Compositions and methods for vaccination against influenza A virus

09981034 ยท 2018-05-29

Assignee

Inventors

Cpc classification

International classification

Abstract

Disclosed herein are compositions and methods useful for immunizing a subject against disease caused by influenza A. Disclosed methods comprise administering to the subject an immunoprotective dose of an immunogenic composition. In certain aspects, the immunogenic composition is a vaccine comprised of a recombinant chimeric hemagglutinin polypeptide. In certain aspects, the subject is a mammal. In further aspects, the mammal is a pig. In still further aspects, the mammal is a human.

Claims

1. An immunogenic composition comprising a polypeptide comprising the sequence of SEQ ID NO 8.

2. The immunogenic composition of claim 1, wherein the immunogenic composition is a recombinant polypeptide.

3. The immunogenic composition of claim 2, further comprising a vector.

4. The immunogenic composition of claim 3, wherein the vector further comprises a virus backbone.

5. The immunogenic composition of claim 4, wherein the virus backbone is PR8.sub.LAIV or TX98.

6. The immunogenic composition of claim 4, wherein the virus backbone is a non-influenza virus.

7. The immunogenic composition of claim 6, wherein the virus backbone is retrovirus, lentivirus, adenovirus, adeno-associated virus, or parainfluenza virus.

8. The immunogenic composition of claim 3, further comprising an adjuvant.

9. The immunogenic composition of claim 3, further comprising a pharmaceutically acceptable carrier.

10. A method of immunizing a subject against disease caused by influenza A comprising administering to the subject an immunoprotective dose of an immunogenic composition, wherein the immunogenic composition comprises: a polypeptide comprising the sequence of SEQ ID NO 8.

11. The method of claim 10, wherein the subject is a mammal.

12. The method of claim 11, wherein the mammal is a pig.

13. The method of claim 11, wherein the mammal is a human.

14. The method of claim 10, wherein the immunogenic composition is a recombinant polypeptide.

15. The method of claim 10, wherein the immunogenic composition further comprises a virus backbone.

16. The method of claim 14, wherein the virus backbone is a non-influenza virus.

17. The method of claim 16, wherein the non-influenza virus is a retrovirus, lentivirus, adenovirus, adeno-associated virus, or parainfluenza virus.

18. The method of claim 14, wherein the immunogenic composition is an attenuated virus.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) FIG. 1 shows a phylogenetic comparison of swine H1 influenza hemagglutinins, including those used to create chimeric HAs, according to certain embodiments.

(2) FIG. 2 shows a schematic diagram of DNA shuffled chimeric HA gene sequences, according to certain embodiments.

(3) FIG. 3 shows IgG antibody response in mice immunized with plasmid DNAs expressing chimeric HA, according to certain embodiments.

(4) FIG. 4A and FIG. 4B show comparison of growth kinetics of wild type virus with recombinant viruses expressing HA-129.

(5) FIG. 5 shows serum antibody HAI titers from mice infected with recombinant virus PR8.sub.LAIV-129.

(6) FIG. 6A and FIG. 6B show antibody reactivity against viruses expressing parental or non-parental HAs using serum samples from pigs immunized with the TX98-129 IIV.

(7) FIG. 7 shows alignment of the chimeric HAs with A/Ohio/01/2007 (H1N1) (SEQ ID NO 11).

(8) FIG. 8 shows alignment of the chimeric HAs with A/Tennessee/1-560/2009 (H1N1) (SEQ ID NO 10).

(9) FIG. 9 shows alignment of the chimeric HAs with A/New Jersey/8/76 (H1N1) (SEQ ID NO 12).

(10) FIG. 10 shows alignment of the chimeric HAs with A/Iowa/01/2006 (H1N1) (SEQ ID NO 13).

DETAILED DESCRIPTION

(11) A molecular breeding (DNA shuffling) strategy represents a novel approach to produce broadly protective vaccines. DNA shuffling is a process of random recombination of parental genes into novel genes, with shuffled (recombined) chimeric genes being selected for desired properties. The importance of this process is that molecular breeding by DNA shuffling of specific genes mimics the evolution pathway and accelerates the natural process of evolution for viruses, or viral proteins, in vitro. In the instant disclosure, molecular breeding technology was applied toward producing a broadly protective vaccine against influenza A virus in pigs. Since the viral surface glycoprotein HA has been the major target of most licensed influenza vaccines, we specifically targeted the HA from the 2009 pandemic virus, as well as HAs from three additional swine influenza viruses that had a history of zoonotic transmission to humans. These parental influenza A H1N1 strains represent four distinct phylogenetic clades, and HA genes of these four parental strains were used for DNA shuffling and screening to generate a panel of chimeric influenza HA antigens. One chimeric construct, HA-129, was further presented in the context of a traditional, whole virus vaccine backbone, and immune responses induced by this chimera were evaluated in both mice and pigs. The instantly disclosed results indicate chimeric HA antigens generated by DNA shuffling have potential applications as broadly protective influenza vaccines.

(12) A previous study reported that multiple, individual human influenza hemagglutinins (HAs), from the H3N2 subtype, could be delivered simultaneously to induce immunity that covered approximately 20 years of HA evolution. (See, Huber V C, et. al., A Multi-Valent Vaccine Approach that Elicits Broad Immunity Within an Influenza Subtype, 27 VACCINE 1192-1200 (2009)). This proof-of-concept approach showed that broad immunity can be achieved, within an influenza A virus subtype. However, delivery of distinct HAs by simultaneously inoculating with multiple whole virus preparations did not induce detectable antibody titers against all of the HAs included. Thus, improvement on this approach is needed.

(13) The following definitions and methods are provided to better define the invention and to guide those of ordinary skill in the art in the practice of the present invention. Unless otherwise noted, terms are to be understood according to conventional usage by those of ordinary skill in the relevant art.

(14) Ranges can be expressed herein as from about one particular value, and/or to about another particular value. When such a range is expressed, a further aspect includes from the one particular value and/or to the other particular value. Similarly, when values are expressed as approximations, by use of the antecedent about, it will be understood that the particular value forms a further aspect. It will be further understood that the endpoints of each of the ranges are significant both in relation to the other endpoint, and independently of the other endpoint. It is also understood that there are a number of values disclosed herein, and that each value is also herein disclosed as about that particular value in addition to the value itself. For example, if the value 10 is disclosed, then about 10 is also disclosed. It is also understood that each unit between two particular units are also disclosed. For example, if 10 and 15 are disclosed, then 11, 12, 13, and 14 are also disclosed.

