Method for breeding Brassica rapa plant having self-compatibility

09988639 ยท 2018-06-05

Assignee

Inventors

Cpc classification

International classification

Abstract

The problem of providing a technology that converts a Brassica rapa plant having self-incompatibility to having self-compatibility is addressed. The problem is solved by causing a pollen factor (SP11) to be inactive at a self-incompatibility gene locus for a Brassica rapa plant, while maintaining the inverted repeat sequence (SMI) on a class I dominant S haplotype.

Claims

1. A method for breeding a self-compatible Brassica rapa plant strain, comprising: crossbreeding a Brassica rapa strain having an S.sub.0 haplotype belonging to class I in a self-incompatibility gene locus of a self-incompatible Brassica rapa plant strain, in which a pollen factor SP11 is inactivated while an SP11 methylation inducer (SMI) inverted repeat sequence is retained, with a Brassica rapa strain having an S.sub.II haplotype belonging to class II, to obtain a self-compatible Brassica rapa plant strain, and selfing the self-compatible Brassica rapa plant strain, or conducting inbreeding of the self-compatible Brassica rapa plant strain by crossing it with a Brassica rapa plant strain having the same genotype as the self-compatible Brassica rapa plant strain with respect to an S haplotype, to select a Brassica rapa plant strain that is a homozygote with respect to the S.sub.0 haplotype.

2. The method according to claim 1, wherein the selfing or inbreeding step is repeated about five to seven times.

3. A method for breeding a parent strain for an F1 hybrid breeding of a Brassica rapa plant strain, comprising: (1b) crossbreeding a Brassica rapa plant strain having an S.sub.0 haplotype belonging to class I in a self-incompatibility gene locus of a Brassica rapa plant strain, in which a pollen factor SP11 is inactivated while an SP11 methylation inducer (SMI) inverted repeat sequence is retained, with a Brassica rapa plant strain having an S.sub.II haplotype belonging to class II, to obtain a self-compatible Brassica rapa plant strain; (2b) selfing the self-compatible Brassica rapa plant strain obtained in the step (1b), or conducting inbreeding by crossing it with a Brassica rapa plant strain having the same genotype as the self-compatible Brassica rapa plant strain with respect to an S haplotype, to obtain a set of Brassica rapa plant strains; and (3b) selecting a Brassica rapa plant strain that is a homozygote with respect to the S.sub.II haplotype belonging to class II from the set of Brassica rapa plant strains obtained in the step (2b).

4. The method according to claim 3, wherein the step (2b) is repeated about five to seven times.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) FIG. 1 is a diagram showing a dominance control mechanism between SP11 alleles.

(2) FIG. 2 is a diagram showing a self-compatibility expression mechanism by S.sub.0 haplotype.

(3) FIG. 3 is a representative picture showing an example of making a Brassica rapa having self seed fertility.

(4) FIG. 4 is a graph showing the number of seeds sampled per one capsule in each Brassica rapa strain made in Examples, and representative pictures of individual strains.

EMBODIMENTS OF THE INVENTION

(5) (1) Method for Making Self Seed Fertile Brassicaceae Plant

(6) The method for making a self seed fertile Brassicaceae plant of the present invention is characterized by inactivating pollen factor SP11 while retaining an inverted repeat sequence (SMI) of dominant S haplotype belonging to class I in a self-incompatibility gene locus (S gene locus) of Brassicaceae plant, and as a result, it is possible to covert a self-incompatible Brassicaceae plant to one having self-compatibility, and to impart self seed fertility to the same.

(7) In the present invention, a Brassicaceae plant refers to a plant classified into a dicotyledon, and having four petals arranged in the shape of a cross. In the present invention, as a Brassicaceae plant, for example, Brassica (rape) plants, Raphanus (Japanese radish) plants, Wasabia (wasabi) plants, Nasturtium (watercress) plants and so on can be recited, and Brassica plants are preferably exemplified.

(8) Concrete examples of Brassica plants include Brassica rapa such as turnip rape (native rapeseed), Chinese cabbage, turnip, Japanese mustard spinach, potherb mustard, bok choy, coleseed greens, and pak choi; Brassica oleracea such as cabbage, broccoli, cauliflower, and brussels sprouts; and Brassica juncea such as brown mustard, and leaf mustard. Examples of Raphanus plants include Japanese radish, and radioxenon, examples of Wasabia plants include wasabi, and examples of Nasturtium plants include watercress.

(9) Among these plants, Brassica rapa is more preferred because it has immense genetic diversity, and oilseed rape (native rapeseed) is further preferred.

(10) In the present invention, a Brassicaceae plant includes the whole plant, pollen, seed; organs such as leaf, stem, root, floral organ, growing point, seed, and embryo; tissue such as epidermis, phloem, parenchyma, xylem, and vascular bundle; and plant culture cell or tissue such as protoplast and callus.

(11) An inverted repeat sequence (SMI) refers to a sequence made up of 24 bases represented by the following SEQ ID NO: 1 located near the gene encoding pollen factor SP11 (for example, within about 100 kb upstream or downstream from the SP11 gene).

(12) TABLE-US-00001 (SEQIDNO:1) 5-ATGTTTACGTGTAAAATAGTTACA-3

(13) For example, regarding S.sub.9 haplotype and S.sub.12 haplotype, the position of the inverted repeat sequence on the gene has been identified, and regarding S.sub.9 haplotype, it exists at 3.6 kb downstream from the untranslated region (utr) of SLG gene, and regarding S.sub.12 haplotype, it exists at 3 kb downstream from the untranslated region (utr) of SLG gene. While the positions have not been identified for other S haplotypes, they can be determined based on existence of 24 bases represented by the above SEQ ID NO: 1.

