Plexin D1 as a target for tumor diagnosis and therapy
09988449 · 2018-06-05
Assignee
Inventors
- Wilhelmus Petrus Johannes Leenders (Nijmegen, NL)
- Ilse Roodink (Loenen, NL)
- Jozef Maria Hendrik Raats (Nijmegen, NL)
Cpc classification
A61P29/00
HUMAN NECESSITIES
C07K14/705
CHEMISTRY; METALLURGY
C07K2317/569
CHEMISTRY; METALLURGY
A61P9/10
HUMAN NECESSITIES
A61K9/0019
HUMAN NECESSITIES
C07K16/28
CHEMISTRY; METALLURGY
A61P25/28
HUMAN NECESSITIES
A61K47/6849
HUMAN NECESSITIES
C07K2317/22
CHEMISTRY; METALLURGY
International classification
A61K39/00
HUMAN NECESSITIES
A61K51/10
HUMAN NECESSITIES
A61K39/395
HUMAN NECESSITIES
A61K47/68
HUMAN NECESSITIES
C07K14/705
CHEMISTRY; METALLURGY
C07K16/28
CHEMISTRY; METALLURGY
Abstract
The present invention relates to plexin D1 for use as a targetable protein in the treatment or diagnosis of disorders that involve expression of plexin D1. Diagnosis is suitably effected by detecting the presence of plexin D1 in the body or a bodily tissue or fluid, whereas treatment is effected by targeting plexin D1 for delivery of therapeutics to the site where treatment is needed. The invention further relates to the use of molecules that bind plexin D1, a nucleic acid encoding plexin D1 or a ligand of plexin D1 for the preparation of a therapeutical composition for the treatment or diagnosis of disorders that involve expression of plexin D1. The disorders comprise disorders in which plexin D1 is expressed on tumor cells, tumor blood vessels or activated macrophages.
Claims
1. A method for treating a subject having a cancer mediated by expression of plexin D1, the method comprising: administering to the subject an antibody or an antibody fragment that binds to plexin D1; wherein the cancer is selected from the group consisting of hemangioblastoma, prostate carcinoma, renal cell carcinoma, renal clear cell carcinoma, squamous cell carcinoma, melanoma, lung carcinoma, small-cell lung carcinoma, non-small-cell lung carcinoma, and soft tissue sarcoma; and wherein the antibody or antibody fragment that binds to plexin D1 is conjugated to an effector compound.
2. The method according to claim 1, wherein the effector compound is selected from the group consisting of a toxin, a thrombosis-inducing compound, a chemotherapeutic agent, a radioactive moiety, an apoptosis-inducing peptide, a peptide comprising the peptide KLAKLAKKLAKLAK (SEQ ID NO:7), a nanodevice, a liposome, a polymersome, a polymersome composed of block copolymers, a truncated tissue factor, doxorubicin, cisplatin, bleomycin sulfate, carmustine, chlorambucil, cyclophosphamide hydroxyurea, technetium 99m, iodine-123, iodine-131, rhenium-186 or -188, gallium-67, yttrium-90, and lutetium-177.
3. The method according to claim 1, wherein the effector compound is a toxin.
Description
BRIEF DESCRIPTION OF THE FIGURES
(1) The present invention will be further illustrated in the Examples that follow and that are in no way intended to limit the invention. In the Examples, reference is made to the following figures:
(2)
(3)
(4)
(5)
(6)
(7)
(8) Kinetic measurements were performed at 25? C. with a flow rate of 10 ml/minute in HBS-EP buffer (10 mM Hepes, pH 7.4, 150 mM NaCl, 3 mM EDTA, 0.005% surfactant P20). Six concentrations of Ni-affinity-purified sdabs (in the range of 1 mM to 50 ?M) were used to determine the dissociation constants (Kds) of the interaction with the PLXND1-peptide. After each experiment, regeneration of the sensor surface was performed with 10 mM NaOH.
