman, S. (1994) Identification and characterization of an Onchocerca volvulus cDNA clone encoding a highly immunogenic calponin-like protein. Mol. Biochem. Parasitol. 65, 135-146 82. Wilson, W. R., Tuan, R. S., Shepley, K. J., Freedman, D. O., Greene, B. M., Awadzi, K., and Unnasch, T. R. (1994) The Onchocerca volvulus homologue of the multifunctional polypeptide protein disulfide isomerase. Mol. Biochem. Parasitol. 68, 103-117 83. Mancuso, V. P., Parry, J. M., Storer, L., Poggioli, C., Nguyen, K. C., Hall, D. H., and Sundaram, M. V. (2012) Extracellular leucine-rich repeat proteins are required to organize the apical extracellular matrix and maintain epithelial junction integrity in C. elegans. Development 139, 979-990 84. Lu, W., Egerton, G. L., Bianco, A. E., and Williams, S. A. (1998) Thioredoxin peroxidase from Onchocerca volvulus: a major hydrogen peroxide detoxifying enzyme in filarial parasites. Mol. Biochem. Parasitol. 91, 221-235 85. Babayan, S. A., Allen, J. E., and Taylor, D. W. (2012) Future prospects and challenges of vaccines against filariasis. Parasite Immunol. 34, 243-253 86. Sepsenwol, S., and Taft, S. J. (1990) In vitro induction of crawling in the amoeboid sperm of the nematode parasite, Ascaris suum. Cell Motil. Cytoskeleton 15, 99-110 87. Morgan, K. L., Estevez, A. O., Mueller, C. L., Cacho-Valadez, B., Miranda-Vizuete, A., Szewczyk, N. J., and Estevez, M. (2010) The glutaredoxin GLRX-21 functions to prevent selenium-induced oxidative stress in Caenorhabditis elegans. Toxicol. Sci. 118, 530-543 88. Hawkes, W. C., and Turek, P. J. (2001) Effects of dietary selenium on sperm motility in healthy men. J. Androl 22, 764-772 89. Zhao, Y., Sun, W., Zhang, P., Chi, H., Zhang, M. J., Song, C. Q., Ma, X., Shang, Y., Wang, B., Hu, Y., Hao, Z., Huhmer, A. F., Meng, F., L'hernault, S. W., He, S. M., Dong, M. Q., and Miao, L. (2012) Nematode sperm maturation triggered by protease involves sperm-secreted serine protease inhibitor (Serpin). Proc. Natl. Acad. Sci. U. S. A 109, 1542-1547 90. Johnson, M. H., Orihel, T. C., and Beaver, P. C. (1974) Dipetalonema viteae in the experimentally infected jird, Meriones unguiculatus. I. Insemination, development from egg to microfilaria, reinsemination, and longevity of mated and unmated worms. J. Parasitol. 60, 302-309 91. Funato, Y., and Miki, H. (2007) Nucleoredoxin, a novel thioredoxin family member involved in cell growth and differentiation. Antioxid. Redox. Signal. 9, 1035-1057 92. Kunchithapautham, K., Padmavathi, B., Narayanan, R. B., Kaliraj, P., and Scott, A. L. (2003) Thioredoxin from Brugia malayi: defining a 16-kilodalton class of thioredoxins from nematodes. Infect. Immun. 71, 4119-4126 93. Gems, D., and Riddle, D. L. (1996) Longevity in Caenorhabditis elegans reduced by mating but not gamete production. Nature 379, 723-725 94. Kumari, S., Lillibridge, C. D., Bakeer, M., Lowrie, R. C., Jr., Jayaraman, K., and Philipp, M. T. (1994) Brugia malayi: the diagnostic potential of recombinant excretory/secretory antigens. Exp. Parasitol. 79, 489-505 95. Bardehle, G., Hintz, M., Linder, D., Schares, G., Schott, H. H., Stirm, S., and Zahner, H. (1992) Litomosoides carinii: extraction of the microfilarial sheath components and antigenicity of the sheath fractions. Parasitol. Res. 78, 501-508 96. Maizels, R. M., Philipp, M., Dasgupta, A., and Partoni, F. (1984) Human serum albumin is a major component on the surface of microfilariae of Wuchereria bancrofti. Parasite Immunol. 