METHOD FOR SCREENING PHARMACEUTICALS FOR TREATMENT OF STEATOHEPATITIS USING N-TERMINAL DIMERIZATION OF APOPTOSIS SIGNAL-REGULATED KINASE1

20180149638 ยท 2018-05-31

    Inventors

    Cpc classification

    International classification

    Abstract

    A method for screening a pharmaceutical compound for prevention, alleviation and/or treatment of steatohepatitis, the method including employing N-terminal dimerization of an apoptosis signal-regulated kinase 1 as a target.

    Claims

    1. A method for screening a pharmaceutical compound to determine whether the pharmaceutical compound is a potential substance for prevention, alleviation and/or treatment of steatohepatitis, the method comprising: (a) contacting a system containing an N-terminal of the apoptosis signal-regulated kinase 1 and a candidate substance, wherein the system containing the N terminal of the apoptosis signal-regulated kinase 1 is a cell containing the N terminal of the apoptosis signal-regulated kinase 1 or a solution containing the N terminal of the apoptosis signal-regulated kinase 1; and (b) observing effect of the candidate substance on the N-terminal dimerization of the apoptosis signal-regulated kinase 1; wherein when the candidate substance inhibits the N-terminal dimerization of the apoptosis signal-regulated kinase 1, the candidate substance is deemed to be a potential substance for prevention, alleviation and/or treatment of steatohepatitis.

    2. The method of claim 1, wherein (a) contacting a system containing an N-terminal of the apoptosis signal-regulated kinase 1 and a candidate substance comprises: adding the candidate substance to the system containing the N terminal of the apoptosis signal-regulated kinase 1 in a test group; and/or (b) observing effect of the candidate substance on the N-terminal dimerization of the apoptosis signal-regulated kinase 1 comprises: detecting the role of the N-terminal dimerization of the apoptosis signal-regulated kinase 1 in the system in the test group and comparing with a control group, wherein the control group is a system containing N-terminal dimerization of an apoptosis signal-regulated kinase 1 without addition of the candidate substance.

    3. The method of claim 1, wherein (a) contacting a system containing an N-terminal of the apoptosis signal-regulated kinase 1 and a candidate substance comprises: (1) constructing a cell model containing the N terminal of the apoptosis signal-regulated kinase 1: a CheckMate mammalian two-hybrid system is used to connect the DNA fragment encoding the N-terminal amino acids from 1 to 678 of the apoptosis signal-regulated kinase 1 to the pBIND vector encoding the DNA binding domain and the pACT vector encoding transcriptional activation domain respectively; two constructed vectors are transfected into an animal cell; amino acids from 1 to 678 of the N-terminal amino acid sequence of the apoptosis signal-regulated kinase 1 is shown in SEQ. ID. NO: 1 and a nucleotide sequence encoding the N-terminal of the apoptosis signal-regulated kinase 1 is shown in SEQ. ID. NO: 2; and (2) connecting nucleotide fragments of the candidate polypeptides to a psi-Flag vector, respectively, and simultaneously transfecting the constructed candidate polypeptide plasmids and pG5luc plasmid into the above constructed animal cell model for screening the N-terminal dimerization of the apoptosis signal-regulated kinase 1; and (b) observing effect of the candidate substance on the N-terminal dimerization of the apoptosis signal-regulated kinase 1 comprises detecting RLUs of firefly luciferase and Renilla luciferase of a successfully transfected cell after incubated for 24 h; calculating a ratio of the two, and comparing degrees of inhibition of the polypeptides from different samples according to an obtained ratio; when the N terminal of the apoptosis signal-regulated kinase 1 is normally dimerized, the firefly luciferase reporter gene is highly expressed when the above cells continue to be transfected into the pG5luc vector; when the N terminal dimerization of the apoptosis signal-regulated kinase 1 is inhibited, the firefly luciferase reporter gene on the pG5luc vector is not expressed.

    4. The method of claim 3, wherein the animal cell in (a) is HEK-293T, L02, Hela, Huh7, Hepg2, A549, 3T3, MEFs, and H9C2.

    5. The method of claim 4, wherein the animal cell used in (a) is HEK-293T.

    6. The method of claim 1, wherein (a) contacting a system containing an N-terminal of the apoptosis signal-regulated kinase 1 and a candidate substance comprises: (1) constructing a cell model containing the N terminal of the apoptosis signal-regulated kinase 1: a DNA encoding the N-terminal amino acids from 1 to 678 of the apoptosis signal-regulated kinase 1 is connected to plasmids pcDNA5-HA and pcDNA5-Myc, respectively, to construct plasmid HA-ASK1.sub.N and Myc-ASK1.sub.N; the constructed plasmids are transfected into an animal cell respectively or simultaneously; and (2) the DNA encoding candidate polypeptides are connected to the psi-Flag vectors, respectively, and the plasmids psi-flag-Peptides are obtained; the plasmids psi-flag-Peptides are transfected into an animal cell containing both plasmids HA-ASK1.sub.N and Myc-ASK1.sub.N respectively; and (b) observing effect of the candidate substance on the N-terminal dimerization of the apoptosis signal-regulated kinase 1 comprises: detecting the contents of HA-ASK1.sub.N and Myc-ASK1.sub.N in a protein solution after co-immunoprecipitation by Western blot after 24 hrs of incubation of a successfully transfected cell; wherein co-immunoprecipitation is performed by using anti-HA to connect the target protein with protein A/G agarose beads, and Western blot is treated with anti-Myc as primary antibody; when an animal cell group transfected with candidate psi-flag-Peptide, HA-ASK1.sub.N and Myc-ASK1.sub.N simultaneously is identical to a control group transfected with HA-ASK1.sub.N or Myc-ASK1.sub.N alone, no significant Myc protein band is detected, that means the candidate substance is a potential substance for prevention, alleviation and/or treatment of steatohepatitis.

    7. The method of claim 6, wherein the animal cell used in (a) is HEK-293T, L02, Hela, Huh7, Hepg2, A549, 3T3, MEFs, and H9C2.

    8. The method of claim 7, wherein the animal cell used in (a) is HEK-293T.

    9. The method of claim 8, further comprising performing a cellular experiments and/or animal tests on the obtained potential substance to select a substance that inhibits the N-terminal dimerization of the apoptosis signal-regulated kinase 1 for prevention, alleviation and/or treatment of steatohepatitis.

    10. A cell model for screening a pharmaceutical compound for prevention, alleviation and/or treatment of steatohepatitis using N-terminal dimerization of apoptosis signal-regulated kinase 1 as a target.

    11. The cell model of claim 10, wherein a CheckMate mammalian two-hybrid system is used, the DNA shown in SEQ. ID. NO: 2 encoding amino acids from 1 to 678 of the N-terminal of the apoptosis signal-regulated kinase 1 is connected to the pBIND vector encoding the DNA binding domain and the pACT vector encoding transcriptional activation domain, and the two constructed vectors are transfected into an animal cell.