(14) It is believed that the relation of dominance between S haplotypes in Brassicaceae plants arises according to the following mechanism. That is, based on the inverted repeat sequence existing on class I S.sub.I haplotype, low molecular RNA made up of 24 nucleotides is produced, and a SP11 gene expression regulation region of S.sub.II haplotype belonging to class II having the homology is methylated, and thus expression of class II SP11 is suppressed to several tens of thousandths part. On the other hand, low molecular RNA homologous to a SP11 gene expression regulation region of class I S.sub.I haplotype is also synthesized from the inverted repeat sequence of class II S.sub.II haplotype, however, the SP11 gene expression regulation region is not methylated because homology with the target region is reduced due to single base substitution. With this mechanism, dominance arises in the reaction of self-other discrimination (see FIG. 1).

(15) In the present description, S.sub.I haplotype belonging to class I is also indicated as dominant S haplotype. On the other hand, S.sub.II haplotype belonging to class II is also indicated as recessive S haplotype.

(16) Pollen factor SP11 is expressed in an anther tapetum tissue, and is recognized by a pistil factor SRK which is a receptor, and self-incompatibility is established if they have the same genotype. The position on the S gene locus and the transcription direction of the gene encoding pollen factor SP11 differs between different S haplotypes, and many of these are not clearly identified, and, regarding S.sub.8, S.sub.9, S.sub.12 haplotypes, for example, the position of SP11 gene on the S gene locus has been identified, and is located between pistil factors SRK and SLG in any cases (see Takayama et al., PNAS, vol. 97, no. 4, 2000, 1920-1925). Nucleotide sequences of individual S haplotypes of SP11 gene have already identified, and are registered in a known database. For example, they are registered in NCBI (National Center for Biotechnology Information, US) at accession number: AB035504.1 for S.sub.8 haplotype, at accession number: AB022078.1 for S.sub.9 haplotype, at accession number: AB035503.1 for S.sub.12 haplotype, at accession number for S.sub.52 haplotype: AB035505.1, and at accession number: AB067446.1 for S.sub.60 haplotype. Therefore, based on these registered sequences, the position on the S gene locus of SP11 gene and so on can be identified.

(17) While the form of inactivation of pollen factor SP11 is not particularly limited as far as it is the form in which SP11 is not recognized by SRK, it includes lack of expression of SP11 gene or lack of generation of normal SP11 protein while excluding reduction in expression of SP11 gene or protein in the present invention. Inactivation of pollen factor SP11 can be realized by modifying a gene encoding SP11 according to conventionally known genetic engineering techniques. Gene modification may be conducted on a gene itself, however, it may be conducted in any stages including transcription, post-transcriptional regulation, translation, and post-translational modification. An exemplary form of inactivation of SP11 includes the case where SP11 is not recognized by SRK as a result of introduction of mutation into the amino acid sequence constituting SP11 when a gene encoding SP11 is knocked out (or knocked in).

(18) The means for knocking out (or knocking in) SP11 gene is not particularly limited as far as it does not allow transcription of mRNA from SP11 gene, and a conventionally known method can be employed, and for example, the following methods can be recited. That is, non-limiting exemplary methods include: after isolating SP11 gene (genomic DNA) from a plant for which gene modification is to be made (that is, self-incompatible Brassicaceae plant having at least a inverted repeat sequence (SMI) and SP11 gene) according to ordinary methods comprising, (a) inserting a DNA fragment containing a selective marker gene (for example, drug resistance gene or reporter gene) into a promotor region or an exon part of SP11 gene to destroy the function of the promotor or the exon; (b) cutting SP11 gene by using zinc finger nuclease (ZFNs) or Transcription Activator-Like Effector Nuclease (TALENs), etc. to introduce mutation into the gene; (c) inserting a stop codon into a region encoding SP11 protein to disable translation of complete protein; and (d) incorporating a DNA fragment that is constructed by inserting a transcription termination signal (for example, polyadenylation signal) into a transcription region to disable synthesis of complete mRNA, into a gene locus of a wild-type strain.

(19) Also, it is possible to inactivate SP11 on the gene level by introducing function defective mutation such as point mutation, deficiency or frame shift mutation into SP11 gene by a mutagen treatment. While known means may be employed for the mutagen treatment, for example, irradiation including exposure to radiation (X-ray, -ray and so on), or heavy ion beam irradiation; and treatments with chemicals such as methyl methanesulfonate (EMS), ethylnitrosourea, nitrosoguanidine, benzopyrene and so on can be exemplified. In the present invention, it is preferred to employ a gene modification means for making deletion of SP11 gene.

(20) As a method for introducing mutation into an amino acid sequence constituting SP11 to allow SP11 not to be recognized by SKR, a method of introducing mutation into amino acid residues that are highly conserved among S haplotypes is recited. In the amino acid residues constituting SP11 protein, eight cysteine residues, and two amino acid residues (concretely, a glycine residue at the second residue before the second cysteine residue from N-terminal, and an aromatic amino acid residue (phenylalanine residue or tyrosine residue) at the fourth residue after the third cysteine residue from N-terminal) are highly conserved (for example, see Mishima, M., et al., J. Biol. Chem. 278, 36389-36396, 2003 and so on). Therefore, it is supposed that by introducing mutation into a nucleotide sequence encoding that part, synthesis of complete SP11 protein is inhibited, and SP11 can be inactivated. The method for introducing mutation is not particularly limited as far as SP11 is inactivated, and conventionally known methods may be employed, and for example, site-directed mutagenesis can be recited.

(21) For each S haplotype of SP11 protein, the amino acid sequence has been already identified, and registered in a known database. For example, amino acid sequences of S.sub.8, S.sub.9, S.sub.12, S.sub.52, S.sub.60 haplotypes are concretely shown below.