(15) An immunogenic composition as used herein, means an antigenic component which elicits an immunological response in the host with a cellular and/or antibody-mediated immune response to such a component. Preferably, this immunogenic composition is capable of conferring protective immunity against infection against a selected pathogen and the clinical signs associated therewith. In some forms, immunogenic portions of the native virus in a killed or inactivated form are used as the antigenic component in such compositions.

(16) An individual or subject or animal, as used herein, refers to vertebrates that support a negative strand RNA virus infection, specifically influenza virus infection, including, but not limited to, birds (such as water fowl and chickens) and members of the mammalian species, such as canine, feline, lupine, mustela, rodent (racine, murine, etc.), equine, bovine, ovine, caprine, porcine species, and primates, the latter including humans. In a specific embodiment, the subject is a pig. In another embodiment, the subject is a human.

(17) As used herein, the term immunogenic means that the virus or polypeptide is capable of eliciting a humoral or cellular immune response, and preferably both. An immunogenic entity is also antigenic.

(18) The terms effective amount or pharmaceutically effective amount of an immunogenic composition of the present invention refer herein to a sufficient amount of the immunogenic composition to treat or diagnose a condition of interest. The exact amount required will vary from subject to subject, depending, for example, on the species, age, and general condition of the subject; the severity of the condition being treated; the particular antigen of interest; in the case of an immunological response, the capacity of the subject's immune system to synthesize antibodies, for example, and the degree of protection desired; and the mode of administration, among other factors. An appropriate effective amount in any individual case may be determined by one of ordinary skill in the art. Thus, a therapeutically effective amount will typically fall in a relatively broad range that can be determined through routine trials.

(19) The phrase pharmaceutically acceptable refers to molecular entities and compositions that are physiologically tolerable and do not typically produce an allergic or similar untoward reaction, such as gastric upset, dizziness and the like, when administered to a human. Preferably, as used herein, the term pharmaceutically acceptable means approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in animals, and more particularly in humans.

(20) As used herein, the terms administering and administration refer to any method of providing a pharmaceutical preparation to a subject. Such methods are well known to those skilled in the art and include, but are not limited to, oral administration, transdermal administration, administration by inhalation, nasal administration, topical administration, intravaginal administration, ophthalmic administration, intraaural administration, intracerebral administration, rectal administration, sublingual administration, buccal administration, and parenteral administration, including injectable such as intravenous administration, intra-arterial administration, intramuscular administration, and subcutaneous administration. Administration can be continuous or intermittent. In various aspects, a preparation can be administered therapeutically; that is, administered to treat an existing disease or condition. In further various aspects, a preparation can be administered prophylactically; that is, administered for prevention of a disease or condition.

(21) The term carrier refers to a diluent, adjuvant, excipient, or vehicle with which the compound is administered. Such pharmaceutical carriers can be sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. Water or aqueous saline solutions and aqueous dextrose and glycerol solutions are preferably employed as carriers, particularly for injectable solutions. Suitable pharmaceutical carriers are described in Remington's Pharmaceutical Sciences by E. W. Martin, 18.sup.th Edition.

(22) As used herein, the term adjuvant refers to a compound or mixture that enhances the immune response to an antigen. An adjuvant can serve as a tissue depot that slowly releases the antigen and also as a lymphoid system activator that non-specifically enhances the immune response (Hood, et al., Immunology, Second Ed., Menlo Park, Calif.: Benjamin/Cummings, 1984. p. 384). Often, a primary challenge with an antigen alone, in the absence of an adjuvant, will fail to elicit a humoral or cellular immune response. Adjuvants include, but are not limited to, complete Freund's adjuvant, incomplete Freund's adjuvant, saponin, mineral gels such as aluminum hydroxide, surface active substances such as lysolecithin, pluronic polyols, polyanions, peptides, oil or hydrocarbon emulsions, keyhole limpet hemocyanins, and potentially useful human adjuvants such as N-acetyl-muramyl-L-threonyl-D-isoglutamine (thr-MDP), N-acetyl-nor-muramyl-L-alanyl-D-isoglutamine, N-acetylmuramyl-L-alanyl-D-isoglutaminyl-L-alanine-2-(1-2-dipalmitoyl-sn-glycero-3-hydroxyphosphoryloxy)-ethylamine, BCG (bacille Calmette-Guerin), and Corynebacterium parvum. Preferably, the adjuvant is pharmaceutically acceptable.

(23) The terms killed or inactivated are used interchangeably herein and refer to a significant or complete reduction in the infectivity of the virus(es) utilized for preparation of the vaccine compositions. The killing or inactivation of the viruses may be evaluated according to any procedure known to those skilled in the art, for example, by molecular biology methods (PCR), methods for titration of the viral titer, fluorescence, immunological methods (ELISA, RIA and the like), or immunoenzymatic methods allowing the detection of one or more viral polypeptides (Western and the like). A number of different inactivating agents and means have been employed including formalin, azide, freeze-thaw, sonication, heat treatment, sudden pressure drop, detergent (especially non-ionic detergents), lysozyme, phenol, proteolytic enzymes, and beta-propiolactone.