    12. The cell model of claim 11, wherein the animal cell is a HEK-293T cell.

    13. The cell model of claim 10, wherein a DNA shown in SEQ. ID. NO: 2 encoding the N-terminal amino acids from 1 to 678 of the apoptosis signal-regulated kinase 1 is connected to plasmids pcDNA5-HA and pcDNA5-Myc, respectively, to construct plasmids HA-ASK1.sub.N and Myc-ASK1.sub.N. Then the constructed plasmids are transfected into an animal cell respectively or simultaneously, and the animal cell used is selected from HEK-293T, L02, Hela, Huh7, Hepg2, A549, 3T3, MEFs, and H9C2.

    14. A polypeptide Peptide1 for prevention, alleviation and/or treatment of steatohepatitis, or a pharmaceutically-acceptable salt thereof, or a pharmaceutically-acceptable carrier or excipient, the polypeptide Peptide1 having an amino acid sequence shown in SEQ. ID. NO: 20.

    15. The polypeptide Peptide1 of claim 14, being encoded by a nucleotide sequence shown in SEQ. ID. NO: 38.

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0051] FIG. 1 is a ratio of RLUs of firefly luciferase and Renilla luciferase;

    [0052] FIG. 2 is a detection result of Western blot assay of lysate of HEK-293T cells which have been transfected with different plasmids and a protein solution obtained by co-immunoprecipitation.

    [0053] FIG. 3 is a detection result of Western blot assay of ASK1-JNK1 signaling pathway in L02 cells transfected with different polypeptide plasmids after stimulation with PA for 1 h;

    [0054] FIGS. 4A-4B are detection results of oil red O staining and quantitative determination result of intracellular triglyceride content in L02 cells which have been transfected with different polypeptide plasmids after stimulation with PA for 12 h, wherein FIG. 4A is the oil red O staining and FIG. 4B is a statistical chart of the detection result of triglyceride content;

    [0055] FIGS. 5A-5B are detection results of Peptide1 overexpression efficiency of cynomolgus monkeys' liver mediated by adeno-associated virus AAV8, wherein FIG. 5A is a result of virus transfection efficiency of cynomolgus monkeys' liver in saline control group, AAV8-GFP control group and AAV8-GFP-Peptide1 group; FIG. 5B is a detection result of Peptide1 expression of cynomolgus monkeys' liver in AAV8-GFP control group and AAV8-GFP-Peptide1 group after portal vein injection of viral vectors;

    [0056] FIGS. 6A-6B illustrate a weight and BMI index result of cynomolgus monkeys in AAV8-GFP and AAV8-GFP-Peptide1 group, wherein FIG. 6A is a graph showing the weight result, FIG. 6B is a graph showing the BMI index result (n. s.: p>0.05 vs AAV8-GFP group);

    [0057] FIGS. 7A-7F illustrate blood lipid levels and a liver function detection result of cynomolgus monkeys in AAV8-GFP and AAV8-GFP-Peptide1 group, wherein FIG. 7A is a graph showing a detection result of serum triglyceride content, FIG. 7B is a graph showing a detection result of total cholesterol content, FIG. 7C is a graph showing a detection result of serum high-density cholesterol content, FIG. 7D a graph showing is a detection result of serum low-density cholesterol content, FIG. 7E is a graph showing a detection result of alanine aminotransferase (ALT) content, and FIG. 7F is a graph showing a detection result of aspartate transaminase (AST) content (n. s. p>0.05 vs AAV8-GFP group, **: p<0.01 vs AAV8-GFP group); and

    [0058] FIG. 8 illustrates a liver tissue HE and oil red O staining result of cynomolgus monkeys in AAV8-GFP and AAV8-GFP-Peptide1 group.

    DETAILED DESCRIPTION OF THE EMBODIMENTS

    [0059] The features and advantages of the present disclosure can be further understood from the following detailed description in conjunction with the accompanying drawings. The embodiments provided are merely illustrative of the method of the present disclosure and are not intended to limit the remainder of the present disclosure in any way.

    [0060] Methods:

    [0061] (1) Cell Culture

    [0062] HEK-293T cells are cultured in DMEM high glucose medium (containing 10% FBS, 1% penicillin-streptomycin); L02 cells are cultured in DMEM high glucose medium (containing 10% FBS, 1% penicillinstreptomycin), the air humidity in the incubator should be ensured, the CO2 content is 5% and the incubation temperature is 37 C.

    [0063] (2) Vector Construction

    [0064] 1) Construction of Mammalian Two-Hybrid Detection Vectors pACT-ASK1.sub.N and pBIND-ASK1.sub.N

    [0065] Construction of ASK1.sub.N dimerization detection vector selecting a CheckMate mammalian two-hybrid system (Promega, E2440):

    [0066] i) The ASK1(NCBI: BC088829) cDNA is used as template to amplify the ASK1.sub.N1 fragment, the primer pairs are as follows:

    TABLE-US-00001 Forward: (SEQ.ID.NO:3) 5-CGGGATCCGGATGAGCACGGAGGCGGACGA-3 Reverse: (SEQ.ID.NO:4) 5-TGATGTCATTCTGGTGCTCCTCGCCCTCGC-3;

    [0067] ii) The ASK1 (NCBI: BC088829) cDNA is used as template to amplify the ASK1.sub.N2 fragment, the primer pairs are as follows:

    TABLE-US-00002 Forward: (SEQ.ID.NO:5) 5-GGAGCACCAGAATGACATCAGGAAAGCTCG-3 Reverse: (SEQ.ID.NO:6) 5-GCTCTAGATCAATCATATTCATAGTCATACTCCAGC-3

    [0068] iii) The ASK1.sub.N1 and ASK1.sub.N2 mixture is used as template to amplify ASK1.sub.N fragment, the primer pairs are as follows:

    TABLE-US-00003 Forward: (SEQ.ID.NO:3) 5-CGGGATCCGGATGAGCACGGAGGCGGACGA-3 Reverse: (SEQ.ID.NO:6) 5-GCTCTAGATCAATCATATTCATAGTCATACTCCAGC-3

    [0069] iv) pACT vector and pBIND vector are digested with BamH I (NEB, R0136L) and Xba I (NEB, R0145L) and then connected with the amplified target gene to obtain pACT-ASK1.sub.N and pBIND-ASK1.sub.N vectors.

    [0070] 2) Construction of pcDNA5-HA, pcDNA5-Myc, psi-Flag Vectors

    [0071] Construction of pcDNA5-HA:

    [0072] i) Two complementary fragments containing an HA tag sequence are synthesized:

    TABLE-US-00004 F- (SEQ.ID.NO:9) AGCTTGCCACCATGTACCCATACGATGTTCCAGATTACGCTAGCCCGGGC G R- (SEQ.ID.NO:10) GATCCGCCCGGGCTAGCGTAATCTGGAACATCGTATGGGTACATGGTGGC A

    [0073] ii) Two fragments are annealed to obtain a product with a cohesive end;

    [0074] iii) The pcDNA5/FRT mammalian expression vector (Thermo, V601020) is linearized with the following primers and digested with HindIII (NEB, R0104L) and BamH I;

    TABLE-US-00005 pcDNA5-VF: (SEQ.ID.NO:11) CGCGGATCCACTAGTCCAGTGTGGTGGAA pcDNA5-VR: (SEQ.ID.NO:12) CCCAAGCTTAAGTTTAAACGCTAGAGTCCGGA

    [0075] iv) The annealed product is connected with the digested linearized vector to obtain the pcDNA5-HA vector.