(9) Specific binding, defined by binding to a PLXND1-surface minus binding to a control BSA-surface, was analyzed using the BIAevaluation 4.1 software and a 1:1 Langmuir binding model. Affinities of single-domain antibodies A12 and F8 were 2.1?10.sup.?8 M and 3.5?10.sup.?8 M.
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23) The tables show the following:
(24) Table 1: Analysis of different pathologies for plexin D1 expression.
(25) Table 2: Plexin D1 expression in melanocytic lesions increases from benign to malignant lesions.
DETAILED DESCRIPTION
EXAMPLES
Example 1
Specific Expression of Plexin D1 on Tumor-Associated Blood Vessels
(26) Plexin D1 is expressed on neurons but also endothelial cells in angiogenic vessels during embryogenesis.
(27) The present invention demonstrates that plexin D1 is expressed on tumor-associated blood vessels but not on normal blood vessels. This has been shown by in situ hybridization of mouse brains, containing angiogenic human melanoma lesions (
(28) Sections of 4 ?m were subjected to in situ hybridization with digoxigenin-labeled sense and antisense RNA fragments. RNA probes were generated by transcription using T3 and T7 RNA polymerase, respectively, from a PCR product, encompassing 600 bases in the 3-untranslated region, and which was flanked by T7 and T3 promoters (Van der Zwaag et al. (2002), supra).
(29) In situ hybridizations using antisense RNA probes and sense RNA probes as negative controls, were performed using standard protocols. Sections were deparaffinated by melting paraffin at 60? C. and subsequent treatments with xylene and ethanol. After rehydration in phosphate-buffered saline (PBS), a proteinase K digestion was performed (10 ?g/ml PBS in 20 mM Tris-HCl pH7.4/5 mM EDTA) for 15 minutes at 37? C. Sections were post-fixed in 4% buffered formaldehyde for 10 minutes, and acetylated in 0.1 M acetic acid anhydrid. Slides were washed subsequently in 2?SSC (sodium Citrate/sodium chloride) and MILLIQ?. After drying, slides were hybridized with digoxigenin-labeled RNA probes overnight at 65? C. in 50% formamide/2?SSC.
(30) High levels of plexin D1 RNA were observed in vessels of angiogenic Me157 tumors (
Example 2
Expression of Plexin D1 in Tumors
(31) To investigate plexin D1 RNA expression in human tumor samples, in situ hybridizations were performed with a human-specific plexin D1 RNA probe. High plexin D1 RNA expression levels were found in a number of human tumors, including glioblastoma multiforme, brain metastases of sarcoma, renal cell carcinoma, adenocarcinoma of the colon and of the breast, both in tumor vasculature and tumor cells. A summary of plexin D1-expressing tumor types is given in Table 1.
Example 3
Preparation of Antibodies Against Plexin D1
(32) To detect plexin D1 protein, antibodies were selected with affinity toward plexin D1. To this end, a M13 pHENIX phage library was constructed expressing Llama single-domain V-H antibodies, constructed by RT-PCR from Llama B-lymphocytes as described (S. van Koningsbruggen et al., J. Immunol. Methods 279:149-161 (2003)). The population of resulting cDNAs encoding V-H-single-domain antibody (sdab) fragments was ligated into phagemid vector pHENIXHis8VSV (results not shown), resulting in a fusion product with an 8*His-tag and a VSV-G-tag at the C-terminus. After electroporation in E. coli TG1 cells, ampicillin-resistant colonies were collected and pooled.
(33) The resulting library had a complexity of 8?10.sup.8 clones. Eighty percent of plasmids contained full-length sdab insert as determined by PCR analysis and immunological dot-blot-detection of the VSV-G-tag in sdabs (see below). The phage library was propagated as phagemids in E. coli TG1 bacteria. Phage particles were rescued by infection with trypsin-sensitive helper phage M13K07 (50). Phages were purified and concentrated from the culture supernatant by precipitation with 20% Polyethyleneglycol/2.5 M NaCl via standard methodology.