(24) Identity, as known in the art, is a relationship between two or more polypeptide sequences or two or more polynucleotide sequences, as determined by comparing the sequences. In the art, identity also means the degree of sequence relatedness between polypeptide or polynucleotide sequences, as the case may be, as determined by the match between strings of such sequences. Identity and similarity can be readily calculated by known methods, including but not limited to those described in Computational Molecular Biology, Lesk, A. M., ed., Oxford University Press, New York, 1988; Biocomputing: Informatics and Genome Projects, Smith, D. W., ed., Academic Press, New York, 1993; Computer Analysis of Sequence Data, Part I, Griffin, A. M., and Griffin, H. G., eds., Humana Press, New Jersey, 1994; Sequence Analysis in Molecular Biology, von Heinje, G., Academic Press, 1987; Sequence Analysis Primer, Gribskov, M. and Devereux, J., eds., M Stockton Press, New York, 1991; and Carillo, H., and Lipman, D., SIAM J. APPLIED MATH., 48:1073 (1988). Preferred methods to determine identity are designed to give the largest match between the sequences tested. Methods to determine identity and similarity are codified in publicly available computer programs. Preferred computer program methods to determine identity and similarity between two sequences include, but are not limited to, the GCG program package (Devereux, J., et al 1984), BLASTP, BLASTN, and FASTA (Altschul, S. F., et al., 1990). The BLASTX program is publicly available from NCBI and other sources (BLAST Manual, Altschul, S., et al., NCBI NLM NIH Bethesda, Md. 20894; Altschul, S., et al., 1990). The well-known Smith Waterman algorithm may also be used to determine identity.

(25) By way of example, without intending to be limited thereto, an amino acid sequence of the present invention may be identical to the reference sequences SEQ ID NOS: 1-9; that is be 100% identical, or it may include a number of amino acid alterations as compared to the reference sequence such that the % identity is less than 100%. Such alterations are selected from the group consisting of at least one amino acid deletion, substitution, including conservative and non-conservative substitution, or insertion, and wherein the alterations may occur at the amino- or carboxy-terminal positions of the reference polypeptide sequence or anywhere between those terminal positions, interspersed either individually among the amino acids in the reference sequence or in one or more contiguous groups within the reference sequence. The number of amino acid alterations for a given % identity is determined by multiplying the total number of amino acids in SEQ ID NOS:1-9 by the numerical percent of the respective percent identity (divided by 100) and then subtracting that product from said total number of amino acids in any of SEQ ID NOS: 1-9, or:
n.sub.a=X.sub.a(X.sub.a.Math.Y),
wherein n.sub.a is the number of amino acid alterations, X.sub.a is the total number of amino acids in SEQ ID NOS: 1-9, and Y is, for instance 0.70 for 70%, 0.80 for 80%, 0.85 for 85% etc., and wherein any non-integer product of X.sub.a and Y is rounded down to the nearest integer prior to subtracting it from X.sub.a.

(26) In preferred embodiments, the polypeptide above is selected from the proteins set forth in the SEQ ID NOS 1-9.

(27) Disclosed herein is an immunogenic composition comprising a polypeptide having at least 90% sequence identity to SEQ ID NOs 1-9. According to certain aspects, the immunogenic composition is a recombinant polypeptide. In certain aspects, the immunogenic composition comprises a polypeptide having at least 90% sequence identity to SEQ ID NO 8. In further aspects, the immunogenic composition further comprises a vector. In still further aspects, the vector further comprises a virus backbone. In yet further aspects, the virus backbone is PR8.sub.LAIV or TX98.

(28) According to certain embodiments, the vector is a non-influenza virus. Exemplary non-influenza virus vectors include, but are not limited to, retrovirus, lentivirus, adenovirus, adeno-associated virus, parainfluenza virus, or other virus vectors known in the art to be suitable for the delivery of recombinant proteins.

(29) According the certain aspects, the disclosed immunogenic composition further comprises an adjuvant. In yet further aspects, the immunogenic composition further comprises a pharmaceutically acceptable carrier.

(30) Disclosed herein is a method of immunizing a subject against disease caused by influenza A comprising administering to the subject an immunoprotective dose of an immunogenic composition, wherein the immunogenic composition comprises a polypeptide having at least 90% sequence identity to SEQ ID NO 1-9. According to certain aspects, the immunogenic composition comprises a polypeptide having at least 90% sequence identity to SEQ ID NO 8.

(31) In certain aspects, the subject is a mammal. In further aspects, the mammal is a pig. In still further aspects, the mammal is a human.

(32) According to certain aspects, the immunogenic composition is administered at a therapeutically effective amount. In further aspects, the immunogenic composition is administered at a prophylactically effective amount.

(33) In still further aspects, the immunogenic composition further comprises a virus backbone. In yet further aspects, the immunogenic composition is an attenuated virus. In further aspects, the immunization elicits immune response against , , , and pandemic strains of classical swine virus.

EXAMPLES

(34) The following examples are put forth so as to provide those of ordinary skill in the art with a complete disclosure and description of certain examples of how the compounds, compositions, articles, devices, and/or methods claimed herein are made and evaluated, and are intended to be purely exemplary of the invention and are not intended to limit the scope of what the inventors regard as their invention. However, those of skill in the art should, in light of the present disclosure, appreciate that many changes can be made in the specific embodiments which are disclosed and still obtain a like or similar result without departing from the spirit and scope of the invention.

Materials and Methods

(35) Parental HA Genes and Viral Strains

(36) The HA genes of the four parental H1N1 influenza A viruses A/Tennessee/1-560/09 (TN09; CY040457.1), A/New Jersey/8/1976 (NJ76; CY130118.1), A/Ohio/01/2007 (OH07; FJ986620.1), and A/Iowa/01/2006 (IA06; FJ986618.1) were amplified by RT-PCR from stock viruses using the Bm-HA-1F (TATTCGTCTCAGGGAGCAAAAGCAGGGG) (SEQ ID NO 14) and Bm-NS-890R (ATATCGTCTCGTATTAGTAGAAACAAGGGTGTTTT) (SEQ ID NO 15) primers as described [26,27]. The PCR products were cloned in pHW2000 plasmid using BsmBI restriction enzyme sites [28]. Additional H1N1 influenza A virus strains that were tested to demonstrate cross reactivity include A/North Carolina/18161/2002 (NC02; CY098516.1), A/swine/Iowa/i/1985 (IA85; CY022317.1), A/swine/Iowa/40766/1992 (IA92; KP788773), A/swine/Germany/2/1981 (GE81; Z30276.1), and A/New Caledonia/20/99 (NC99; CY125100.1).