    [0076] Construction of pcDNA5-Myc:

    [0077] i) Two complementary fragments containing a Myc tag sequence are synthesized:

    TABLE-US-00006 F- (SEQ.ID.NO:13) AGCTTGCCACCATGGAGCAGAAGCTGATCTCAGAGGAGGACCTGAGCCCGG GCG R- (SEQ.ID.NO:14) GATCCGCCCGGGCTCAGGTCCTCCTCTGAGATCAGCTTCTGCTCCATGG TGGCA

    [0078] ii) Two fragments are annealed to obtain a product with a cohesive end;

    [0079] iii) The pcDNA5/FRT mammalian expression vector (Thermo, V601020) is linearized with the following primers and digested with HindIII and BamH I;

    TABLE-US-00007 pcDNA5-VF: (SEQ.ID.NO:11) CGCGGATCCACTAGTCCAGTGTGGTGGAA pcDNA5-VR: (SEQ.ID.NO:12) CCCAAGCTTAAGTTTAAACGCTAGAGTCCGGA

    [0080] iv) The annealed product is connected with the digested linearized vector to obtain the pcDNA5-Myc vector.

    [0081] Construction of psi-Flag:

    [0082] the following fragment is synthesized:

    TABLE-US-00008 5- (SEQ.ID.NO:15) CCGGCTAGCGATTACGCCAAGCTCGAAATTAACCCTCACTAAAGGGAACA AAAGCTGGAGCTCCACCGCGGTGGCGGCCGCCACCATGGATTACAAGGAT GACGACGATAAGAGCCCGGGCGGATCTATGGATTACAAGGATGACGACGA TAAGAGCCCGGGCGGATCTATGGATTACAAGGATGACGACGATAAGAGCC CGGGCGGATCTATGGATTACAAGGATGACGACGATAAGAGCCCGGGCGGA TCCGCGATACCGGAATTCCGGAATCCGCTCGAGCAATTGATGC-3

    [0083] ii) The synthetic DNA fragment is digested with NheI (NEB, R0131L) and MfeI (NEB, R0589L) and connected with plasmid pSicoR (Addgene, #67884) which is digested with NheI and EcoRI (NEB, R0101L) to obtain psi-Flag vector.

    [0084] 3) Construction of HA-ASK1.sub.N and Myc-ASK1.sub.N Vectors for Co-Immunoprecipitation to Verify the Inhibitory Effect of the Target Polypeptide on N-Terminal Dimerization of ASK1

    [0085] Construction of HA-ASK1N vector: N-terminal sequence of ASK1 (NCBI: BC088829) gene is amplified by using the upstream primer: 5-CGGGATCCATGAGCACGGAGGCGGACGA-3 (SEQ. ID. NO: 16) and downstream primer: 5-TGCGGCCGCTCAATCATATTCATAGTCATACTCCAGC-3 (SEQ. ID. NO: 17), the amplified product and the pcDNA5-HA vector are digested with the restriction endonucleases BamHI and NotI (NEB, R0189L) and connected to obtain the HA-ASK1.sub.N vector.

    [0086] Construction of Myc-ASK1.sub.N vector: N-terminal sequence of ASK1 (NCBI: BC088829) gene is amplified by using the upstream primer: 5-GAAGATCTATGAGCACGGAGGCGGACGA-3 (SEQ. ID. NO: 18) and downstream primer: 5-CATGCCATGGTCAATCATATTCATAGTCATACTCCAGC-3 (SEQ. ID. NO: 19), the amplified product and the pcDNA5-Myc vector are digested with the restriction endonucleases BglII (NEB, R0144L) and NcoI (NEB, R0193L) and connected to obtain the Myc-ASK1.sub.N vector.

    [0087] 4) Construction of Candidate Polypeptide Vectors

    [0088] the amino acid sequence of the polypeptides used in this patent are as follows:

    TABLE-US-00009 Peptide1(SEQ.ID.NO:20): LHNGRSKEQRLKEQLGAQQEPVKKSIQESEAFLPQSIPEERYKMKSKPLG ICLIIDCI Peptide2(SEQ.ID.NO:21): MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKL SVGDLAEL Peptide3(SEQ.ID.NO:22): MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICT TGKLPVPW Peptide4(SEQ.ID.NO:23): GVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEG DTLVNRIE

    [0089] i) The Peptide1 fragment is amplified using the cFLIP (NCBI: NM_003879.5) cDNA as a template, the primer pairs are as follows:

    TABLE-US-00010 Forward: (SEQ.ID.NO:24) 5-CGGGATCCCTCCATAATGGGAGAAG-3 Reverse: (SEQ.ID.NO:25) 5-GCTCTAGAAATGCAATCGATTATC-3;

    [0090] ii) The Peptide2 fragment is amplified using the cFLIP (NCBI: NM_003879.5) cDNA as a template, the primer pairs are as follows:

    TABLE-US-00011 Forward: (SEQ.ID.NO:26) 5-CGGGATCCATGTCTGCTGAAGTC-3 Reverse: (SEQ.ID.NO:27) 5-GCTCTAGATCACAGTTCAGCCAAGTC-3;

    [0091] iii) The Peptide3 fragment is amplified using the GFP (NCBI: KX130867.1) cDNA as a template, the primer pairs are as follows:

    TABLE-US-00012 Forward: (SEQ.ID.NO:28) 5-CGGGATCCATGGTGAGCAAGGGCG-3 Reverse: (SEQ.ID.NO:29) 5-GCTCTAGATCACCAGGGCACGGGCAG-3;

    [0092] iv) The Peptide4 fragment is amplified using the GFP (NCBI: KX130867.1) cDNA as a template, the primer pairs are as follows

    TABLE-US-00013 Forward: (SEQ.ID.NO:30) 5-CGGGATCCGGCGTGCAGTGCTTC-3 Reverse: (SEQ.ID.NO:31) 5-GCTCTAGATCACTCGATGCGGTTCAC-3;

    [0093] v) The psi-flag vector and the amplified target gene are digested with the restriction endonucleases BamH I and Xba I, and then connected to obtain the psi-flag-peptides (Flag-peptides) vectors.

    [0094] (3) Construction of Mammalian Two-Hybrid Screening System

    [0095] 1) The constructed ASK1.sub.N mammalian two-hybrid detection vector is packaged with virus in HEK-293T cells for 72 h, and the medium is collected and used for infection;

    [0096] 2) The HEK-293T cells are cultured in 6-well plates for 18-24 hrs so that the number of cells reach to 210.sup.5 per hole;

    [0097] 3) The next day, the original medium is replaced with 2 ml fresh medium containing 6 g/mL polybrene, and an appropriate amount of virus suspension is added;

    [0098] 4) After 48 h of continuous culture, the virus-containing medium is replaced with fresh medium, and the polypeptide plasmids to be screened is transfected.