(22) TABLE-US-00002 S8-SP11(GenBank;BAA92246.1:SEQIDNO:2); MKSAVYALLCFIFIVSGHIQELEANLMKRCTRGFRKLGKCTTLEEEKCKT LYPRGQCTCSDSKMNTHSCDCKSC S9-SP11(GenBank;BAA85458.1:SEQIDNO:3); MKSAIYALLCFIFIVSSHVQEVEANLRKTCVHRLNSGGSCGKSGQHDCEA FYTNKTNQKAFYCNCTSPFRTRYCDCAIKCKVR S12-SP11(GenBank;BAA92245.1:SEQIDNO:4); MKSAIYALLCFIFIILSRSQELTEVGADKQQCKKNFPGHCETSERCENTY KRLNKKVFDCHCQPFGRRRLCTCKC S52-SP11(GenBank;BAA92247.1:SEQIDNO:5); MKSVLYALLCFIFIVSSHAQDVEANLMNRCTRELPFPGKCGSSEDGGCIK LYSSEKKLHPSRCECEPRYKARFCRCKIC S60-SP11(GenBank;BAB86353.1:SEQIDNO:6); MRYATSIYTFLTNIHYLCFIFLILTYVQALDVGAWKCPEGIVYPSPISGR CINSRSTECKKHYEVEGQNVTNCRCDTYSMQNPARITCYCCKVKS

(23) The C indicated in the amino acid sequence denotes eight cysteine residues conserved among S haplotypes, and the G and Y respectively denote a glycine residue and a tyrosine residue conserved among S haplotypes.

(24) By transformation with an expression vector containing a DNA fragment encoding SP11 having mutation in the highly-conserved amino acid sequence, it is possible to obtain a Brassicaceae plant in which pollen factor SP11 is inactivated. In the expression vector, the DNA fragment encoding SP11 into which mutation is introduced may be linked with a promotor so as to allow expression.

(25) For modifying SP11 gene by a genetic engineering technique, it is necessary to express it in an anther tapetum tissue. Therefore, a promotor capable of functioning in a cell of an objective plant is not particularly limited as far as it is a gene promotor expressed in an anther tapetum tissue of a plant body, and for example, SP11 promotor can be recited. The expression vector may have a known terminator region, a cis-regulatory element such as an enhancer, a drug resistance gene and so on as necessary. For facilitating mass preparation, the expression vector may contain a replication origin that enables self-replication in Escherichia coli, a selective marker (such as ampicillin resistance gene, or tetracycline resistance gene) in Escherichia coli and so on.

(26) As a method for transforming a plant, conventionally known methods can be employed, and for example, by treating a plant to be transformed, with a cell wall degrading enzyme such as cellulase or hemicellulase to isolate a protoplast from the cell of the objective plant, and introducing an intended DNA fragment into the protoplast by PEG method, liposome method, electroporation or the like to cause redifferentiation into a plant body from the protoplast, it is possible to obtain a transformed plant body. Also on a cell of an objective plant having a cell wall, a direct introducing method such as micro injection method or particle gun method may be used. Further, transformation can be achieved by utilizing infection with Agrobacterium. In introducing an intended DNA fragment, the part of the plant body from which the cell is derived is not particularly limited, and an appropriate organ, tissue or cell can be selected depending on the employed method for introduction, and for example, an embryo, hypocotyl section, isolated growing point and so on can be recited. As a transformation method utilizing infection with Agrobacterium, for example, the method described in Takasaki et al., (1997) Breeding Science 47:127-13 can be employed.

(27) The self-compatible Brassicaceae plant obtained by the making method of the present invention can be grown in conventionally known growing conditions, and the soil, fertilizer and so on to be used can be appropriately selected depending on the kind of the plant and the growth state.

(28) As a condition for growing Brassicaceae plants, for example, a temperature ranging from 4 to 30 C., preferably ranging from 20 to 23 C.; a light quantity ranging from 400 to 100,000 Lux, preferably ranging from 1,000 to 50,000 Lux; an irradiation time ranging from 8 to 24 hours, preferably ranging from 12 to 14 hours; and a growing period ranging from 20 to 150 days, preferably ranging from 30 to 90 days can be recited.

(29) Prior to sowing a seed of a Brassicaceae plant, the seed may be subjected to pretreatments such as disinfection and preliminary imbibition. The disinfecting treatment may be conducted according to a conventionally known method, and for example, it can be conducted by dipping in 5% sodium hypochlorite solution at 18 to 25 C. for 10 to 30 minutes. Also the preliminary imbibition treatment may be conducted according to a known method, and for example, a method of dipping in water at 18 to 25 C. for 1 to 24 hours can be recited. Preliminary imbibition may be conducted by spraying water to seeds, and water at 18 to 25 C. may be sprayed in an amount of 10 to 100 mL per 100 seeds, and left still for 1 to 24 hours. Also a low temperature treatment may be conducted as necessary. The condition of the low temperature treatment can be appropriately set from conventionally known conditions, and for example, the treatment can be carried out by growing seeds in an environment of 1 to 5 C. for 1 to 2 months.

(30) As a method for confirming that pollen factor SP11 is inactivated while the inverted repeat sequence is retained in the self-compatible Brassicaceae plant made in the manner as described above, a method of preparing a DNA sample from the obtained plant individual according to an ordinary method, amplifying DNA fragments respectively encoding the inverted repeat sequence and SP11 by using primers and the DNA sample as a template, and judging from an amplified product according to the molecular weight and the nucleotide sequence can be recited.