(37) DNA Shuffling of HA Genes

(38) The DNA shuffling of HA genes was performed as described by Soong et al [29] with minor modifications. Briefly, DNA products of HA genes from the four parental strains (TN09, NJ76, OH07, and IA06) were mixed equimolarly and digested with DNase I. The DNA fragments were assembled as described previously [23], and the reassembled fragments were amplified by PCR using the Bm-HA-1F (TATTCGTCTCAGGGAGCAAAAGCAGGGG) (SEQ ID NO 14) and Bm-NS-890R (ATATCGTCTCGTATTAGTAGAAACAAGGGTGTTTT) (SEQ ID NO 15) primers. The PCR products were cloned into the pHW2000 plasmid to establish the chimeric HA library.

(39) Creation and Characterization of HA-Expressing Virus Reassortants

(40) The 8-plasmid reverse genetics system, incorporating co-cultured 293T (American Type Culture Collection, Manassas, Va.) and MDCK (ATCC) cells, was used to create reassortant viruses in this study [27]. For viruses expressing the cloned parental HA genes from TN09, OH07, NJ76, or IA06, the viruses were created using reverse genetics, with each HA incorporated into a reassortant virus that derived the 7 other influenza virus genes from the A/Puerto Rico/8/34 (PR8) donor virus [30,31]. Viruses rescued from 293T:MDCK cell co-cultures that expressed the desired HA were propagated in 10-day-old embryonated chicken eggs for 72 h at 35 C. and sequenced to verify appropriate HA genotype. Similarly, when expressing the chimeric HA construct, HA-129, within influenza viruses for vaccine creation, we used the attenuated PR8 (PR8.sub.LAIV) backbone for generating a candidate vaccine in mouse (PR8.sub.LAIV-129), while the A/swine/Texas/4199-2/98 swine reverse genetics system was used for generating a candidate inactivated influenza virus (IIV) vaccine in pigs (TX98-129) [32].

(41) Viruses (PR8.sub.LAIV-129) rescued on the PR8.sub.LAIV backbone were propagated in 10-day-old embryonated chicken eggs for 72 h at 33 C., as described previously [13,33], and the TX98-129 virus was propagated for 72 h at 35 C. The growth characteristics of these viruses were determined using MDCK cells as previously described [34]. Briefly, MDCK cell monolayers (310.sup.5 cells per well) were inoculated with influenza viruses in the presence of TPCK-trypsin [34], and at indicated times, amounts of virus present were tested using standard methods for calculating the median tissue culture infectious dose (TCID.sub.50) of influenza viruses [35].

(42) Mice and Immunization

(43) Adult (6-8-week-old) female BALB/cJ mice were obtained from Harlan Laboratories (Indianapolis, Ind.) and housed in groups of four, with 24-hour access to food and water. All animal experiments were performed following the guidelines established and approved by the Animal Care and Use committee at the University of South Dakota (Vermillion, S. Dak.). For DNA immunization, plasmid DNA was coupled to gold particles as described previously [36], and administered directly to the mouse abdomen, using a Helios gene gun (Bio-Rad Laboratories, Hercules, Calif.). Mice were boosted twice with a 3-week interval between inoculations. Three weeks after the third inoculation, sera were collected and analyzed by ELISA. For whole virus vaccination, mice that were lightly anesthetized with 2.5% isoflurane were inoculated with 110.sup.5 TCID.sub.50 PR8.sub.LAIV-129 in a 50 l volume, and boosted with 110.sup.5 TCID.sub.50 PR8.sub.LAIV-129 at 28 days post inoculation (dpi). Sera were collected at 21 days after the second inoculation with whole virus. To inactivate host innate immune inhibitors of influenza virus, sera were treated with receptor-destroying enzyme (RDE, Accurate Chemical, Westbury, N.Y.) and heat-inactivated as described previously [37].

(44) Antibody detection by ELISA

(45) Serum antibodies were detected using an ELISA, as described previously [13]. Briefly, 96-well flat bottom plates (NUNC, Thermo Fisher Scientific) were coated with concentrated, formalin-inactivated parental viruses (1 g HA mL.sup.1). RDE-treated sera were serially diluted in phosphate buffered saline (PBS) containing 10% fetal bovine serum (FBS) (Atlanta Biologicals, Lawrenceville, Ga.) and 0.05% (v/v) Tween-20 (Sigma, St. Louis, Mo.) (FBS-PBST). Alkaline phosphatase-conjugated preparations of goat anti-mouse IgG (-specific) antibodies (Southern Biotechnology, Inc., Birmingham, Ala.), diluted in FBS-PBST, were added to the plate. Plates were washed, and 1 mg mL.sup.1 p-nitrophenyl phosphate substrate (Sigma, St. Louis, Mo.) in diethanolamine buffer was added. One hour after substrate addition, the OD was detected at 405 nm using a BioTek EL808 plate reader (BioTek Instruments, Inc.). Reciprocal serum antibody titers for individual sera are reported at 50% maximal binding on the individual titration curves. Individual sera were considered positive only if their starting dilution OD.sub.405 values were greater than 3 times the OD.sub.405 of negative control sera.

(46) Hemagglutination Inhibition and Microneutralization Assays

(47) Hemagglutination inhibition (HAI) assays were performed as described previously [37]. Briefly, RDE-treated sera were diluted serially, and four HA units of virus were added to each well. The virus:sera mixtures were incubated for one hour at 4 C., and a 0.5% solution of chicken red blood cells (Lampire Biological Laboratories, Pipersville, Pa.) was added to each well. Titers are reported as the reciprocal of the final serum dilution that inhibited hemagglutination. Similarly, microneutralization (MN) assays were performed as previously described [34,37], using 100 TCID.sub.50 for each virus inoculated onto confluent MDCK monolayers. Infected MDCK cells were identified using monoclonal antibodies against the influenza A virus nucleoprotein, with a titer defined as the last dilution that inhibited detection of NP below 50% of the OD.sub.490 for positive control wells, as described previously [38,39]. For both HAI and MN assays, serum samples that did not show a detectable titer at the starting serum dilution of 1:10 were assigned a titer of 5 for the purpose of both graphing and statistical analyses.