    [0099] (4) Polypeptide Plasmids Transfection

    [0100] 1) Configure the transfection solution as follows:

    [0101] A) 0.5 g psi-Flag-Peptides+0.5 g pG5luc plasmid is added to 200 L serum-free DMEM medium and is mixed even by vortex oscillation;

    [0102] B) TurboFect transfection reagent is mixed by vortex oscillation slightly, 2 L mixture is added to the medium of a, blown and mixed immediately, and then placed at room temperature for 20 min;

    [0103] 2) The transfected solution is added to a 24-well culture plate that culture HEK-293T cells which expressed pACT-ASK1.sub.N and pBIND-ASK1.sub.N vectors stably, and then shake to mix and incubate at 37 C. for 24 hrs.

    [0104] (5) Luciferase Fluorescence Detection

    [0105] 1) Cell lysis: discard the medium and cells are lysed with reporter gene lysis buffer. After full lysis, the resulting solution is centrifuged at 10,000-15,000 g for 3-5 min to collect supernatant;

    [0106] 2) Dissolve the firefly luciferase detection reagent and Renilla luciferase detection buffer, and reach room temperature, the Renilla luciferase detection substrate (100) is placed in an ice bath or ice box;

    [0107] 3) Renilla luciferase assay substrate (100) is diluted (1:100) with Renilla luciferase detection buffer;

    [0108] 4) Turn on the fluorescence meter (Promega, GloMax 20/20 Luminometer), and set the detection interval to 2 s, and the detection time to 10 s.

    [0109] 5) When each sample is detected, take 20-100 L of the sample and add 100 L firefly luciferase detection reagent, then detecting the RLU (relative light unit) after mixing with a gun, wherein the reporter gene cell lysate is used as blank control;

    [0110] 6) After completing the step of detecting the firefly luciferase, add 100 L Renilla luciferase detection solution, and mix it with the gun to detect the RLU (relative light unit);

    [0111] 7) In the case of Renilla luciferase as the internal reference. Inhibition degrees of the different polypeptides are compared according to the obtained ratio of RLU value of firefly luciferase and Renilla luciferase.

    [0112] (6) Co-Immunoprecipitation

    [0113] 1) The HEK-293T cells are transfected with the constructed plasmids HA-ASK1N and Myc-ASK1N respectively or simultaneously. The plasmids psi-flag-Peptides are then transfected into HEK-293T cells containing both HA-ASK1N and Myc-ASK1N, respectively.

    [0114] 2) The cells are harvested after transfection for 24 hrs, add the appropriate amount of cell lysis buffer (containing protease inhibitor), lysate on ice for 30 min, take the supernatant after cell lysate is centrifuged at 4 C. with the maximum speed for 30 min;

    [0115] 3) Take a small amount of lysate for Western blot assay, add 1 g of anti-HA antibody (Sigma, # H6908) to the remaining lysate, and slowly shake and incubate overnight at 4 C.;

    [0116] 4) Take 10 L protein A/G agarose beads (11719394001 and 11719386001, Roche), wash 3 times with the appropriate amount of lysis buffer and centrifuge at 3,000 rpm for 3 min per time;

    [0117] 5) Add the pretreated 10 L protein A/G agarose beads to the cell lysate that incubated overnight with antibodies, and slowly shake and incubate at 4 C. for 2-4 hrs to equilibrate the antibodies with protein A/G agarose beads;

    [0118] 6) After the co-immunoprecipitation reaction, centrifuge at 4 C. with 3,000 rpm for 3 min until the agarose beads are centrifuged to the bottom of the tube; aspirate the supernatant, and wash the agarose beads 3-4 times with 1 ml lysis buffer; finally add 15 pt of 2SDS loading buffer, and boil in boiling water for 5 min;

    [0119] 7) SDS-PAGE, Western blot assay.

    [0120] (7) Western Blot

    [0121] 1) Protein Extraction

    [0122] Add lysis buffer to cultured cells, collect the protein samples and quantitatively using the BCA Protein Assay Kit.

    [0123] 2) Electrophoresis

    [0124] i) Place the prepared gel plate in the electrophoresis tank, and the electrophoretic internal solution and the electrophoretic outer solution are added. Each electrophoresis tank contains 200 ml electrophoretic internal solution and the electrophoresis tank is filled with the electrophoretic outer solution with of the volume of the electrophoresis tank.

    [0125] ii) Load the protein sample into the sample hole of SDS-PAGE gel, and start the electrophoresis.

    [0126] 3) Transfer

    [0127] i) Prepare the transfer buffer and place at 4 C. for precooling.

    [0128] ii) Cut the PVDF membrane by 8 cm5.9 cm and cut a gap in the corner as the upper left corner of the membrane, before use, soak it in methanol for 15 s and then put it in the transfer buffer.

    [0129] iii) Spread the splint around and turn the negative to the right. The black side is negative, and the white side is positive, and both sides are covered with two sponges and five filter papers (the sponges and filter papers are previously wetted with transfer buffer).

    [0130] iv) Remove the gel in the gel plate, remove the excess part, wash the gel with the transfer buffer, place the gel on the filter paper of the negative electrode, remove the air bubbles, cover it with the PVDF membrane, make the gap align with the corner of the largest marker, and remove the bubbles and cover the left filter paper and sponge (cannot have bubbles), and clip the splint.

    [0131] v) Place the splint in the transferring film groove and the negative (black face) of the transferring film groove should be placed together with the negative (black side) of the splint, fill the transfer buffer to flood the gel.

    [0132] vi) Connect the transferring film groove to the power supply. Transfer in transfer buffer at 250V and 0.2 A for 1.5 h.

    [0133] vii) Take out the PVDF membrane after the transfer.

    [0134] 4) Sealing

    [0135] Wash the membrane with TBST buffer. Put the membrane in sealing solution for 1-4 hrs on a slowly shaking platform at room temperature to block no-specific binding.

    [0136] 5) Primary Antibody Incubation

    [0137] i) Wash the membrane 3 times for 5 min each with TBST.

    [0138] ii) The sealing machine seals the film into the hybrid bag, add a primary antibody, not leaving the air as far as possible.

    [0139] iii) Place the hybrid bag in the shaking table at 4 C. for overnight.

    [0140] 6) Secondary Antibody Incubation

    [0141] i) Take out and wash the membrane 3 times for 5 min each with TB ST.

    [0142] ii) Incubate the membrane with corresponding secondary antibody for 1 h in dark.

    [0143] 7) Protein Detection

    [0144] After incubation, wash the membrane 3 times again for 5 min each with TBST. The target bands are detected using a Bio-Rad Chemi Doc XRS.sup.+ gel imaging system.

    [0145] (8) Construction of Adeno-Associated Virus Vector System (AAV8-GFP-Peptide1/AAV8-GFP)

    [0146] AAV8 is a liver-targeted gene therapy vector, and the in the present disclosure is used for mediating the overexpression of Peptide1 in liver of cynomolgus monkeys (Macaca. fascicularis) to study the effect of Peptide1 overexpression on nonalcoholic steatohepatitis.