(34) To select for phages, displaying antibodies with affinity toward plexin D1, immunotubes (Nunc, Roskilde, Denmark) were coated overnight at 4? C. with 5 ?g/ml KLH-conjugated peptide (H.sub.2N-ALEIQRRFPSPTPTNC-CONH.sub.2 (SEQ ID NO:8), corresponding to amino acids 1-16 of the mature human PLXND1 protein (accession no. AY 116661) in 50 mM NaHCO.sub.3 (pH 9.6). Of note, the glutamic acid on position 3 in this peptide is a lysine in the mouse sequence; the remaining amino acids are homologous to mouse plxnd1.
(35) After rigorous washing with PBS/0.05% TWEEN? 20 (PBST), non-specific binding sites were blocked with 5% marvel in PBST (MPBST, 1 hour at room temperature (RT)) and 10.sup.13 phage particles from the library stock were incubated with the immobilized peptide for 90 minutes at RT. After rigorous washing with PBST and PBS, bound phages were eluted by trypsin treatment (10 mg/ml, 30 minutes RT).
(36) After trypsin inactivation with 1% newborn calf serum, the eluate was used to infect log-phase TG1 cells to amplify PLXND1-binding phages and calculate number of binders.
(37) To enrich for binding phages, four rounds of selection were performed. From the second round on, selections were performed against unconjugated peptides, immobilized on DNA-binding plates (Costar) to prevent selection of KLH-binders.
(38) Individual PLXND1-binding phages with PCR-confirmed full-length sdab inserts were tested for specificity toward plexin D1. Wells of DNA-binding plates or immunoplates (Nunc) were coated overnight at 4? C. with PLXND1-peptide or an irrelevant peptide (1 ?g/well in PBS/0.5 M NaCl pH 9.0), Bovine serum albumin (1 ?g/well in 50 mM NaHCO.sub.3 pH 9.6) or human Immunoglobulin G (1 ?g/well in 50 mM NaHCO.sub.3 pH 9.6). After blocking non-specific binding sites with MPBST, wells were incubated with phages in MPBST for 1 hour at RT and non-bound phages removed by rigorous washing. Bound phages were detected using HRP-conjugated anti-M13 (Amersham Pharmacia Biotech, Piscataway, N.J., USA) and tetramethylbenzidine (TMB; bioMerieux B.V., Netherlands). The reaction was terminated with 2 M H.sub.2SO.sub.4 and enzymatic activity quantified by measuring absorbance at 450 nm using an ELISA reader.
(39) Using this selection procedure, phages displaying V-H single-domain antibodies A12 and F8 on their surfaces were identified as specific binders.
(40) Expression of soluble single-domain antibodies was induced in log-phase E. coli TG1 cells by culturing at 30? C. in 2?TYA medium/1 mM IPTG. Sdabs were collected by osmotic lysis using ice-cold TES buffer (200 mM TrisHCl, 0.5 mM EDTA, 500 mM sucrose) containing a protease inhibitor cocktail (Roche, Basel, Switzerland). Sdab concentrations were estimated via dot-blot analysis using the mouse monoclonal anti-VSV-G P5D4, alkaline phosphatase-conjugated rabbit anti-mouse immunoglobulin (Dako, Denmark) and NBT/BCIP staining. Sdabs were tested in ELISA for PLXND1-peptide specificity. Single-domain antibodies A12 and F8 did not bind to irrelevant peptide, not to bovine serum albumin, and not to human immunoglobin G (
(41) Kinetic measurements were performed at 25? C. with a flow rate of 10 ml/minute in HBS-EP buffer (10 mM Hepes, pH 7.4, 150 mM NaCl, 3 mM EDTA, 0.005% surfactant P20).
(42) Six concentrations of Ni-affinity-purified sdabs (in the range of 1 mM to 50 ?M) were used to determine the dissociation constants (Kds) of the interaction with the PLXND1-peptide. After each experiment, regeneration of the sensor surface was performed with 10 mM NaOH. Specific binding, defined by binding to a PLXND1-surface minus binding to a control BSA-surface, was analyzed using the BIAevaluation 4.1 software and a 1:1 Langmuir binding model.