(48) Nursery Pig Study

(49) Nursery pigs (3 weeks old) that were free of swine influenza virus, porcine reproductive and respiratory syndrome virus, and Mycoplasma hyopneumoniae were obtained. They were randomly divided into three groups, and housed separately in animal isolation facilities at South Dakota State University (SDSU). In contrast to the murine model, live influenza virus was not given to pigs, due to biosafety considerations. Therefore, TX98-129 virus was formalin-inactivated as described previously [40], and pigs were immunized intramuscularly with 100 g/ml of inactivated virus in a 2 mL volume. As a negative control, a group of unvaccinated pigs were inoculated with a similar volume of PBS. Fourteen days after primary inoculation, pigs were boosted with the same dose of antigen, and sera were collected at 14 days post-secondary inoculation.

(50) Data Analysis

(51) DNASTAR and MEGA4 were used for sequence alignment and phylogenetic analysis. Table 1 lists all the influenza virus strains from which HA genes were used for constructing the phylogenetic tree. Analysis of HA chimeras created by DNA shuffling was performed by using the Salanto method (https://bitbucket.org/benderc/salanto/wiki/Home). Two way analysis of variance and nonparametric Mann Whitney tests were used to analyze the data. Significant differences between groups were evaluated using Bonferroni post-tests. All statistical analyses were performed using either JMP 5.1 (SAS Institute, Cary, N.C.) or GraphPad Prism version 4.00 for Windows (GraphPad Software, San Diego Calif. USA, www.graphpad.com).

Results

(52) Construction and Screening of Chimeric HA Genes

(53) As shown in FIG. 1, based on the phylogenetic analysis of influenza A H1 HA genes, four distinct parental influenza virus strains were selected for generating chimeric HA constructs. Specifically, the selection consisted of A/Tennessee/1-560/2009 (TN09; 2009 human pandemic vaccine strain), A/Ohio/1/2007 (OH07; zoonotic isolate), A/Iowa/1/2006 (IA06; zoonotic isolate), and A/New Jersey/8/1976 (NJ76; zoonotic isolate included in the 1976 pandemic vaccine). Each of these represents one of the major phylogenetic clades of classical swine (, , and ) and recent pandemic (pdm) strains, as defined previously [25]. Since analysis of influenza viruses diversity based solely on genetic distance does not fully recapitulate the antigenic differences observed for influenza virus HA proteins, initially, a hemagglutination inhibition (HAI) assay was performed to evaluate antibodies induced against each of the parental HA proteins expressed on a PR8 background. As shown in Table 2, reactivity of sera against homologous HA-expressing virus was at least four-fold higher than that against heterologous HA-expressing viruses. The antigenic distance between the parental HA proteins was calculated using the HAI titers and the criteria described by Cai et al [41]. As shown in Table 3, the closest antigenic distance for any of our selected parental HA proteins was at least 10-fold, which is greater than the four-fold antigenic difference that is used to define distinct isolates during vaccine selection. Notably, the IA06 parental HA expressed on a PR8 background induced a strong antibody response against both the homologous HA and heterologous parental HAs (Table 2). Despite this high immunogenicity, the antigenic distance calculated for IA06 (Table 3) still indicated distinct antibody reactivity for this parental HA. Together, these data indicate that the viruses selected are both genetically and antigenically distinct.

(54) Subsequently, chimeric HA genes from these four parental viruses were constructed. HA genes were molecularly bred using the DNA shuffling method. A total of 33 chimeric HA genes were generated, and these shuffled HA constructs were cloned into the pHW2000 plasmid to establish an influenza HA antigen library. Using a DNA shuffling alignment analysis tool [42], these HA constructs were evaluated for representative parental gene fragments within the chimeric sequence, as shown in FIG. 2. As shown in FIGS. 7-10, individual alignments were also created to compare the HA1 region of each parental HA with the chimeric HA constructs, which shows amino acids differences in antigenic sites and the receptor-binding site (RBS). Nine constructs that contain the genetic elements from HA genes of all four parental viruses were selected for further analysis, including HA-107 (KR012992), HA-111 (KR012990), HA-113 (KR012994), HA-116 (KR012996), HA-123 (KR012995), HA-124 (KR012997), HA-126 (KR012998), HA-129 (KR012993), and HA-208 (KR012991).

(55) DNA Vaccination with Selected Chimeric HA Constructs in Mice

(56) After screening the HA composition, selected chimeric HAs were evaluated in mice by DNA immunization. Serum samples collected at 14 days after a third inoculation with DNA were tested for antibody response using an ELISA that incorporated parental HA-expressing viruses as antigen. The results, as seen in FIG. 3, show that IgG antibodies against all four parental viruses were detected in constructs HA-107, HA-111, HA-113, HA-116, HA-123, and HA-129. Of note, the HA-124, HA-126, and HA-208 chimeras did not induce antibodies that consistently reacted with all four parental viruses. These data demonstrate that chimeric HA constructs created using DNA shuffling method have the ability to induce broad immune responses, with some of these constructs inducing antibodies that react with all four parental HAs.

(57) Characterization of Influenza Viruses Expressing Chimeric HA Genes

(58) Historical approaches for influenza vaccine development utilize the natural reassortment properties of influenza viruses to express viral HA and neuraminidase (NA) genes on a PR8 master donor virus backbone. Since the majority of commercial vaccine preparations still utilize this reassortment approach, reverse genetics was used to generate viruses for candidate vaccine production. Efforts to create viruses expressing these chimeric HAs yielded only the HA-129 construct as an HA that could be expressed within a whole virus. This HA protein was expressed on both the PR8.sub.LAIV (PR8.sub.LAIV-129) and the TX98 (TX98-129) backbones, which were further used for vaccination in mice and pigs, respectively.

(59) To evaluate the in vitro properties of viruses expressing HA-129, growth characterization of PR8.sub.LAIV-129 and TX98-129 in MDCK cells was performed. Specifically, the growth kinetics of these recombinant viruses were compared with those of either PR8.sub.LAIV or TX98 in MDCK cells. Supernatants were harvested from virus-infected cells at different times post-inoculation, and TCID.sub.50 values were quantified by virus titration using separate MDCK cell monolayers. The results showed that both PR8.sub.LAIV-129 and TX98-129 exhibit similar growth kinetics to that of PR8.sub.LAIV (FIG. 4A) and TX98 (FIG. 4B), indicating that virus growth was not affected by the expression of HA-129 at the surface of the virus. Similarly, in chicken eggs, both PR8.sub.LAIV-129 and TX98-129 grew to high titers, with TCID.sub.50 values of 10.sup.8.375 and 10.sup.75, respectively. Together, these data demonstrate that candidate whole virus vaccines expressing chimeric HAs can be propagated using either eggs or MDCK cells, without obvious deficiencies in growth characteristics.