(31) Preparation of a DNA sample from a plant individual can be conducted by using a known method appropriately, and examples of such a method include a method based on phenol extraction and ethanol precipitation, and a method using glass beads. More conveniently, a commercially available DNA extraction reagent or DNA extraction kit may be used for preparation. Although the site of the plant body used in preparing a DNA sample is not particularly limited, for example, leaf is recited.

(32) Also the method for obtaining DNA fragments encoding the inverted repeat sequence and SP11 from the prepared DNA sample can be a conventionally known method, and the DNA fragments encoding the inverted repeat sequence and SP11 can be specifically amplified by using primers.

(33) A primer can be any oligonucleotide that has a characteristic sequence capable of specifically hybridizing with at least part of a target DNA fragment and amplifying the DNA fragment. Such a primer can be appropriately designed and synthesized based on sequence information of a target gene acquired by using a program such as BLAST or FASTA and a database. Nucleotide sequence length of a primer is generally 300 to 1500 bp, preferably 300 to 1000 bp, and more preferably 300 to 500 bp.

(34) Examples of primer sequences to be used for confirming that SP11 gene is inactivated while the inverted transcription sequence (SMI) is retained in S.sub.I haplotype belonging to class I are shown below. Regarding SP11 gene, concrete nucleotide sequences are shown below while taking primers for SP11 gene of S.sub.8 haplotype as examples.

(35) Primer set for confirming existence of SP11 gene of S.sub.8 haplotype

(36) TABLE-US-00003 (SEQIDNO:7) S8sp11-genome-Forward; 5-CTGCAAGTAAAAGAGAGAATCTTTTATCAC-3 (SEQIDNO:8) S8sp11-genome-Reverse; 5-GCACCGCTTCATCAGATTTGC-3

(37) Primer set for confirming existence of SMI sequence of class I (S.sub.9, S.sub.8, S.sub.12, S.sub.52)

(38) (see Tarutani, et al., (2010) Nature, vol. 466 (19), 983-986 Supplementary Table 5)

(39) TABLE-US-00004 SL-Forward1; (SEQIDNO:9) 5-ACACCTCGGACTARAWTTTATGTATTYTTTC-3 SL-Reverse1; (SEQIDNO:10) 5-TCATTAATATTTTATATGCACTAATCGTTTTG-3

(40) Concretely, SP11 gene of S.sub.II haplotype or the inverted repeat sequence belonging to class II can be confirmed respectively by the following primer sets.

(41) Primer set for confirming existence of SP11 gene of class II (S.sub.44, S.sub.60, S.sub.40, S.sub.29)

(42) TABLE-US-00005 (SEQIDNO:11) classII-SP11-Forward; 5-CGTGTGAAATAGGCAATTAAGTGCAAG-3 classII-SP11-Reverse; (SEQIDNO:12) 5-CTTTGCAACAGTAGCAAGTAATCCTC-3

(43) Primer set for confirming existence of SMI sequence (S.sub.44, S.sub.60, S.sub.40, S.sub.29) of class II

(44) (see Tarutani, et al., (2010) Nature, vol. 466(19), 983-986 Supplementary Table 5)

(45) TABLE-US-00006 SL-Forward2; (SEQIDNO:13) 5-TAACCATAGAAAAATATTCGTGTTC-3 SL-Reverse1; (SEQIDNO:10) 5-TCATTAATATTTTATATGCACTAATCGTTTTG-3

(46) Based on the molecular weight or the nucleotide sequence of the amplified product obtained by amplification reaction of a DNA fragment using these primers, it is possible to confirm that the inverted repeat sequence is retained and SP11 is inactivated. For amplification of a DNA fragment, a conventionally known method can be employed, and non-limiting examples include polymerase chain reaction (PCR), and more concrete examples include RT-PCR, nested PCR, real-time PCR, and competitive PCR.

(47) Inactivation of SP11 for S.sub.I haplotype belonging to class I can be confirmed, for example, by cutting the amplified DNA fragment with a restriction enzyme, and comparing the size of the cut DNA fragment with the molecular weight of the DNA fragment obtained from the plant body expressing normal SP11 by electrophoresis or the like. If the molecular weights of these fragments do not coincide with each other, it can be determined that SP11 is inactivated. Further, when SP11 gene is deleted, absence of the sequence can be confirmed by sequencing. By sequencing the DNA fragment, retention of the inverted repeat sequence can be confirmed.

(48) Regarding SP11 gene of S haplotype belonging to class I, since the gene length (mainly length of intron) differs among S haplotypes (S.sub.9, S.sub.8, S.sub.11, S.sub.52 etc.), and the highly conserved part in the amino acid sequence is limited to the signal sequence of the first exon, it is difficult to design a common primer to confirm existence of almost every SP11 gene belonging to class I. Therefore, inactivation of SP11 gene of class I is desirably confirmed by designing primers based on the nucleotide sequence of SP11 gene of each S haplotype belonging to class I, and sequencing a DNA fragment amplified by these primers.

(49) On the other hand, regarding SP gene of S haplotype and the inverted repeat sequence (SMI) belonging to class II, SP11 gene or the inverted repeat sequence can be amplified by a PCR method using common primer sets represented by the above SEQ ID NOs: 11 to 14, and existence can be confirmed based on the molecular weight and the nucleotide sequence.

(50) The self-compatible Brassicaceae plant (S.sub.0 strain) obtained by the making method of the present invention can be also acquired from a naturally occurring self-compatible variant of Brassicaceae plant. Concrete examples of such a variant include the one registered as Brassica rapa C634 in Brassica seed bank of TOHOKU UNIVERSITY. The S.sub.0 strain originates from S54 haplotype of Brassica rapa C634.