(43) Affinities of single-domain antibodies A12 and F8 were 2.1?10.sup.?8 M and 3.5?10.sup.?8 M, respectively (
Example 4
Immunohistochemical Stainings with Single-Domain Antibodies A12 and F8
(44) The single-domain antibodies are tagged at the carboxyterminal end with a VSV-His-tag, enabling immunohistochemical stainings using an anti-VSV antibody. The following protocol was followed for immunohistochemical stainings with single-domain antibodies A12 and F8. Following deparaffinization, endogenous peroxidase activity was blocked by incubation with 0.03% H.sub.2O.sub.2. Antigen retrieval was performed by treatment with pronase according to standard protocols. Subsequently, slides were pre-incubated with normal horse or goat serum (to block non-specific binding sites in sections of human and mouse tissues, respectively), followed by incubation with sdabs for 1 hour. Sdabs were detected by sequential 1-hour incubations with a mouse or rabbit anti-VSV-G antiserum (Sigma-Aldrich Chemie B.V., Zwijndrecht, The Netherlands), biotinylated anti-mouse or anti-rabbit antibody as appropriate (Vector, Burlingame, Calif.), and avidin-biotin peroxidase complex (Vector, Burlingame, Calif.). Finally, peroxidase was visualized by the 3-amino-9-ethylcarbazole (ScyTek, Utah, USA) peroxidase reaction with hematoxylin as counterstain. All steps were performed at RT.
(45) The specificity of the antibody A12 and F8 for plexin D1 in immunohistochemical stainings was first examined by staining mouse embryos in which expression patterns of plexin D1 on the RNA level were well characterized (Van der Zwaag et al. (2002), supra), and comparing profiles with immunostainings with anti-endothelial antibody anti-CD31 (DAKO, Glostrup, Denmark). In growth plate of trabecular bone of mice embryos at E16.5, immunostaining was observed on CD31-positive blood vessels. The staining profile correlated well to in situ hybridization for the plexin D1 transcript (
Example 5
Staining of Tumor Cells with F8
(46) Four ?m sections cerebral mouse xenografts of the human melanoma cell line Me157-VEGF-A (Kusters et al. (2003), supra) were stained with single-domain antibody F8, according to the protocol exemplified in Example 4. The antibody clearly recognized plexin D1 on tumor blood vessels (
Example 6
Timing of Plexin Expression on Malignant Cells
(47) To investigate whether expression of plexin D1 occurs on premalignant cells, a progression series of melanoma was stained, consisting of benign nevi, dysplastic nevi, radial growth phase melanoma, invasive melanoma and disseminated melanoma. Melanocytes in benign nevi and dysplastic nevi do not express the protein, whereas malignantly transformed cells, both in radial growth phase and vertical growth phase tumors are positive for the protein (
Example 7
Activation State of Plexin D1-Expressing Cells
(48) Plexin D1 expression is related to the activation state of the endothelial cells in tumor blood vessels. Treatment with ZD6474, an inhibitor of VEGFR2 and EGFR, was previously shown to block angiogenesis in a mouse brain tumor model, resulting in a phenotypic shift from an angiogenic to a non-angiogenic vessel co-opting phenotype (43). Treatment with ZD6474 resulted in a decrease of plexin D1 expression on tumor-associated blood vessels in a dose-dependent manner (
Example 8
Immunohistochemistry with A12 on Normal Tissues
(49) Expression of plexin D1 in normal brain, heart, skin, kidney, spleen, intestine, and endometrium was examined by immunohistochemistry using antibody A12. Vessels in proliferative myometrium-expressed plexin DL showing that plexin D1 is associated not only with pathological angiogenesis, but also with physiological angiogenesis (not shown).