    [0147] 1) The plasmid PX458 (Addgene, 48138) is used as template to amplified T2A-EGFP fragment, and the primer pairs are as follows:

    TABLE-US-00014 PX458-HindIII-F: (SEQ.ID.NO:32) (CCCAAGCTTGGTACCACTAGTGTCGACgaattcGGCAGTGGAGAGGG) PX458-BgLII-R: (SEQ.ID.NO:33) (GGAAGATCTTTACTTGTACAGCTCGTCCATGCC).

    [0148] The T2A-EGFP fragment is connected with pAAV-MCS (AAV vector) that digested with HindIII and BgLII (NEB, R0144L) to construct the pAAV-T2A-EGFP vector.

    [0149] The following sequences are synthesized and:

    TABLE-US-00015 MCS-Oligo1-SacI: (SEQ.ID.NO:34) (CtctagactcgagaccggtCTTAAGGCTAGCGATATCGGATCCAAGCTT GGTAC) MCS-Oligo2-KpnI: (SEQ.ID.NO:35) (CAAGCTTGGATCCGATATCGCTAGCCTTAAGACCGGTCTCGAGTCTAGA GAGCT)

    [0150] The synthetic DNA fragments are annealed and pAAV-MCS-T2A-EGFP vector is constructed by connecting the annealed products with pAAV-T2A-EGFP vector which digested with SacI (NEB, R0156L) and KpnI (NEB, R0142L).

    [0151] 2) The cDNA of gene cFLIP (NCBI: NM_003879.5) is used as template to amplified to amplified Peptide1 encoding sequence, the primer pairs are as follows:

    TABLE-US-00016 Upstreamprimer: (SEQ.ID.NO:7) 5-GCTCTAGAgccaccATGCTCCATAATGGGAGAAG-3 Downstreamprimer: (SEQ.ID.NO:8) 5-CGGGATCCCTTGTCATCGTCGTCCTTGTAATCAATGC

    [0152] The Peptide1 encoding sequence is digested with XbaI and BamHI, then subcloned to a pAAV-MCS-T2A-EGFP vector which is digested with the same enzymes to obtain a pAAV-Peptide1-T2A-EGFP vector in which the fragment Peptide1 is located in the same reading frame with EGFP, leading to the co-expression of Peptide1 and EGFP, thereby facilitating section observation.

    [0153] 3) Three plasmid transfection systems (pAAV-Peptide1-T2A-EGFP, pAAV-Helper and pAAV-2/8) are co-transfected into AAV293 cells using PEI (Polysciences cat#24765) and incubated for 72 h. Then the cells are collected and ultrasonically lyased, centrifuging to remove cell debris (for the AAV8-GFP control group, pAAV-MCS-T2A-EGFP, pAAV-Helper and pAAV-2/8 are used as plasmid transfection systems).

    [0154] 4) The virus is purified by cesium chloride gradient centrifugation and then separated with 1PBS+5% Sorbitol-in Slide-A-Lyzer dialysis cassettes to remove cesium chloride, to obtain adeno-associated virus AAV8-GFP-Peptide1 and AAV8-GFP.

    [0155] 5) The Virus titer analysis is performed by fluorescent quantitative PCR, comprising the following steps:

    [0156] a. Add 10 L purified virus solution into 100 L DNase lysate (10 mM Tris.Cl, pH 7.5, 10 mM MgCl.sub.2, 2 mM CaCl.sub.2, 50 U/ml DNase I) and incubate at 37 C. for 1 h;

    [0157] b. Add 0.5 M EDTA and mix evenly, incubate at 70 C. for 10 min, and then add protease K (50 g/ml), and incubate at 50 C. for overnight.

    [0158] c. Incubate at 99 C. for 10 min to deactivate protease K completely. Add sterile double-distilled water up to 1 ml, collect a 2 L sample, and add water up to 400 L to obtain a template for fluorescence quantitative PCR;

    [0159] d. Dilute plasmid pAAV-Peptide1-T2A-EGFP/pAAV-MCS-T2A-EGFP to eight concentration gradients of 510.sup.1 to 510.sup.8 to make standard substances.

    [0160] e. Collect a 2 L sample and a 2 L standard substance respectively, perform fluorescence quantitative PCR using GFP-specific primers: Forward 5-AGCAGCACGACTTCTTCAAGTCC-3 (SEQ. ID. NO: 36) and Reverse 5-TGTAGTTGTACTCCA GCTTGTGC-3 (SEQ. ID. NO: 37). Calculate the copy number of vectors in viruses (virus titer) according to the standard curve defined by the standard substance.

    Example 1 Screening of Peptides that can Inhibit N-Terminal Dimerization of ASK1

    [0161] HEK-293T cells that expressing p pACT-ASK1.sub.N and pBIND-ASK1.sub.N plasmids stably are divided into five groups, named as groups A, B, C, D, and E. Among these groups, cells of group A are infected with pG5luc plasmid only. In groups B, C, D, and E, HEK-293T cells are transfected into both plasmid pG5luc and one of psi-flag-Peptide 1, psi-flag-Peptide 2, psi-flag-Peptide 3, and psi-flag-Peptide 4 respectively. The five groups are as follows:

    [0162] A: HEK-293T cells (pACT-ASK1.sub.N+pBIND-ASK1.sub.N)+pG5luc

    [0163] B: HEK-293T cells (pACT-ASK1.sub.N+pBIND-ASK1.sub.N)+psi-flag-Peptide 1+pG5luc

    [0164] C: HEK-293T cells (pACT-ASK1.sub.N+pBIND-ASK1.sub.N)+psi-flag-Peptide 2+pG5luc

    [0165] D: HEK-293T cells (pACT-ASK1.sub.N+pBIND-ASK1.sub.N)+psi-flag-Peptide 3+pG5luc

    [0166] E: HEK-293T cells (pACT-ASK1.sub.N+pBIND-ASK1.sub.N)+psi-flag-Peptide 4+pG5luc

    [0167] After the transfection solutions are added, the cells are incubated at 37 C. for 24 hrs and then collected for Luciferase fluorescence assay.

    [0168] The results of fluorescence assay shown in FIG. 1. Group A (free of plasmid psi-flag-Peptide) shows normal N-terminal dimerization of ASK1, with the ratio of RLU value of firefly luciferase to RLU value of Renilla luciferase is about 1.9. In group B, the ratio of RLU value of firefly luciferase to RLU value of Renilla luciferase is significantly lower as compared with peptide-free group, indicating that Peptide1 inhibits N-terminal dimerization of ASK1. In group C, D, and E, there is no significant difference as compared with group A, indicating that Peptide 2, 3, 4 have no effect on N-terminal dimerization of ASK1.