(51) Whether it is a heterozygote or a homozygote with respect to S.sub.0 haplotype can be determined by using the primer sets represented by the following SEQ ID NOs: 15 to 18. That is, by using the primer sets represented by SEQ ID NOs: 14 and 15, almost every SLG (S-locus glycoprotein) belonging to class I including S.sub.0 haplotype is amplified (SLG of class II is not amplified).

(52) TABLE-US-00007 (SEQIDNO:14) SLGI-Forward:5-AGAACACTTGTATCTCCCGGT-3 (SEQIDNO:15) SLGI-Reverse:5-CATAGTCGGATCCGTGTTTT-3

(53) By using the primer sets represented by SEQ ID NOs: 16 and 17, SLG of class II is amplified (SLG of class I is not amplified).

(54) TABLE-US-00008 (SEQIDNO:16) SLGII-Forward:5-ATGAAAGGGGTACAGAACAT-3 (SEQIDNO:17) SLGII-Reverse:5-CTCAAGTCCCACTGCTGCGG-3

(55) By means of the PCR method using these primer sets, it is possible to discriminate whether the obtained plant body is a homozygote or a heterozygote with respect to S.sub.0 haplotype or S.sub.II haplotype. Further, the nucleotide sequence may be checked by sequencing as necessary.

(56) The Brassicaceae plant obtained by the making method of the present invention is a self seed fertile plant which has been converted to one having self-compatibility. A strain (S.sub.0S.sub.II strain) obtained by crossbreeding a strain having S.sub.0 haplotype with a strain having S.sub.II haplotype belonging to class II retains self-compatibility, and grows well due to heterosis, and has high seed productivity. For example, a rapeseed having self-compatibility obtained by crossbreeding with a strain having S.sub.0 haplotype by the method of the present invention usually has a larger size and number of capsule, a larger thickness and length of stem, a larger number of flowers, and a larger number of seeds per one capsule in comparison with the parent strain.

(57) (2) Method for Breeding Brassicaceae Plant Having Self-Compatibility

(58) The present invention provides a method for breeding a self-compatible Brassicaceae plant. The breeding method includes the following steps. (1a) a step of crossbreeding a strain having S.sub.0 haplotype belonging to class I in which pollen factor SP11 is inactivated while the inverted repeat sequence is retained in a self-incompatibility gene locus of Brassicaceae plant, with a strain having S haplotype belonging to class II to obtain a self-compatible strain.

(59) As the parent strains in step (1a), it is only required that a combination of a strain having S.sub.0 haplotype and a strain having S.sub.II haplotype belonging to class II regarding S gene is selected, and each parent strain may be either a homozygote or a heterozygote with respect to S gene, and may be either self-compatible or self-incompatible.

(60) The crossbreeding conducted in step (1a) means that regarding two strains of Brassicaceae plants having different origins, pollen of one strain pollinates to a stigma of the other strain, and then fertilization and seed formation advance. One exemplary method for crossbreeding includes covering the whole plants of two strains having different origins with a net bag, and releasing insects such as bees into the bag to allow pollination in the course that the insects collect nectar. Also artificial pollination may be conducted manually with brushes or tweezers. Further, a method of growing two masses of plural strains having different origins in a plastic greenhouse or the like, and releasing insects in the house to cause pollination (mass crossbreeding) may be employed.

(61) In the crossbreeding conducted in step (1a), the strain having S.sub.0 haplotype or the strain having S.sub.II haplotype used as a parent strain is not particularly limited regarding other genetic backgrounds than S gene, and may be appropriately arranged so that a strain having a desired phenotype and self-compatibility can be obtained by the crossbreeding. For example, by selecting a strain having a gene capable of expressing phenotypes such as increase in production amount of plant reserve substances such as oil, improvement in seed productivity, resistance to injurious insects, resistance to fungi, resistance to virus, resistance to bacteria, resistance to environmental stress (for example, resistance to cold), and improvement in nitrogen fixing ability, as a parent strain, it is possible to convert a Brassicaceae plant with such beneficial phenotypes to one having self-compatibility to impart it with self seed fertility.

(62) As a more concrete example, it is possible to obtain a self-compatible S.sub.0S.sub.II strain having resistance to cold and resistance to injurious insects by crossbreeding a strain having S.sub.0 haplotype (S.sub.0 strain) having resistance to cold, with a strain having S.sub.II haplotype (S.sub.II strain) having resistance to injurious insects. Alternatively, after obtaining a self-compatible S.sub.0S.sub.II strain having resistance to cold by crossbreeding a S.sub.0 strain and a S.sub.II strain having resistance to cold, the S.sub.0S.sub.II strain as a parent strain may be crossbred with a S.sub.II strain having resistance to injurious insects to obtain a self-compatible S.sub.0S.sub.II strain having resistance to cold and resistance to injurious insects.

(63) The method for breeding a self-compatible Brassicaceae plant of the present invention may further include, after the step (1a), a step (2a) of selecting a strain that is a homozygote with respect to S.sub.0 haplotype by selfing of the self-compatible strain of Brassicaceae plant obtained in the step (1a), or by conducting inbreeding using a strain having the same genotype with respect to S haplotype. Since the self-compatible Brassicaceae plant obtained in the step (1a) is a heterozygote with respect to S.sub.0 haplotype, by selfing or inbreeding the strain, it is possible to obtain a strain that is a homozygote with respect to S.sub.0 haplotype. When the present method is applied to Brassica rapa, the obtainable plant (Brassica rapa) can be preferably used for production of oil (rapeseed oil) because it has self seed fertility and seeds thereof can be harvested.