(50) In some instances, co-immunostainings were performed with the CD68 macrophage marker. These stainings revealed that a subpopulation of macrophages expressed the protein (
Example 9
Staining of Macrophages in Inflammatory Diseases
(51) To further examine the involvement of plexin D1 in diseases with prominent macrophage involvement, immunohistochemical stainings were performed on atherosclerotic plaques, multiple sclerosis and rheumatoid arthritis. Macrophages express plexin D1.
Example 10
Access to Plexin D1 in Tumor Vessels Via Intravenous Injection
(52) The expression of plexin D1 protein on tumor blood vessels suggests that plexin D1 is accessible via intravenous injection. To test this, 2?10.sup.5 stably transfected Me157 cells expressing the VEGF-A.sub.165 isoform were microsurgically injected into the right internal carotid artery of BALB/C nude mice. After 18 days, when animals showed neurological symptoms (Kusters et al. (2003), supra), 10.sup.12 PLXND/-binding phages of clones A12, F8 or non-relevant phages were injected in the tail vein of nude mice, carrying established Me157-VEGF-A.sub.165 brain metastases (n=2 for A12, n=4 for F8, n=3 for control phage).
(53) In two other groups of mice, 30 ?g sdab F8 or a control sdab (n=2 for each group) was intravenously injected. After 5 minutes, mice were anesthetized using isoflurane, the chests were opened, and non-bound phages were washed from the system by cardiac perfusion with 15 ml of phosphate-buffered saline (PBS). Then, mice were sacrificed by cervical dislocation, and parts of brains, hearts, lungs, livers, spleens and kidneys were snap frozen in liquid nitrogen.
(54) Other parts were fixed in formalin to be paraffin-embedded. After short hematoxylin staining, tumors were dissected from 10 ?m brain sections using laser capture dissection microscopy (Leica laser dissection microscope). Equivalent areas were dissected from unaffected brain, contralateral to the tumor.
(55) Subsequently, phages were eluted from dissected tissue samples using trypsin treatment and used to infect TG1 cells. Numbers of colony-forming phages were counted and used as a measure of tumor homing. To qualitatively assess tumor homing by phages or sdabs, 4 ?m sections, serial to the sections used for laser dissection, were stained with anti-M13 p8 antibody (Abcam Limited, Cambridge, UK) to detect bound phages, or anti-VSV-G antibodies (Sigma-Aldrich) to detect single-domain antibodies.
(56) Intravenous injection of M13 phages displaying anti-PLXND1 single-domain antibody F8, but not phages carrying irrelevant single-domain antibodies, in mice carrying angiogenic melanoma lesions resulted in accumulation of phages in tumor vessels but not to detectable specific presence of phages in normal brain vessels, nor blood vessels in liver, spleen, kidney (
(57) Injection of the partially purified single-domain antibody accordingly led to preferential tumor localization (
Example 11
Accumulation of F8 in Tumor Blood Vessels
(58) Mice were injected transcranially with E98, a glioma xenograft line. E98 tumors are maintained as subcutaneous tumors. A Balbc/c nu/nu athymic mouse carrying a subcutaneous E98 tumor was killed and the tumor removed. The tumor was minced with a sterile scalpel and the homogenate was passed through a sterile 70 ?m mesh nylon filter. Twenty ?l of the resulting cell suspension, containing 150,000 cells, was injected transcranially in the brain of nude mice. After 3 weeks, M13 phages displaying single-domain antibody F8 were injected intravenously, and after five minutes the mouse was subjected to cardiac perfusion with 15 ml of phosphate-buffered saline.
(59) The mice were killed, brains removed and fixed in formalin. Four ?m sections were subjected to immunohistochemistry with anti-M13 antibody, and serial sections were stained immunohistochemically with antibodies against CD34 (endothelial marker) and glut-1 (a marker for pre-existent brain endothelial cells (B. Kusters et al., Cancer Res. 62:341-345 (2002)).