(60) Antibody Response Induced by HA-129 in Animal Models

(61) Using the PR8.sub.LAIV-129 as antigen, HAI assay results show that immune sera from mice inoculated with parental viruses broadly reacted with this chimeric HA-expressing virus (Table 2). To determine whether the PR8.sub.LAIV-129 can be used to induce broad immune responses, mice were vaccinated with this chimeric HA-expressing virus. Specifically, mice were immunized twice with the PR8.sub.LAIV-129, and sera were collected at 21 days post-secondary inoculation. Results from the HAI assay show that antibodies induced by the PR8.sub.LAIV-129 react with viruses expressing each of the four parental HAs, with maximal reactivity against the virus expressing the HA-129 itself (FIG. 5). This result indicates that HA-129 is immunogenic when expressed within a whole virus, and that antibodies induced can react with all four parental HA proteins.

(62) To determine the immunogenicity of HA-129 in pigs, pigs were immunized with the formalin-inactivated TX98-129 virus. Serum samples were collected at 14 days post-secondary immunization for analysis using both HAI and MN assays (FIG. 6). Similar to the results observed in mice, in both assays, immunized pigs developed significantly increased antibody titers (p<0.001) against the virus expressing HA-129, in comparison to that of serum antibody response from unvaccinated control pigs. These vaccine-induced antibodies also showed reactivity against viruses expressing parental HAs from OH07, TN09, NJ76, and IA06. To further assess the breadth of immunity induced by HA-129, additional non-parental influenza virus variants representing the major phylogenetic clades within the H1N1 influenza A virus subtype were also tested. These results show that antibodies induced after vaccination with TX98-129 were significantly increased (p<0.05) against a non-parental clade variant (A/swine/North Carolina/18161/02), two additional c clade variants (A/swine/Iowa/1/85 and A/swine/Iowa/40766/92), and a virus from the Eurasian swine lineage (A/swine/Germany/2/81) [48], as detected using both HAI and MN assays. As a comparison, serum from TX98-129-vaccinated animals did not react with the A/New Caledonia/20/99 H1N1 virus (FIG. 6), which was used here to represent the H1N1 clade. This result is expected, since none of the parental viruses are from clade.

(63) In the Examples disclosed herein, a panel of chimeric HA constructs was created that have the ability to induce humoral immunity against four genetically divergent parental HAs. The parental viruses selected were isolated from zoonotic infections [24,49,50] and the 2009 pandemic cases [51]. They represent strains with the potential to cause future pandemics through genetic mutation. Since the molecular breeding approach mimics and accelerates the natural evolutionary pathway, in certain embodiments, these novel chimeric HA antigens induce protective immunity against the current circulating H1 viruses and have the ability to induce protective immunity against future emerging H1 strains. These findings demonstrate that an HA-based, broadly-protective vaccine could be created using this DNA shuffling method, with the added benefit of incorporating these HA constructs into conventional virus vaccines that are immunogenic in both mice and pigs. Since an influenza virus pandemic can emerge at any time, and current approaches for vaccine selection and production leave us 6-9 months away from a vaccine [11,52], we may not have a vaccine prepared to face the first wave of the next pandemic. The instantly disclosed Examples show that chimeric HA molecules can be constructed to improve the breadth of antibody responses within a single influenza A virus subtype (H1N1). This suggests that a vaccine developed using this approach would be able to limit the interspecies transmission of influenza viruses between pigs and humans and to either prevent a pandemic or significantly lessen its impact.

(64) In the disclosed Examples, reverse genetics were used to create viruses expressing chimeric HA constructs. Recombinant viruses expressing the chimeric HA-129 on their surface (PR8.sub.LAIV-129 and TX98-129) were successfully rescued, and the growth kinetics analysis showed that expression of the HA-129 on either the PR8.sub.LAIV or the TX98 genetic backbone did not affect virus propagation. The observation that these viruses could be propagated in eggs and MDCK cells provides a basis for future development of inactivated and live, attenuated influenza virus vaccine preparations using conventional, FDA-approved approaches for vaccine production [53]. The recombinant viruses rescued were used to vaccinate both mice and pigs, and they induced antibody responses against viruses expressing both parental and non-parental HAs, particularly in pigs. These data show that broad, protective immunity could be induced within the swine population using this chimeric HA construct. These results encourage our approach toward vaccinating pigs in the pre-pandemic phase, a practice that could be helpful for limiting interspecies transmission.

(65) While not identical, the antibody response induced after DNA vaccination allowed for the screening of the HA constructs, and could also predict the breadth of humoral immunity induced by the PR8.sub.LAIV-129 in mice and TX98-129 in pigs. This is in contrast to prior attempts to induce broad immunity within an HA subtype by vaccinating with multiple HAs simultaneously. Specifically, the results reported here demonstrate advantages of using a single HA construct, instead of multiple parental HAs delivered simultaneously, especially when attempting to deliver these HAs in the context of a PR8.sub.LAIV backbone [13]. Furthermore, the antibody response to PR8.sub.LAIV-129 in mice correlated with the antibody response against TX98-129 in pigs, in which significant levels of antibodies against TN09, NJ76, OH07, and IA06 HAs were generated. In fact, based on previous reports [54,55], a HAI titer of 1:40 is considered an accepted antibody level that correlates with protective immunity in both pigs and humans, and our TX98-129-vaccinated animals developed antibodies against all four parental HAs that either met or exceeded this level. However, some of the serum samples from unvaccinated pigs generated unexpectedly high background reactivity in HAI assay, so we further analyzed the serum using MN assay to confirm that the antibodies detected by HAI were indeed neutralizing. Similar to our results from the HAI assay, we observed significant differences in neutralizing antibody titers when comparing vaccinated and unvaccinated serum samples by MN. Together, our results demonstrate that DNA vaccination can be used as a tool for screening the breadth of immunity induced by chimeric HA gene constructs, and that immunity induced by whole virus vaccine preparations expressing chimeric HAs in mice could predict the performance of similar vaccines in pigs.