(64) Here, selfing means that pollen of stamen pollinates to a stigma of pistil in the same flower, or pollen of a flower of a certain strain pollinates to a stigma of other flower of the same strain, and then fertilization and seed formation advance. One exemplary method for selfing includes covering one or plural inflorescences (mass of flowers) or the entirety of one strain with a net bag, and releasing insects such as bees in the bag to cause pollination. Also as described above, artificial pollination may be employed. Also a method of growing a plurality of strains of Brassicaceae plant originating from the same parent strain in a plastic greenhouse or the like, and releasing insects in the house to cause pollination between the plural strains (mass seed production) may be employed.

(65) The term inbreeding used herein means conducting crossbreeding between brother strains made from the same parent strain. The crossbreeding can be conducted according to the method employed in the aforementioned selfing, and for example, a method of putting brother strains made from the same parent strain into a plastic greenhouse or the like, and conducting artificial pollination or pollination via insects can be recited.

(66) In the method for breeding a self-compatible Brassicaceae plant of the present invention, selfing of the self-compatible strain of Brassicaceae plant conducted in the step (2a) may be repeated five to seven times, preferably six to seven times. In this technical field, it is believed that 99.9% of genes on genome become homozygotes by repeating selfing seven times. When selfing or inbreeding is repeated, a strain that is a homozygote with respect to S.sub.0 haplotype can be selected from the strains obtained in the last selfing or inbreeding.

(67) Therefore, by repeating the operation of selfing or inbreeding a strain of heterozygote (S.sub.0S.sub.II) obtained in the step (1a), selecting a self-compatible strain from the resultant strains, and further selfing or inbreeding the selected strain to select a self-compatible strain, almost every strain becomes a homozygote (S.sub.0S.sub.0) with respect to S.sub.0 haplotype. Therefore, it is not necessarily required to confirm the genotype in discrimination of a homozygote, however, when discrimination is made on the basis of the genotype, it can be determined that the obtained self-compatible strain is a homozygote with respect to S.sub.0 haplotype by confirming that the self-compatible strain (namely, having a genotype of either S.sub.0S.sub.0 or S.sub.0S.sub.II) does not have S haplotype of class II by a PCR method using the primer sets for confirming existence of class II-SP11 (S.sub.44, S.sub.60, S.sub.40, S.sub.29) described in the foregoing (1) Method for making self seed fertile Brassicaceae plant.

(68) (3) Method for Breeding Parent Strain for F1 Hybrid Breeding

(69) The present invention also provides a method for breeding a parent strain for F1 hybrid breeding of Brassicaceae plant.

(70) The breeding method includes the following steps.

(71) (1b) a step of crossbreeding a strain having S.sub.0 haplotype belonging to class I in which pollen factor SP11 is inactivated while the inverted repeat sequence is retained in a self-incompatibility gene locus of Brassicaceae plant, with a strain having S.sub.II haplotype belonging to class II to obtain a self-compatible strain;

(72) (2b) a step of selfing the self-compatible strain of Brassicaceae plant obtained in the step (1b), or conducting inbreeding using a strain having the same genotype with respect to S haplotype; and

(73) (3b) a step of selecting a strain that is a homozygote with respect to S.sub.II haplotype belonging to class II from the strains obtained in the step (2b).

(74) The step (1b) is equivalent to the step (1a) in the (2) Method for breeding Brassicaceae plant having self-compatibility. In the step (2b), selfing of the self-compatible Brassicaceae plant obtained in the step (1b) is conducted, or inbreeding using a strain having the same genotype with respect to S haplotype is conducted, and selfing or inbreeding is as described in the foregoing (2) Method for breeding Brassicaceae plant having self-compatibility.

(75) In the step (2b), from the strains obtained by conducting selfing or inbreeding, a self-compatible strain having S.sub.0 haplotype and S.sub.II haplotype heterozygously is selected. In the step (2b), selfing or inbreeding may be conducted repeatedly, and thus an inbred line that is genetically homogenous can be made. In the step (2b), by repeating selfing or inbreeding typically five to seven times, preferably six to seven times, a genetically homogenous strain is made.

(76) Further, in the step (3b), from the strains obtained as a result of the last selfing or inbreeding in the step (2b), a self-incompatibility strain that is a homozygote with respect to S.sub.II haplotype is selected. The self-incompatibility strain obtained in this manner can be used as a parent strain for F1 hybrid breeding.

(77) Selection of a strain that is a heterozygote or homozygote with respect to S.sub.II haplotype can be achieved by using primers designed based on known sequences of S.sub.II haplotype. As S.sub.II haplotype, for example, S.sub.44, S.sub.60, S.sub.40, S.sub.29 and so on can be recited, and sequences of these are disclosed, for example, in Kakizaki et al., (2006) Genes Genet. Syst. 81, 63-67. Discrimination between a heterozygote and a homozygote with respect to S.sub.II haplotype can be conducted, more concretely, by a PCR method using primer sets for confirming existence of class II-SP11 (S.sub.44, S.sub.60, S.sub.40, S.sub.29) as described in the foregoing (1) Method for making self seed fertile Brassicaceae plant.

(78) According to the method for breeding a parent strain for F1 hybrid breeding of the present invention, since a strain that is a homozygote with respect to recessive S.sub.II haplotype is obtained by selfing or inbreeding a self-compatible strain obtained in the step (1b), bud pollination that required enormous labor in the past is no longer needed, and a parent strain for F1 hybrid breeding can be bred conveniently and efficiently. Bud pollination means artificially pollinating to an immature pistil of an unflowered bud, and is a method utilizing the phenomenon that pollination to seed formation proceed without recognition of oneself due to immatureness of the stigma even in a self-incompatible plant.

(79) (4) Method for Screening Self-Compatible Brassicaceae Plant

(80) The present invention provides a method for screening a self-compatible Brassicaceae plant. The screening method is characterized by including the following steps (1c) to (3c).