(60) Phages carrying anti-plexin D1 single-domain antibodies accumulated specifically in tumor-associated blood vessels, but not in normal vessels (
Example 12
Recombinant Plexin D1 Ectodomains Inhibit Angiogenesis
(61) Human melanoma Me157 cells were transfected with the VEGF-A.sub.165 coding sequence in vector pIREShyg. Stably transfected cells were selected by culturing in 200 ?g/ml hygromycin in Dulbecco's Modified Eagle medium (DMEM) supplemented with 10% fetal calf serum (FCS) and penicillin/streptomycin. Because expression of the hygromycin resistance gene is linked to that of the VEGF-A cDNA via the internal ribosomal entry site (IRES), all hygromycin-resistant cells will produce the VEGF-A protein also. Stably transfected Me157-VEGF cells were subsequently transfected with pIRESneo-PlexinD1 ED. The vector contains the cDNA encoding the extracellular domain from nucleotides 1-2745, linked via the IRES to expression of the neomycin resistance gene.
(62) Double transfectants were injected in the right carotid artery of nude mice, and tumors were allowed to develop. At the onset of neurological symptoms (approximately 18 days) mice were subjected to Gadolinium-DTPA-enhanced magnetic resonance imaging. Subsequently, mice were sacrificed, brains fixed in formalin and subjected to immunohistochemical stainings to examine the tumor vasculature.
(63) When compared to controls, consisting of tumors expressing VEGF-A only, Gd-DTPA enhancement in T1-weighted magnetic resonance imaging (MRI) was less (compare
Example 13
High-Affinity Antibodies Against Plexin D1
(64) A protein sequence, corresponding to amino acids 47-506 (the 459 most amino terminal amino acids of the mature protein), was expressed in E. coli M15 pREP4 cells, using the expression vecor pQE16 (Qiagen). The recombinant protein, which was produced in the bacterial cells as inclusion bodies, was dissolved in denaturing buffer, containing 4 M urea and 1 mM dithiothreitol (DTT) and afterwards gradually dialyzed against PBS. The protein was used to immunize BALB c/c mouse 25 according to standard procedures.
(65)
(66) When tested in immunohistochemical stainings on a brain metastasis of an alveolar soft tissue sarcoma, the mouse immune serum (Panel D), but not the pre-immune serum (Panel C), showed positivity toward blood vessels and tumor cells, a staining pattern that was similar to that of single-domain antibody A12. Thus, the B-lymphocytes of this mouse were considered suitable to generate hybridomas of spleen B-lymphocytes with myeloma cell line SP2/0.
(67) From these hybridomas, a number of antibody-producing cell lines were selected based on reactivity against protein 47-506 in ELISA, and were analyzed for their potential to detect plexin D1 in frozen sections of human tumors. Of these, 11F5H6 and 17E9C12, both antibodies of the IgM subtype, showed strong positivity in brain metastases of sarcoma and melanoma, as illustrated in
Example 14
Monoclonal Antibody 11F5H6 is Able to Recognize Tumor Blood Vessels
(68) To further evaluate whether monoclonal antibody 11F5H6 is able to recognize tumor blood vessels, angiogenic Me157-VEGF-A tumors were grown in brains of nude mice, essentially as described in Example 10. Antibody 11F5H6 (1 mg) was injected in a lateral tail vein and allowed to circulate for 15 minutes. After this period, the mice were anesthetized with 1.3% isoflurane and the chest was opened, upon which a cardiac perfusion was performed with 20 ml phosphate-buffered saline.