    Example 2 Evaluation of Inhibitory Effect of Peptides on N-Terminal Dimerization of ASK1 by Immunoprecipitation Assay

    [0169] HEK-293T cells are divided into seven groups, named as groups A, B, C, D, E, F, and G. Among these groups, only vector HA-ASK1.sub.N or Myc-ASK1.sub.N is transfected into cells in groups A and B, both vectors HA-ASK1.sub.N and Myc-ASK1.sub.N are transfected into cells in groups C, D, E, F, and G, and positive cells are screen after 48 h incubation. The obtained cells are as follows:

    [0170] Group A: HEK-293T cells (HA-ASK1.sub.N)

    [0171] Group B: HEK-293T cells (Myc-ASK1.sub.N)

    [0172] Groups C, D, E, F, and G: HEK-293T cells (HA-ASK1.sub.N+Myc-ASK1.sub.N)

    [0173] Then the transient transfection of target peptide plasmids is performed, only an equal amount of transfection buffer free of target peptide plasmid is added to the cells in groups A, B, and C respectively, and transfection buffer containing plasmid psi-flag-Peptide1, psi-flag-Peptide2, psi-flag-Peptide3 or psi-flag-Peptide4 is added to the cells in groups D, E, F, and G respectively, that is, the seven groups are as follows:

    [0174] Group A: HEK-293T cells (HA-ASK1.sub.N)

    [0175] Group B: HEK-293T cells (Myc-ASK1.sub.N)

    [0176] Group C: HEK-293T cells (HA-ASK1.sub.N+Myc-ASK1.sub.N)

    [0177] Group D: HEK-293T cells (HA-ASK1.sub.N+Myc-ASK1.sub.N)+psi-flag-Peptide 1

    [0178] Group E: HEK-293T cells (HA-ASK1.sub.N+Myc-ASK1.sub.N)+psi-flag-Peptide 2

    [0179] Group F: HEK-293T cells (HA-ASK1.sub.N+Myc-ASK1.sub.N)+psi-flag-Peptide 3

    [0180] Group G: HEK-293T cells (HA-ASK1.sub.N+Myc-ASK1.sub.N)+psi-flag-Peptide 4

    [0181] The cells are harvested after 24 hrs transfection and subjected to immunoprecipitation assay for evaluating the effect of the target peptide on N-terminal dimerization of ASK1. In Western blot assay, the primary antibodies used: HA (Sigam, #H6908), Myc (MBL, #M192-3), Flag (Sigma, #F3165), the secondary antibodies used: HRP AffiniPure Goat Anti-Rabbit IgG (H+L) (Jackson, #111-035-003), Biotin AffiniPure Goat Anti-Mouse IgG (H+L) (Abbkine, A21210).

    [0182] During immunoprecipitation assay, protein A/G agarose beads are bound with HA-ASK1.sub.N in the cell lysates via HA antibody. In the case of normal N-terminal dimerization of ASK1, HA-ASK1.sub.N and Myc-ASK1.sub.N are contained in the protein solution obtained from immunoprecipitation, causing two stripes of HA-ASK1.sub.N and Myc-ASK1.sub.N shown in the Western blot pattern. In the case of inhibited N-terminal dimerization of ASK1, the content of Myc-ASK1.sub.N is significantly reduced, even to be undetectable.

    [0183] The results of Western blotting shown in FIG. 2 indicates that groups B-G show normal same expression level of Myc-ASK1.sub.N in the cells, groups D-G show same expression level of different peptides in the cells. After immunoprecipitation, the results of Western blotting indicate that group A shows a clearly visible strip of HA-ASK1.sub.N, group B shows no obvious strips, group C shows two clearly visible strips, groups E, F, and G show the same result with group C, showing no inhibition of N-terminal dimerization of ASK1. While group D shows significantly weakened strip of Myc-ASK1.sub.N in the case of Peptide1 involved, with strip of HA-ASK1.sub.N being unchanged, further indicating that Peptide1 can inhibit N-terminal dimerization of ASK1.

    Example 3 Inhibition of ASK1-JNK1 Signaling Pathway by Inhibiting N-Terminal Dimerization of ASK1

    [0184] The effect of inhibited N-terminal dimerization of ASK1 on intracellular JNK1 signaling pathway is evaluated by Western blot assay. The primary antibodies required: p-ASK1 (Cell Signaling Technology, #3765), ASK1 (GeneTex, #GTX107921), p-MKK7 (Aviva Systems Biology, #OAAF05547), MKK7 (Cell Signaling Technology, #4172), p-JNK1 (NOVUS, #NB100-82009), JNK1 (Abcam, #ab199380), Flag (Sigma, #F3165); the secondary antibodies required: HRP AffiniPure Goat Anti-Rabbit IgG (H+L) (Jackson, #111-035-003), Biotin AffiniPure Goat Anti-Mouse IgG (H+L) (Abbkine, A21210).

    [0185] L02 cells are divided into five groups (numbered as groups A, B, C, D, and E) and cultured at 37 C. until the cell density reaches to 70%. Cells in Group A are transfected with plasmid psi-flag, to serve as a control. Cells in Group B, C, D, and E are transfected with plasmid psi-Flag-Peptides 1, 2, 3, or 4 respectively. After 24 hrs incubation, a palmitate (PA) is added to culture medium of each group and incubate for 1 h, BSA is served as a control. Cells are collected for Western blot to assay the changes in the expression of individual proteins involved in intracellular ASK1-JNK1 signaling pathway. As shown in FIG. 3, the results show that there is no significant change in the expression level of Flag protein in each group, indicating that the expression levels of different peptides are substantially consistent. Among the groups, group B shows no significant increase of expression level of proteins p-ASK1, p-MKK7, and p-JNK1 compared with the BSA control, that is, the inhibition of N-terminal dimerization of ASK1 can inhibit the phosphorylation of ASK1, MKK7 and JNK1 and inhibit ASK1-JNK1 signaling pathway.

    Example 4 Effects of Promoting Cell Lipid Metabolism and Inhibiting Steatohepatitis by Inhibiting N-Terminal Dimerization of ASK1

    [0186] L02 cells are divided into five groups (numbered as groups A, B, C, D and E). Cells in Group A are transfected with plasmid psi-flag, serving as a control, and cells in Group B, C, D and E are transfected with plasmids psi-Flag-Peptides1, psi-Flag-Peptides2, psi-Flag-Peptides3 or psi-Flag-Peptides4, respectively. After 24 hrs incubation, PA is added to culture medium and incubate for 12 h, BSA is served as a control (Ctl). Then oil red O staining is performed, and the content of intracellular triglyceride is detected using a triglyceride assay kit (colorimetry) (Cayman, 10010303). The relative values of intracellular triglyceride content of other groups are calculated on the basis of setting the content of intracellular triglyceride in BAS control cells of Group A as 1. The procedure of oil red O staining comprises the following steps:

    [0187] (1) washing the sample group and control group with 1PBS twice, and fixing with 300 L 3% paraformaldehyde for 20 min;

    [0188] (2) washing with 1PBS twice, and rinsing with 60% isopropanol for 10 s;

    [0189] (3) washing with 1PBS twice, and blow-drying in a ventilating cabinet;

    [0190] (4) adding 500 L oil red O stain in each well and staining for 1 h;

    [0191] (5) washing with 1PBS twice, fractioning with 60% isopropanol and washing again with 1PBS twice; detecting under a microscope and imaging;

    [0192] As shown in FIGS. 4A-4B (FIG. 4A is an oil red O staining graph), a lot of cells in Group A are stained in red, indicating that after PA exposure for 12 h, there is obvious lipid deposition in the cells; The results of cell staining of Group C, D and E are similar to Group A, showing a large area of red stained cells in each group. While in Group B, in the case of Peptide1 expression in cells, there are less oil red O stained cell and smaller staining area in cells after PA exposure for 12 h. As shown in FIG. 4B (a view of detection results of intracellular relative triglyceride content), the contents of intracellular triglyceride in the BSA-treated controls are lower, and there is no significant difference in triglyceride content among the five groups. However, after 12 h PA treatment, the contents of intracellular triglyceride are significantly increased as compared with the controls of each group, and the increase in content of intracellular triglyceride of Flag-Peptide1-transfected Group B is smallest as compared with other groups. The results indicate that Peptide1 can inhibit steatosis of liver cells by inhibiting N-terminal dimerization of ASK1, and N-terminal dimerization of ASK1 is significant in the screening of drugs against steatohepatitis and can be used as a potential therapeutic target for treatment of steatohepatitis disorders.