6, 185-190 97. Shenoy, R. K., Rakesh, P. G., Baldwin, C. I., and Denham, D. A. (1996) The sheath of the microfilaria of Brugia malayi from human infections has IgG on its surface. Parasitol. Res. 82, 382-384 98. Bardehle, G., Jepp-Libutzki, A., Linder, D., Moehnle, K., Schott, H. H., Zahner, H., Zahringer, U., and Stirm, S. (1992) Chemical composition of Litomosoides carinii microfilarial sheaths. Acta Trop. 50, 237-247 99. Halliwell, B., and Gutteridge, J. M. (1990) The antioxidants of human extracellular fluids. Arch. Biochem. Biophys. 280, 1-8 100. Lal, R. B. (1991) Monoclonal antibodies to secreted antigens of Brugia malayi define a cross-reactive non-phosphocholine determinant on helminth parasites. Immunol. Cell Biol. 69 (Pt 2), 127-133 101. Olson, S. K., Greenan, G., Desai, A., Muller-Reichert, T., and Oegema, K. (2012) Hierarchical assembly of the eggshell and permeability barrier in C. elegans. J. Cell Biol. 198, 731-748 102. Johnston, W. L., Krizus, A., and Dennis, J. W. (2010) Eggshell chitin and chitin-interacting proteins prevent polyspermy in C. elegans. Curr. Biol. 20, 1932-1937 103. Schraermeyer, U., Peters, W., and Zahner, H. (1987) Lectin binding studies on adult filariae, intrauterine developing stages and microfilariae of Brugia malayi and Litomosoides carinii. Parasitol. Res. 73, 550-556 104. Jones, M. R., Rose, A. M., and Baillie, D. L. (2013) The ortholog of the human proto-oncogene ROS1 is required for epithelial development in C. elegans. Genesis. 51, 545-561 105. Gotenstein, J. R., Swale, R. E., Fukuda, T., Wu, Z., Giurumescu, C. A., Goncharov, A., Jin, Y., and Chisholm, A. D. (2010) The C. elegans peroxidasin PXN-2 is essential for embryonic morphogenesis and inhibits adult axon regeneration. Development 137, 3603-3613 106. Bi, M., Hickox, J. R., Winfrey, V. P., Olson, G. E., and Hardy, D. M. (2003) Processing, localization and binding activity of zonadhesin suggest a function in sperm adhesion to the zona pellucida during exocytosis of the acrosome. Biochem. J. 375, 477-488 107. Heiman, M. G., and Shaham, S. (2009) DEX-1 and DYF-7 establish sensory dendrite length by anchoring dendritic tips during cell migration. Cell 137, 344-355 108. Matyash, V., Geier, C., Henske, A., Mukherjee, S., Hirsh, D., Thiele, C., Grant, B., Maxfield, F. R., and Kurzchalia, T. V. (2001) Distribution and transport of cholesterol in Caenorhabditis elegans. Mol. Biol. Cell 12, 1725-1736 109. Moreno, Y., Gros, P. P., Tam, M., Segura, M., Valanparambil, R., Geary, T. G., and Stevenson, M. M. (2011) Proteomic analysis of excretory-secretory products of Heligmosomoides polygyrus assessed with next-generation sequencing transcriptomic information. PLoS Negl. Trop. Dis. 5, e1370 110. Nagaraj, S. H., Gasser, R. B., and Ranganathan, S. (2008) Needles in the EST haystack: large-scale identification and analysis of excretory-secretory (ES) proteins in parasitic nematodes using expressed sequence tags (ESTs). PLoS Negl. Trop. Dis. 2, e301 111. Kang, Y., Zhao, D., Liang, H., Liu, B., Zhang, Y., Liu, Q., Wang, X., and Liu, Y. (2012) Structural study of TTR-52 reveals the mechanism by which a bridging molecule mediates apoptotic cell engulfment. Genes Dev. 26, 1339-1350 112. Jacob, J., Vanholme, B., Haegeman, A., and Gheysen, G. (2007) Four transthyretin-like genes of the migratory plant-parasitic nematode Radopholus similis: members of an extensive nematode-specific family. Gene 402, 9-19 113. Saverwyns, H., Visser, A., Van, D. J., Power, D., Morgado, I., Kennedy, M. W., Knox, D. P., Schymkowitz, J., Rousseau, F., Gevaert, K., Vercruysse, J., Claerebout, E., and Geldhof, P. (2008) Analysis of the transthyretin-like (TTL) gene family in Ostertagia ostertagicomparison with other strongylid nematodes and Caenorhabditis elegans. Int. J. Parasitol. 