(69) After this procedure, mice were decapitated, and brains removed and snap-frozen or fixed in formalin. Frozen sections of 4 ?m were stained with anti-IgM antibody. In
Example 15
Plexin D1 Expression in Rheumatoid Arthritis
(70) Plexin D1 is expressed in macrophages in mouse models of rheumatoid arthritis (
(71) TABLE-US-00001 Sequences A12(SEQIDNO:1): ATGAAATACCTATTGCCTACGGCAGCCGCTGGATTGTTATTACTCGCG GCCCAGCCGGCCATGGCCCAGGTGCAGCTGCAGGAGTCTGGGGGAGGCTT GGTGCAGCCTGGGGGGTCTCTGAGACTCTCCTGTGCAGCCTCTGGAAGCA GTATCAGTATCAATAACTGGGGCTGGTACCGCCAGGCTCCAGGAAAACAG CGCGAGCGGGTCGCAGCTATATCTGGTGGTGGTAAAACAGTCTATGCGGA CTCCGTGAAGGGCCGATTCACCATCTCCAGAGACAACGCCAAGAACACGG TGTATCTGCAAATGAACAGCCTGAAACCTGAGGATACGGCCGTCTATTAC TGTAGAGCAGTCCGGAAAAGTACGGGTTGGCTTAGGGGGCTTGACGTCTG GGGCCAGGGGACCCAGGTCACCGTCTCCGCAGAACCCAAGACACCAAAAC CACAACCAGCGGCCGCACATCATCACCATCATCACCATCATTATACAGAC ATAGAGATGAACCGACTTGGAAAGGGGGCCGCATAG A12proteinsequence(SEQIDNO:2) MKYLLPTAAAGLLLLAAQPAMAQVQLQESGGGLVQPGGSLRLSCAASG SSISINNWGWYRQAPGKQRERVAAISGGGKTVYADSVKGRFTISRDNAKN TVYLQMNSLKPEDTAVYYCRAVRKSTGWLRGLDVWGQGTQVTVSAEPKTP KPQPAAAHHHHHHHHYTDIEMNRLGKGAA@ F8(SEQIDNO:3): ATGAAATACCTATTGCCTACGGCAGCCGCTGGATTGTTATTACTCGCG GCCCAGCCGGCCATGGCCCAGGTGCAGCTGCAGGAGTCTGGGGGAGGATT GGTGCAGGCTGGAGACTCTCTGAGACTCTCCTGTGCAGCCTCTGGACGCA CCTTCAGTACTTTGATTATGGCCTGGTTCCGCCAGGCTCCAGGGAAGGAG CGTGAATTTGTAGCGGCGATTAGCCGGGGTGGCGGTAGCACAAGCTATGC AGACTCCGTGAAGGGCCGATTCACCATCTCCAGAGACAATTCCAAGAACG CGGTGTATCTACAAATGAACAGCCTGAAACCTGATGACACGGCCGTCTAT TACTGTAATGCCCGGTACGGTAGCCGAATTTACTGGGGCCAGGGGACCCA GGTCACCGTCTCCTCAGAACCCAAGACACCAAAACCACAACCAGCGGCCG CACATCATCACCATCATCACCATCATTATACAGACATAGAGATGAACCGA CTTGGAAAGGGGGCCGCATAG F8proteinsequence(SEQIDNO:4) MKYLLPTAAAGLLLLAAQPAMAQVQLQESGGGLVQAGDSLRLSCAASG RTFSTLIMAWFRQAPGKEREFVAAISRGGGSTSYADSVKGRFTISRDNSK NAVYLQMNSLKPDDTAVYYCNARYGSRIYWGQGTQVTVSSEPKTPKPQPA AAHHHHHHHHYTDIEMNRLGKGAA@ Sequencesinglechainantibody,derivedfrom antibody11F5H6(SEQIDNO:5) MKYLLPTAAAGLLLLAAQPAMADYKDIVMTQTPLSLPVSLGDQASISCR SSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVFNRLSGVPDRFSGSGSGT DFTLKISRVEAEDLGVYYCFQGSHVPLTFGAGTKLELKRGGGGSGGGGSG GGGRAPGGGGSEVQLQQSGPELVKPGASMKISCKASGYSFTGYTMNWVKQ SHGKNLEWIGLINPYNGGTSYNQKFKGKATLTVDKSSSTAYMELLSLTSE DSAVYYCARAITTDGWFAYWGQGTLVTVSAAAAHHHHHHHHYTDIEMNRL GKGAA Sequencesinglechainantibody,derivedfrom antibody17E9C12(SEQIDNO:6) MKYLLPTAAAGLLLLAAQPAMADYKDIQMTQTPSSLAVSAGEKVTMSC KSSQSVLYSSNQKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGS GTDFTLTISSVQAEDLAVYYCHQYLSSWTFGGGTKLEIKRGGGGSGGGGS GGGGSGGGGSQVQLQQSGAELVKPGASVKLSCTASGFNIKDTYMHWVKQR PEQGLEWIGRIDPANGNTKYDPKFQGKATITADTSSNTAYLQLSSLTSED TAVYYCAMDYWGQGTSVTVSSAAAHHHHHHHHYTDIEMNRLGKGAA