    Example 5 Construction of Cynomolgus Monkey Model of AAV8-Peptide1-Mediated Liver Over-Expression of Peptide1

    [0193] Cynomolgus monkeys are given an AAV8-Peptide1 vector by portal venous injection, for over-expression of Peptide1 in the liver.

    [0194] Cynomolgus monkeys are fed with a high-fat diet (provided by Beijing Huafukang bioscience Co. Ltd., batch No. #5043, calorie ingredients: proteins: 17.86%, carbohydrates: 58.8%, fats: 22.34%) for 2 d, and then randomly divided into three groups (6-8 monkeys each group) that are injected with AAV8-GFP-Peptide1, AAV8-GFP and normal saline, respectively. Portal vein injection requires laparotomy, with preoperative fasting 10-14 hrs and water deprivation 6 h. Before surgery, monkeys receive intramuscular injection of atropine 0.05 mg/kg (for reducing gland secretion during surgery) and about 10 min later, receive intramuscular injection of Shumianning II 0.1 ml/kg. After anesthetization, the monkeys undergo body weighing and skin preparation, are fixed in supine position on an operating table and connected with an ECG monitor for monitoring blood oxygen saturation, blood pressure and heart rate. The abdominal cavity is opened by cutting along the middle line of abdomen, the portal vein is captured and then injected slowly with 1 ml of a buffer solution containing an AAV8-GFP-Peptide1 vector (titer of 5.88E+08 Tu/ml, serotype AAV2/8). Pressed with sterile gauzes for bleeding stopping, followed by suturing after determination of no bleeding. Penicillin (4 million units) is administered by intravenous drip infusion for infection control. The abdominal cavity is closed layer by layer, and the bellyband is worn for preventing postoperative excessive tension of incision and reducing intraperitoneal bleeding (AAV8-GFP group and normal saline group are injected with equal volumes of normal saline containing AAV8-GFP virus and normal saline, respectively, and investigated in the same way as AAV8-GFP-Peptide1 group). After high fat-feeding for 20 weeks, tissues are collected by needle biopsy, for immunofluorescence assay and Western blot assay of adeno-associated virus-mediated overexpression of Peptide1

    [0195] Cynomolgus monkeys are fed with a high fat-diet #5043 and 150 g fruits every day for 30 weeks. All animals are given water.

    Example 6 Inhibition of Incidence of Steatohepatitis Due to High Fat-Feed by Over-Expression of Peptide1 in Liver of Cynomolgus Monkeys

    [0196] The physiological indices of the experiment monkeys are detected every two weeks, including body weight, body temperature, breathing, heart rate, blood pressure, waist measurement, hip measurement, sitting height, etc. Abdominal ultrasonography is performed every four weeks. Blood samples (5 ml) are collected at Week 0 and Week 30 and subjected to serum separation, followed by detection of fasting serum lipid levels (triglyceride, total cholesterol, high-density lipoprotein and low-density lipoprotein) and liver functions (ALT, AST). The liver tissues are collected by needle biopsy, for fluorescence assay of GFP and Western blot assay of adeno-associated virus-mediated overexpression of Peptide1.

    [0197] 1. Fluorescence Assay and Western Blot Assay of Liver Tissues

    [0198] Liver tissue frozen-slices are prepared and then observed under a fluorescence microscope for detecting green fluorescence intensity of GFP, to determine the efficiency of adeno-associated virus infection. Western blot assay of liver tissues is performed to detect the expression of Peptide1 in liver tissues.

    [0199] (1) Liver Tissue Frozen-Slices

    [0200] The tissues collected by biopsy are embedded in a freezing machine, and sliced (5 m thick) after the embedding operation is completed, and the tissue slices are attached onto glass slides. The obtained frozen-slices are observed under a fluorescence microscope for detection of green fluorescence intensity.

    [0201] (2) Western Blot Assay of Peptide1 Expression

    [0202] 1) Protein Extraction

    [0203] a. A liver tissue sample is collected under 80 C. temperature condition, and put in dry ice. 3-4 steel beads are put in each EP tube, and then the tubes are put in dry ice for pre-cooling. The sample is cut with ophthalmic scissors, the sample pieces are loaded to corresponding EP tubes, and the weight of the sample in each tube is recorded.

    [0204] b. A lysis buffer is mixed with PMSF, and then a certain amount of the mixture is added to the samples and mixed evenly.

    [0205] c. The samples are ground in a pre-cooled grinding machine adapter at 80 C., with the grinding parameter settings of 30 Hz/s, 90 s.

    [0206] d. After the grinding operation is completed, the samples are put on ice for 10 min, and the steel beads are removed.

    [0207] e. The samples are lysed using an ultrasonic lysis device at 5 KHz each time, is each time, every 1 second, over 10 times. After the ultrasonic lysis is completed, the samples are put on ice for 10 min.

    [0208] f. The samples are centrifuged in a centrifuge (pre-cooled at 4 C.) under 12000 rpm/min at 4 C. for 30 min

    [0209] g. The supernatants are transferred to other EP tubes, and then centrifuged under 14000 rpm/min at 4 C. for 10 min.

    [0210] h. The supernatants are transferred to other EP tubes, and then centrifuged under 14000 rpm/min at 4 C. for 5 min. The supernatants are collected and finely metered using BCA Protein Assay Kit (Pierec, 23225).

    [0211] 2) According to the preceding steps, an SDS-PAGE gel column is prepared and loaded with the samples, followed by electrophoresis, membrane transfer, blocking, antibody incubation and protein detection. In the experiment, the primary antibody used is anti-Flag (Sigma, #F3165), and the secondary antibody is Biotin AffiniPure Goat Anti-Mouse IgG (H+L) (Abbkine, A21210).

    [0212] 2. Physiological and Biochemical Index Detection

    [0213] (1) Physiological Index Detection

    [0214] Monkeys are fasted 10-14 hrs with water deprivation for 6 h and then anesthetized by intramuscular injection of 10 mg/kg ketamine hydrochloride, and the above physiological indices are detected and the related experiment data are recorded.

    [0215] (2) Biochemical Index Detection

    [0216] Monkeys are fasted 10-14 hrs with water deprivation for 6 h before experiment, and anesthetized by intramuscular injection of 10 mg/kg ketamine hydrochloride, 5 ml blood samples are collected intravenously, and the samples are subjected to serum separation and delivered to Wuhan DiAn Diagnostics Company for detection of lipids contents and enzyme activities.