38, 1545-1556 114. Wergin, W. P., and Endo, B. Y. (1976) Ultrastructure of a neurosensory organ in a root-knot nematode. J. Ultrastruct. Res. 56, 258-276 115. Madathiparambil, M. G., Kaleysa, K. N., and Raghavan, K. (2009) A diagnostically useful 200-kDa protein is secreted through the surface pores of the filarial parasite Setaria digitata. Parasitol. Res. 105, 1099-1104 116. Kolotuev, I., Apaydin, A., and Labouesse, M. (2009) Secretion of Hedgehog-related peptides and WNT during Caenorhabditis elegans development. Traffic. 10, 803-810 117. Prusse, A., Vollmer, S., and Diesfeld, H. J. (1983) Immunocytochemical and ultrastructural studies on Dipetalonema viteae (Filarioidea). J. Helminthol. 57, 127-142 118. Kozek, W. J. (2005) What is new in the Wolbachia/Dirofilaria interaction? Vet. Parasitol. 133, 127-132 119. Brattig, N. W., Bazzocchi, C., Kirschning, C. J., Reiling, N., Buttner, D. W., Ceciliani, F., Geisinger, F., Hochrein, H., Ernst, M., Wagner, H., Bandi, C., and Hoerauf, A. (2004) The major surface protein of Wolbachia endosymbionts in filarial nematodes elicits immune responses through TLR2 and TLR4. J. Immunol. 173, 437-445 120. Landmann, F., Foster, J. M., Slatko, B., and Sullivan, W. (2010) Asymmetric Wolbachia segregation during early Brugia malayi embryogenesis determines its distribution in adult host tissues. PLoS Negl. Trop. Dis. 4, e758 121. Melnikow, E., Xu, S., Liu, J., Li, L., Oksov, Y., Ghedin, E., Unnasch, T. R., and Lustigman, S. (2011) Interaction of a Wolbachia WSP-like protein with a nuclear-encoded protein of Brugia malayi. Int. J. Parasitol. 41, 1053-1061 122. Henderson, B., and Martin, A. (2011) Bacterial virulence in the moonlight: multitasking bacterial moonlighting proteins are virulence determinants in infectious disease. Infect. Immun. 79, 3476-3491 123. Hansen, R. D., Trees, A. J., Bah, G. S., Hetzel, U., Martin, C., Bain, O., Tanya, V. N., and Makepeace, B. L. (2011) A worm's best friend: recruitment of neutrophils by Wolbachia confounds eosinophil degranulation against the filarial nematode Onchocerca ochengi. Proc. Biol. Sci. 278, 2293-2302 124. Argueta, J. G., Shiota, S., Yamaguchi, N., Masuhiro, Y., and Hanazawa, S. (2006) Induction of Porphyromonas gingivalis GroEL signaling via binding to Toll-like receptors 2 and 4. Oral Microbiol. Immunol. 21, 245-251 125. Suba, N., Shiny, C., Taylor, M. J., and Narayanan, R. B. (2007) Brugia malayi Wolbachia hsp60 IgG antibody and isotype reactivity in different clinical groups infected or exposed to human bancroftian lymphatic filariasis. Exp. Parasitol. 116, 291-295 126. Storey, D. M., and AI-Mukhtar, A. S. (1982) Vaccination of Jirds, Meriones unguiculatus, against Litomosoides carinii and Brugia pahangi using irradiate larvae of L. carinii. Tropenmed. Parasitol. 33, 23-24 127. Allen, J. E., Daub, J., Guiliano, D., McDonnell, A., Lizotte-Waniewski, M., Taylor, D. W., and Blaxter, M. (2000) Analysis of genes expressed at the infective larval stage validates utility of Litomosoides sigmodontis as a murine model for filarial vaccine development. Infect. Immun. 