(81) (1c) a step of preparing a DNA sample from a test Brassicaceae plant;

(82) (2c) a step of amplifying DNA fragments containing an inverted repeat sequence and SP11 sequence from the DNA sample prepared in the step (1c); and

(83) (3c) a step of selecting a strain belonging to class I in a self-incompatibility gene locus of Brassicaceae plant, in which pollen factor SP11 is inactivated while the inverted repeat sequence (SMI) is retained based on molecular weights or nucleotide sequences of the DNA fragments amplified in the step (2c).

(84) Preparation of a DNA sample from a test Brassicaceae plant in the step (1c), a method for amplifying DNA fragments in the step (2c), and a method for selecting a strain in which pollen factor SP11 is inactivated while the inverted repeat sequence (SMI) is retained in the step (3c) are as described in the forgoing (1) Method for making self-compatible Brassicaceae plant.

(85) (5) Kit for Screening Self-Compatible Brassicaceae Plant

(86) As described above, a strain of Brassicaceae plant belonging to class I in a self-incompatibility gene locus of Brassicaceae plant, in which pollen factor SP11 is inactivated while the inverted repeat sequence (SMI) is retained is found to have self-compatibility and self seed fertility. Based on this finding, the present invention further provides a kit for use in screening a self-compatible Brassicaceae plant. The kit includes (i) a regent capable of detecting retention of an inverted repeat sequence (SMI), and (ii) a reagent capable of detecting inactivation of pollen factor SP11 in S.sub.I haplotype belonging to class I on a self-incompatibility gene locus in Brassicaceae plant.

(87) As such reagents, primers that specifically amplify DNA fragments encoding the inverted repeat sequence, and SP11 can be recited. Concrete examples of the reagents contained in the kit of the present invention include primers described in the foregoing (1) Method for making self seed fertile Brassicaceae plant.

(88) The screening kit of the present invention may further contain a buffer, salt, stabilizer, antiseptic and so on, and may be formulated according to a conventionally known method. The kit of the present invention may contain a reaction diluent, a cleaning agent, a reaction stopping liquid, a control sample and so on that are required to execute detection in addition to the aforementioned reagents.

Examples

(89) Hereinafter, the present invention will be described by way of a test example, however, it is to be noted that the present invention is not limited to this.

(90) 1. Breeding of Self-Compatible Brassicaceae Plant

(91) (1) Acquisition of Self-Compatibility Variant Strain (S.sub.0 Strain)

(92) A self-compatibility variant strain (Brassica rapa C634, available from TOHOKU UNIVERSITY, Brassica seed bank) is a self-compatible strain having variations both in a M gene locus and a S gene locus (see Murase et al., Science 303, 1516-1519, 2004; Fujimoto et al., Plant Mol. Biol. 61, 577-587, 2006). Here, M gene encodes a membrane-bound serine/threonine protein kinase named MLPK (M locus protein kinase). The membrane-bound serine/threonine protein kinase is believed to be an information transmission factor that positively transmits the information of self-incompatibility after reception of a signal of SP11 by SRK which is a receptor.

(93) In a S gene locus in the present strain, base insertion in the first intron of S54-SRK (pistil factor) and base deletion in the S54-SP11 promotor region are confirmed. It was also demonstrated that the strain has S haplotype belonging to class I (S54 haplotype), and expression of SP11 is suppressed. Further, analysis of a registered genome sequence (GenBank: AB190354.1) revealed the retention of the SMI sequence of class I.

(94) Then at first, the present strain S.sub.0S.sub.0mm and a self-incompatible wild-type strain S.sub.8S.sub.8MM are crossbred to make a F1 strain S.sub.0S.sub.8Mm, and the F1 strain was selfed by bud pollination to obtain F2 strains. While the F2 strains included self-compatible strains (S.sub.0S.sub.0MM, S.sub.0S.sub.0Mm, S.sub.0S.sub.0mm, S.sub.0S.sub.0mm, S.sub.8S.sub.8 mm), a strain not having variation in the M gene locus (S.sub.0S.sub.0MM) was selected by using a genomic PCR method, and the strain was selfed another five times to obtain a S.sub.0 strain. It is conceivable that the S.sub.0 strain is converted to one having self-compatibility by dominantly suppressing the function of recessive S haplotype belonging to class II (see FIG. 2).

(95) For extraction of genomic DNA, DNeasy Plant Mini Kit (product of QIAGEN) was used, and extraction was conducted according to the attached protocol by using a lamina of a plant body as a sample. As primers for discriminating between M and m, the primer sets represented in the following SEQ ID NOs: 18 and 19 were used.

(96) TABLE-US-00009 (SEQIDNO:18) MLPK-Forward:5-GCTACGAAAATGTCTTCGCCAATC-3 (SEQIDNO:19) MLPK-Reverse:5-CCTAGAATTTGAAAGGCTGGATGC-3

(97) The PCR reaction condition is as follows.

(98) A cycle of dissociation at 95 C. for 20 seconds, annealing at 55 C. for 20 seconds, and elongation at 68 C. for 60 seconds was repeated 35 times. Under this PCR condition, about 300 bp is amplified in the case of M, and about 900 bp is amplified in the case of m.

(99) (2) Acquisition of Self-Incompatible Brassicaceae Plant (S.sub.60S.sub.60 Strain)

(100) As a S.sub.0S.sub.60 strain, a S.sub.52S.sub.60 strain of Brassica rapa cv. Osome (obtained from TAKII & CO., LTD.) was selfed by bud pollination, and a strain having S.sub.0S.sub.60 genotype was selected by using a genomic PCR method, and the strain was selfed another three times, and the strain thus obtained was used in the present example.