    [0217] 3. Liver Tissue Pathological Staining Related Experiments

    [0218] Frozen slices and paraffin slices are prepared and subjected to oil red O staining and HE staining.

    [0219] (1) Dehydration, Vitrification and Paraffin Embedding of Liver Organ

    [0220] A liver tissue sample obtained by living biopsy is soaked in formaldehyde for fixation, a part of the well-fixed liver tissue sample is put in an embedding frame and washed with a small flow of flowing water for more than 30 min. The machine is set according to the following process: 1) dehydration: 75% ethanol (45 min).fwdarw.75% ethanol (45 min).fwdarw.85% ethanol (45 min).fwdarw.85% ethanol (45 min).fwdarw.95% ethanol (45 min).fwdarw.95% ethanol (45 min).fwdarw.anhydrous alcohol (1 h).fwdarw.anhydrous alcohol (1 h); 2) vitrification: xylene (1 h).fwdarw.xylene (1 h); 3) paraffin embedding (65 C.): paraffin (1 h).fwdarw.paraffin (1 h). After the tissues are completely rinsed, the tissue embedding frame containing the tissues is put in the basket of the machine, and the above process is initiated. After the above procedures are completed, the tissues are embedded.

    [0221] (2) Liver Tissue Slices

    [0222] The liver tissue slices are prepared using a microtome (slice thickness of 5 m).

    [0223] (3) Hematoxylin-Eosin (HE) Staining of Liver Tissues

    [0224] Put liver tissue paraffin slices in an oven at 65 C. (30 min).fwdarw.xylene (5 min3 times).fwdarw.100% ethanol (1 min).fwdarw.90% ethanol (1 min).fwdarw.70% ethanol (1 min).fwdarw.washing with distilled water.fwdarw.hematoxylin (5 min).fwdarw.washing with tap water to remove excessive stains on the slices.fwdarw.1% hydrochloric acid ethanol solution (1-3 s).fwdarw.washing with tap water for several times.fwdarw.Scott bluing solution (sodium bicarbonate 0.35 g, magnesium sulfate 2 g, distilled water 100 ml) (1 min).fwdarw.washing with tap water for several times.fwdarw.Eosin dye (1 min).fwdarw.washing with distilled water to remove excessive stains on the slices.fwdarw.70% ethanol once.fwdarw.90% ethanol once.fwdarw.100% ethanol (30 s3 times).fwdarw.xylene (2 min3 times).fwdarw.sealing before xylene volatiles to dry and imaging.

    [0225] (4) Oil Red O Staining of Liver Tissues

    [0226] 1) Frozen liver tissue slices are air-dried for 30 min in a ventilating cabinet, and fixed with 4% paraformaldehyde for 10 min. The slices are soaked in double distilled water and washed for 10 min, to remove paraformaldehyde from tissue surface.

    [0227] 2) The slices are treated with 60% isopropanol for 1 min.

    [0228] 3) The slices are stained with oil red O (sigma, No. 00625, concentration of 0.5 g/100 ml 100% isopropanol) for 30 min.

    [0229] 4) Then the slices are rinsed with 60% isopropanol for 1 min for three times until the background is clean.

    [0230] 5) The slices are treated with Mayer's hematoxylin stain (5 droplets) for cell nucleus staining.

    [0231] 6) The slices are rinsed with water, then treated with diluted lithium carbonate aqueous solution and fully washed with water until blueness color of cell nuclei.

    [0232] 7) The slices are sealed with glycerogelatin for imaging.

    [0233] 4. Tests

    [0234] The results of fluorescence assay are shown in FIG. 5A. The liver tissues of monkeys in AAV8-GFP group and AAV8-Peptide1 group are found obvious green fluorescence under a fluorescence microscope, and there is no significant difference in fluorescence intensity between the two groups, indicating that the transfection rates of AAV8 vector in the monkey liver tissues of the two groups are the same. The results of Western blot are shown in FIG. 5B, AAV8-GFP group has no strips in Western blot pattern, indicating that the expression of Peptide1 is not found, while AAV8-Peptide1 group has obvious strips, indicating that the expression of Peptide1 peptide in the liver tissues of monkeys of AAV8-Peptide1 portal vein injection groups is significant.

    [0235] The data of body weight and BMI of the monkeys are shown in FIGS. 6A-6B. The Cynomolgus monkeys in AAV8-GFP group and AAV8-GFP-Peptide1 group are fed on a high-fat feed for 30 weeks from the beginning of experiment, there is no significant difference in body weight and BMI between the two groups (FIGS. 6A-6B).

    [0236] The detection results of blood lipids, ASL and AST are shown as FIGS. 7A-7F. After 30-week high-fat feeding, the level of serum triglyceride of the monkeys in AAV8-GFP-Peptide1 group is significantly lower than that of AAV8-GFP control group (FIG. 7A); there is no significant difference in serum total cholesterol between the two groups (FIG. 7B), while the level of serum high density cholesterol of AAV8-GFP-Peptide1 group is higher than that of AAV8-GFP group (FIG. 7C), and the level of low density cholesterol of AAV8-GFP-Peptide1 group is lower than that of AAV8-GFP group (FIG. 7D). There is no significant difference in AST level between the two groups, while the level of ALT of AAV8-GFP-Peptide1 group is significantly lower than that of AAV8-GFP group (FIG. 7E and FIG. 7F). These results indicate that Peptide1 peptide inhibits progression of liver dysfunction caused by high-fat diet and incidence of steatohepatitis.

    [0237] The pathological findings of liver tissues, as shown as FIG. 8, show that after 30 week high-fat feeding, the liver slices of monkeys of AAV8-GFP group appear obvious vacuolar and confluent and destructed liver cells under observation after HE staining, and vacuolization in AAV8-GFP-Peptide1 group is significantly reduced compared with that in AAV8-GFP group (FIG. 8). The results of oil red O staining show that a large red area is found around the hepatic portal vein of monkeys of AAV8-GFP group, indicating massive lipid accumulation, while in AAV8-GFP-Peptide1 group, the red area is significantly reduced, and the lipid accumulation is reduced (FIG. 8, lower portion). The pathological staining results show that over-expression of Peptide1 significantly reduces high-fat diet-induced liver steatosis and liver lipid accumulation in Cynomolgus monkeys. Peptide1 can inhibit the incidence of steatohepatitis in Cynomolgus monkeys.

    [0238] The above results indicate that over-expression of Peptide1 can significantly alleviate HFD-induced steatohepatitis. Peptide1 has obvious effect on improving steatohepatitis. Peptide1 shows potential as a novel drug against steatohepatitis.

    [0239] Unless otherwise indicated, the numerical ranges involved in the invention include the end values. While particular embodiments of the invention have been shown and described, it will be obvious to those skilled in the art that changes and modifications may be made without departing from the invention in its broader aspects, and therefore, the aim in the appended claims is to cover all such changes and modifications as fall within the true spirit and scope of the invention.