(66) It is worth noting that some other HA chimeras, including HA-107, HA-111, HA-113, HA-116, and HA-123 also induced broad antibody responses against all four parental HAs.

(67) Turning now to the Figures, FIG. 1 shows phylogenetic comparison of swine H1 influenza hemagglutinins, including those used to create the chimeric HAs. Parental viruses included in the DNA shuffling of chimeric HA genes are identified with boxes in each phylogenic clade reported by Vincent et al. 2009 [58]. The phylogenetic tree was constructed using the Neighbor-Joining method by MEGA software version 6.0. The numbers on branches are bootstrap values from 1000 replicates.

(68) FIG. 2 shows a schematic diagram of DNA shuffled chimeric HA gene sequences. Alignment of HA genes from chimeric constructs and parental viruses was performed using clustal W (MEGA 6) and the assignment of homology between each construct and the parental viruses was determined by a DNA shuffling alignment analysis tool (Salanto, version 2.0.2; https://bitbucket.org/benderc/salanto/wiki/Home). Different shades represent different HA gene elements from parental virus.

(69) FIG. 3 shows the IgG antibody response in mice immunized with plasmid DNAs expressing chimeric HA. Mice (n=4) were vaccinated with plasmid DNAs of chimeric HA delivered by gene gun. Serum antibody (IgG) titers after the third vaccination were evaluated by ELISA, with samples considered positive if their initial serum OD.sub.405 was at least three times greater than the OD.sub.405 of negative control sera. Samples with antibody titers below the detectable limit of the assay were assigned a titer of 50 for the purpose of generating graphs. Bars show mean values, and error bars indicate standard deviation.

(70) FIGS. 4a and 4b show the comparison of growth kinetics of wild type virus with recombinant viruses expressing HA-129. (A) MDCK cells were inoculated with a 0.01 MOI of either wild type virus PR8.sub.LAIV or recombinant virus PR8.sub.LAIV-129. (B) MDCK cells were infected with wild type virus A/swine/Texas/4199-2/98 (TX98) or recombinant virus TX98-129. At the 12-hour time points indicated, cell culture supernatants were collected and titers were determined by TCID.sub.50 quantitation. Error bars represent SEM, with significance between paired viruses at time points denoted by asterisks (*p<0.05 and **p<0.01 using two-way repeated measures ANOVA with Bonferroni post-test).

(71) FIG. 5 shows serum antibody HAI titers from mice infected with recombinant virus PR8.sub.LAIV-129. BALB/c mice (n=7) were vaccinated intranasally with PR8.sub.LAIV-129. Serum antibody levels were analyzed using the HAI assay against the parental viruses and PR8.sub.LAIV-129. HAI titers are defined as the reciprocal of the final serum dilution where inhibition of hemagglutination was observed. Serum samples with a titer below the detectable limit of the assay (initial serum dilution of 1:10) were assigned a value of 5 for graphical representation and statistical analyses. HAI titers from vaccinated (grey bars) and unvaccinated (black bars) groups are presented for each HA tested (PR8.sub.LAIV-129, OH07, TN09, NJ76, and IA06). Reactivity of antibodies induced by PR8.sub.LAIV-129 from vaccinated mice was compared with that of unvaccinated mice using Mann Whitney nonparametric test (*p<0.05). Bars represent mean value with error bars indicating standard deviation.

(72) FIGS. 6a and 6b show antibody reactivity against viruses expressing parental or non-parental HAs using serum samples from pigs immunized with the TX98-129 IIV. Sera were collected at 28 days after inoculation of pigs with the TX98-129 IIV. (A) Serum antibody HAI assay. HAI titers are defined as the reciprocal of the final serum dilution where inhibition of hemagglutination was observed. (B) Serum antibody microneutralization (MN) assay. MN titers are defined as the reciprocal of the final serum dilution where OD.sub.490 was below 50% of positive control wells, using 100 TCID.sub.50 virus inoculum (confirmed by back-titration). Serum samples with a titer below the detectable limit of the assay (initial serum dilution of 1:10) were assigned a value of 5 for graphical representation and statistical analyses. Viruses expressing non-parental HA proteins are abbreviated (A/North Carolina/18161/2002: NC02; A/sw/Iowa/1/1985: IA85; A/sw/Iowa/40766/1992: IA92; A/sw/Germany/2/1981: GE81; A/New Caledonia/20/99: NC99) and shown with clade representation. Significance between vaccinated vs. unvaccinated for all viruses using a Mann Whitney nonparametric test (*p<0.05).

(73) FIG. 7 shows a comparison of antigenic sites of shuffled chimeric HA sequences with that of a parental HA. Amino acid alignment of the HA protein from A/Ohio/01/2007 (H1N1) with chimeric HAs. Antigenic sites Ca1, Ca2, Cb, Sa, Sb, and the receptor binding site (RBS) were boxed and shaded.

(74) FIG. 8 shows a comparison of antigenic sites of shuffled chimeric HA sequences with that of a parental HA. Amino acid alignment of the HA protein from A/Tennessee/1-560/2009 (H1N1) with chimeric HAs. Antigenic sites Ca1, Ca2, Cb, Sa, Sb, and the receptor binding site (RBS) were boxed and shaded.

(75) FIG. 9 shows a comparison of antigenic sites of shuffled chimeric HA sequences with that of a parental HA. Amino acid alignment of the HA protein from A/New Jersey/8/76 (H1N1) with chimeric HAs. Antigenic sites Ca1, Ca2, Cb, Sa, Sb, and the receptor binding site (RBS) were boxed and shaded.

(76) FIG. 10 shows a comparison of antigenic sites of shuffled chimeric HA sequences with that of a parental HA. Amino acid alignment of the HA protein from A/Iowa/01/2006 (H1N1) with chimeric HAs. Antigenic sites Ca1, Ca2, Cb, Sa, Sb, and the receptor binding site (RBS) were boxed and shaded.