(101) A primer set for amplifying S.sub.60 is as follows. About 2 kbp is amplified by the PCR method using the primer set. The PCR condition is as described above.

(102) TABLE-US-00010 S.sub.60-sp11pro-Forward: (SEQIDNO:20) 5-CCGAAGCTTGACAACAAAGACGGTTCTGATC-3 S.sub.60-sp11pro-Reverse: (SEQIDNO:21) 5-CAGCCATGGCTTATGAGTATATAAGATTTTCGC-3

(103) A primer set for amplifying S52 is as follows. By the PCR method using the primer set, about 600 bp is amplified. The PCR condition is as described above.

(104) TABLE-US-00011 (SEQIDNO:22) S.sub.52-Smi-Forward:5-CCATGCACCAAATAAATTTCCTATGG-3 (SEQIDNO:23) S.sub.52-Smi-Reverse:5-GAATACACCAAGATTGTGTAGAG-3
(3) Culture Condition

(105) A seed of Brassica rapa is allowed to germinate on a laboratory dish containing water-moisten gauze, and transplanted to a plug tray containing Metro Mix (Metro Mix 250: product of HYPONeX JAPAN CORP., LTD.) when the size reaches 2 to 3 cm. When seven to eight true leaves had emerged, the plant was transplanted to a black pot (9 cm diameter) containing organic compost (Organic compost for flowers and vegetables): product of Protoleaf corporation) and a low temperature treatment was conducted for a month in a low temperature room (temperature 4 to 5 C., luminous intensity: 200 to 300 Lux). Then the plant was transplanted into a No. 7 pot containing Hyuga soil (medium grain) (product of Hyuga-tsuchi Hanbai Co. Ltd.) spread over about one third of the capacity, and organic compost (Organic compost for flowers and vegetables: product of Protoleaf corporation), and cultured while herbicide spraying was appropriately conducted. As a S.sub.0 strain or a S.sub.60 strain, those after 2 to 5 months from sowing that had been cultured in an air-conditioned room (temperature 23 degrees, luminous intensity about 1000 Lux (light time), illumination time 12 hours/day) were used. Regarding the S.sub.0 strain, it was cultured without conducting a low-temperature treatment because a breed whose genotype is fixed to rapid cycle (RC) causing early flowering was used for the S.sub.0 strain.

(106) (4) Crossbreeding Between S.sub.0 Strain and S.sub.60 Strain

(107) A Brassica rapa of S.sub.0 strain (S.sub.0S.sub.0) and a Brassica rapa of self-incompatible (S.sub.60S.sub.60) strain were crossbred (once) by artificial pollination, and the obtained seed was cultured for 90 days under the same culture condition. Representative pictures of parent strains used in the crossbreeding and a self-compatible strain obtained as a result of the crossbreeding are shown in FIG. 3.

(108) (5) Results

(109) The Brassicaceae plant (S.sub.0S.sub.60 strain) obtained in this manner lost self-incompatibility and had self seed fertility. Comparison of the number of seeds per one capsule revealed that the number of seeds per one capsule is larger in the strain having both S.sub.60 and S.sub.0 heterozygously than in the S.sub.0S.sub.0 strain (see FIG. 4). For comparison, the numbers of seeds per one capsule in the strain having S haplotype of class I homozygously (S.sub.8S.sub.8 strain) and the strain having S haplotype of class II homozygously (S.sub.60S.sub.60 strain) are also shown in the graph. Since these strains are self-incompatible, a seed is not formed.

(110) Comparing S.sub.0S.sub.60 strain with the S.sub.60S.sub.60 strain or the S.sub.0S.sub.0 strain regarding the size and the number of capsule, the thickness and length of stem, and the number of flowers, the growth was apparently good in any terms. Such a phenotype is ascribable to the heterosis (see FIG. 3).

(111) Sequence List Free Text

(112) SEQ ID NO: 7 shows a nucleotide sequence of S8sp11-genome-Forward primer.

(113) SEQ ID NO: 8 shows a nucleotide sequence of S8sp11-genome-Reverse primer.

(114) SEQ ID NO: 9 shows a nucleotide sequence of SL-Forward 1 primer.

(115) SEQ ID NO: 10 shows a nucleotide sequence of SL-Reverse 1 primer.

(116) SEQ ID NO: 11 shows a nucleotide sequence of class II-SP11-Forward primer.

(117) SEQ ID NO: 12 shows a nucleotide sequence of class II-SP11-Reverse primer.

(118) SEQ ID NO: 13 shows a nucleotide sequence of SL-Forward 2 primer.

(119) SEQ ID NO: 14 shows a nucleotide sequence of SLGI-Forward primer.

(120) SEQ ID NO: 15 shows a nucleotide sequence of SLGI-Reverse primer.

(121) SEQ ID NO: 16 shows a nucleotide sequence of SLGII-Forward primer.

(122) SEQ ID NO: 17 shows a nucleotide sequence of SLGII-Reverse primer.

(123) SEQ ID NO: 18 shows a nucleotide sequence of MLPK-Forward primer.

(124) SEQ ID NO: 19 shows a nucleotide sequence of MLPK-Reverse primer.

(125) SEQ ID NO: 20 shows a nucleotide sequence of S.sub.0-sp11pro-Forward primer.

(126) SEQ ID NO: 21 shows a nucleotide sequence of S.sub.0-sp11pro-Reverse primer.

(127) SEQ ID NO: 22 shows a nucleotide sequence of S.sub.52-Smi-Forward primer.

(128) SEQ ID NO: 23 shows a nucleotide sequence of S.sub.52-Smi-Reverse primer.