(72) TABLE-US-00002 TABLE 1 PLXND1 expression in human tissues Tissue PLXND1 expression Malignant Adenocarcinoma of oesophagus (n = 1) Tumor vessels and tumor cells Adenocarcinoma of rectum (n = 5) Tumor vessels, tumor cells and macrophages Adenocarcinoma of prostate (n = 1) Tumor vessels and tumor cells Alveolar soft part sarcoma of femur (n = 1) Tumor vessels and tumor cells Astrocytoma (n = 1) Tumor vessels Carcinoid tumor of lung (n = 1) Tumor vessels, tumor cells and macrophages Ductal carcinoma in situ of mamma (n = 5) Tumor vessel, tumor cells, macrophages, fibroblasts Follicular lymphoma (n = 8) Tumor vessels Glioblastoma Multiforme (n = 3) Tumor vessels and tumor cells Brain metastasis of adenocarcinoma (n = 4) Tumor vessels and tumor cells (mamma, lung, rectum) Brain metastasis of alveolar soft part sarcoma (n = 1) Tumor vessels and tumor cells Brain metastasis of renal cell carcinoma (n = 1) Tumor vessels and tumor cells Liver metastasis of adenocarcinoma colon (n = 2) Tumor vessels, tumor cells and macrophages Lobular carcinoma in situ of mamma (n = 3) Tumor vessels and tumor cells weakly positive, macrophages and fibroblasts Lymph node metastasis ductal mamma carcinoma (n = 1) Tumor cells and some tumor vessels Ovary metastasis of adenocarcinoma colon (n = 1) Tumor cells and myofibroblasts Renal cell carcinoma (n = 1) Tumor vasculature and tumor cells Urothelial cell carcinoma of prostate (n = 2) Tumor vessel, tumor cells and macrophages Non-malignant Bladder (n = 1) Macrophages Blood vessel, atherosclerosis (n = 6) Macrophages Bone marrow (n = 2) Brain cortex (n = 1) Some neurons perinuclear Brain. Alzheimer + CAA (n = 1) Endometrium Proliferation phase (n = 5) Macrophages Secretion phase (n = 4) Macrophages Secretion/menstruation phase (n = 1) Macrophages Endometriosis interna (n = 1) Macrophages Heart (n = 1) Some muscle cells perinuclear Large intestine (n = 1) Some luminal staining of epithelium, macrophages, fibroblasts Liver (n = 1) Liver cells perinuclear granular, macrophages Lung (n = 2) Macrophages Mamma (n = 2) Some epithelial cells perinuclear Mamma, ductal hyperplasia (n = 1) Focal epithelial cells perinuclear, macrophages Oesophagus (n = 1) Macrophages Small intestine (n = 1) Some luminal staining of epithelium, macrophages, fibroblasts Spleen (n = 1) Macrophages
(73) TABLE-US-00003 TABLE 2 PLXND1 expression in melanoma progression series Absent Moderate Abundant Naevocellular naevi (n = 18) 18 Atypical naevi (n = 14) 14 Melanomas in situ (n = 5) 5 Primary melanomas (n = 26) 4 2 20 Melanoma metastases Lymph node (n = 9) 1 2 6 Skin (n = 5) 1 1 3 Brain (n = 5) 5 Lung (n = 1) 1