68, 5454-5458 128. Makepeace, B. L., Jensen, S. A., Laney, S. J., Nfon, C. K., Njongmeta, L. M., Tanya, V. N., Williams, S. A., Bianco, A. E., and Trees, A. J. (2009) Immunisation with a multivalent, subunit vaccine reduces patent infection in a natural bovine model of onchocerciasis during intense field exposure. PLoS Negl. Trop. Dis. 3, e544 129. Ziewer, S., Hubner, M. P., Dubben, B., Hoffmann, W. H., Bain, O., Martin, C., Hoerauf, A., and Specht, S. (2012) Immunization with L. sigmodontis microfilariae reduces peripheral microfilaraemia after challenge infection by inhibition of filarial embryogenesis. PLoS Negl. Trop. Dis. 6, e1558 130. Townson, S., and Bianco, A. E. (1982) Immunization of calves against the microfilariae of Onchocerca lienalis. J. Helminthol. 56, 297-303 131. Hoffmann, W. H., Pfaff, A. W., Schulz-Key, H., and Soboslay, P. T. (2001) Determinants for resistance and susceptibility to microfilaraemia in Litomosoides sigmodontis filariasis. Parasitology 122, 641-649 132. Hashmi, S., Zhang, J., Oksov, Y., Ji, Q., and Lustigman, S. (2006) The Caenorhabditis elegans CPI-2a cystatin-like inhibitor has an essential regulatory role during oogenesis and fertilization. J. Biol. Chem. 281, 28415-28429

(104) TABLE-US-00008 Sequenceinformationandcomparisons embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image AboveisillustrateddomainorganisationoftheShKdomain-containingproteinnLs_04059 fromLitomosoidessigmodontis.Linearrepresentationoftheamino-acidsequence,showing thesignalpeptide(initalics),sixShKtoxin-likedomains(openrectangles)containingsix cysteineresidueseach(highlighted),andapredictedpropeptidecleavagesite(underlined). DomainsixattheC-terminusisuniqueincontainingtwolysyltyrosinedyads(bold). Diro. MGKYKGEIXCCGTGTSCKNICLKFSEFACNSCAKTCGILQSSGRSGVCYDKDPDCSDDVC Lito. ---------------MSPFILLALLINAPANCRPDNGISRSRDASSACYDKDPDCSSDIC .**:*.***:**..*********.*:* Diro. RNYPYTAKERCPKYCGLCRDSSLRSGNPLSSGLSSSYQQSSSSSLPSLKSGITGSTIIKK Lito. KNYPYTAKERCPKFCGLCSDTVSGSSARPSSQFLPSSSQRQSL---------ALTSGAVE :************:*****:*.***:*.*.*:::: Diro. DERKSSLPCIDKDSDCNMEICPNFPYTAKERCAKTCGLCSGETSSS-GIT--SGHHTIAG Lito. KERKSLTSCTDKDSDCTAEICRNYPFTAREPCAKTCGRCSDDVAIGSGSTTAAHRSTAFG .***********.*****:*:**:**********:.:.**::** Diro. IDKSRGGT-TSLLSSRRGNEPFSSGLCFDKKLDCRKEICRDFPFTAKEECAKTCGFCSSD Lito. VEKFKGGSASSSLSPRIGNALISGSLCFDPKFDCSREICRDFPFTARQECAKTCGFCSVD ::*:**::******:*..****:*:**:**********::*********** Diro. KGMSSSSSSGTAFGTMSPSRHAS--------IRINERDGITGIRSTSPHSILSKEKDLEC Lito. TSISSSSSNA-TLRVMSPSVEIGGSSGGTSSHRTAKQDSYEANHNIPAYPRLSRGEELEC ..:*****..::.****..*::*..:.:**:::*** Diro. TDLNTDCTQQICKDYPYTAKERCAKTCGFCRREMTEGDKTSVGGPHSSFTDKQRSPISEL Lito. VDVNIDCTQQTCKDYPFTAREPCAKTCGFCRKGSVVEE------RHSSL----------- .*:***********:**:***********:.:****: Diro. DSRDSSLRGIKSSPTTEDCRDEDSQCSEKSCLDRPYTAPTKCAKTCGFCGS------TVD Lito. ----PAAQGNKATAITKECKDEDSQCSERSCLEHPYKASRKCAKTCGFCGEKSSYGSVIE ::**::*::*:********:***::**.***********..:: Diro. LEPPLVDSLDKGNIITLDDDVTT----RSTATFDRHSTSGIGTP--TQSSRHLSVGSPTD Lito. LESPIAASSDEGSVIALDSDGNDGSSTRSTMTSERRLTSGSGDTMSMQKPKHSSIPGRTD ***:.**:*.:*:**.*.****:*:*****.:**:.*** Diro. SSRK--PSLSTHIQQPTRRPFQGVLGRYPGPTGLCADENAYCQKEDCYKYPPFGQRYCEK Lito. PIRSSSSASTAHIQQPTNKQYLGT-QRYPGRTGPCTDANQLCEKADCYKYPNFSQKYCEK *.:::******.::*.********:***:*******.*.*:**** Diro. TCNYC Lito. TCNYC *****

(105) Illustrated above provides a sequence alignment comparison between ShK domain-containing proteins nLs.2.1.2.t04059-RA (from Litomosoides sigmodontis) of SEQ ID NO.1 and nDi.2.2.2.t03402-RA (from Dirofilaria immitis) of SEQ ID NO.2.

(106) While overall identity between the two sequences is only 52.8%, it can be seen that the identity shared between the ShK domains (highlighted) of these two filarial nematode proteins is considerably higher.