(77) TABLE-US-00001 TABLE 1 Virus Names, Subtypes and Accession Numbers Included in Phylogenetic Tree Virus Name Accession A/Ohio/01/2007(H1N1) FJ986620 A/swine/Minnesota/03025/2010(H1N1) HM570051 A/swine/Illinois/03037/2010(H1N1) HM754221 A/Swine/Ohio/891/01(H1N2) AF455675 A/Tennessee/1-560/2009(H1N1) CY040457 A/New Jersey/8/1976(H1N1) CY130118 A/Texas/05/2009(H1N1) FJ966959 A/California/04/2009(H1N1) FJ966082 A/Iowa/01/2006(H1N1) FJ986618 A/swine/Kentucky/02086/2008(H1N1) HM461786 A/swine/Iowa/1973(H1N1) EU139826 A/swine/Iowa/2/1987(H1N1) CY028171 A/swine/Ontario/53518/03(H1N1) DQ280219 A/swine/Minnesota/02053/2008(H1N1) CY099119 A/swine/Iowa/1/1985(H1N1) CY022317 A/Swine/North Carolina/98225/01(H1N2) AF455676 A/Swine/Iowa/930/01(H1N2) AF455679 A/swine/MN/48683/2002(H1N1) HM125974 A/swine/North Carolina/18161/2002(H1N1) CY098516 A/swine/Germany/2/1981(H1N1) Z30276 A/swine/Tennessee/49/1977(H1N1) CY022133 A/swine/Tennessee/8/1978(H1N1) CY027523 A/swine/Netherlands/12/85(H1N1) AF091317 A/South Carolina/1/18 (H1N1) AF117241 A/swine/Iowa/15/1930(H1N1) EU139823 A/swine/Colorado/1/1977(H3N2) CY009300 A/swine/Iowa/40766/1992(H1N1) KP788773

(78) TABLE-US-00002 TABLE 2 Antibody cross reactivity in sera from mice infected with recombinant viruses expressing parental or chimeric HA protein Post-Infection Sera Virus Isolate OH07 IA06 NJ76 TN09 PR8-OH07 1280 320 *< 80 PR8-IA06 < 5120** 320 80 PR8-NJ76 < 320 1280 < PR8-TN09 40 160 < 320 PR8.sub.LAIV-129 80 320 160 320 *<: HI titer less than 1:40. **A four-fold difference in antibody reactivity represents an acceptable antigenic distance for vaccine selection [41].

(79) TABLE-US-00003 TABLE 3 Antigenic distance between selected H1 HA proteins. Antigenic distance Virus Isolate OH07 IA06 NJ76 TN09 PR8-OH07 NA* 136 256 18 PR8-IA06 136** NA 10 18 PR8-NJ76 256 18 NA 160 PR8-TN09 18 18 160 NA *NA: Not Applicable. **A four-fold difference represents an acceptable antigenic distance for vaccine selection [41].

(80) Although the present invention has been described with reference to preferred embodiments, persons skilled in the art will recognize that changes may be made in form and detail without departing from the spirit and scope of the invention.

REFERENCES

(81) 1. Webster R G, Bean W J, Gorman O T, Chambers T M, Kawaoka Y (1992) Evolution and ecology of influenza A viruses. Microbiol Rev 56: 152-179. 2. Klimov A, Simonsen L, Fukuda K, Cox N (1999) Surveillance and impact of influenza in the United States. Vaccine 17 Suppl 1: S42-S46. 3. Richt J A, Lekcharoensuk P, Lager K M, Vincent A L, Loiacono C M, Janke B H, Wu W H, Yoon K J, Webby R J, Solorzano A, Garcia-Sastre A (2006) Vaccination of pigs against swine influenza viruses by using an NS1-truncated modified live-virus vaccine. J Virol 80: 11009-11018. 4. Hause B M, Stine D L, Sheng Z, Wang Z, Chakravarty S, Simonson R R, Li F (2012) Migration of the swine influenza virus delta-cluster hemagglutinin N-linked glycosylation site from N142 to N144 results in loss of antibody cross-reactivity. Clin Vaccine Immunol 19: 1457-1464. CVI.00096-12 [pii]; 10. 1128/CVI.00096-12 [doi]. 5. Osterholm M T, Kelley N S, Sommer A, Belongia E A (2012) Efficacy and effectiveness of influenza vaccines: a systematic review and meta-analysis. Lancet Infect Dis 12: 36-44. 6. Nichol K L (2008) Efficacy and effectiveness of influenza vaccination. Vaccine 26 Suppl 4: D17-D22. 7. Kilbourne E D (2006) Influenza pandemics of the 20th century. Emerg Infect Dis 12: 9-14. 8. Webby R J, Webster R G (2003) Are we ready for pandemic influenza? Science 302: 1519-1522. 9. Vijaykrishna D, Poon L L, Zhu H C, Ma S K, Li O T, Cheung C L, Smith G J, Peiris J S, Guan Y (2010) Reassortment of pandemic H1N1/2009 influenza A virus in swine. Science 328: 1529. 10. Meiklejohn G (1983) Viral respiratory disease at Lowry Air Force Base in Denver, 1952-1982. J Infect Dis 148: 775-784. 11. Gerdil C (2003) The annual production cycle for influenza vaccine. Vaccine 21: 1776-1779. 12. Schultz-Cherry S, Olsen C W, Easterday B C (2012) History of Swine Influenza. Curr Top Microbiol Immunol. 13. Huber V C, Thomas P G, McCullers J A (2009) A multi-valent vaccine approach that elicits broad immunity within an influenza subtype. Vaccine 27: 1192-1200. 14. Zhao G, Hortsch M (1998) The analysis of genomic structures in the L1 family of cell adhesion molecules provides no evidence for exon shuffling events after the separation of arthropod and chordate lineages. Gene 215: 47-55. S0378-1119(98)00273-X [pii]. 15. Ness J E, Welch M, Giver L, Bueno M, Cherry J R, Borchert T V, Stemmer W P, Minshull J (1999) DNA shuffling of subgenomic sequences of subtilisin. Nat Biotechnol 17: 893-896. 10.1038/12884 [doi]. 16. Ness J E, Kim S, Gottman A, Pak R, Krebber A, Borchert T V, Govindarajan S, Mundorff E C, Minshull J (2002) Synthetic shuffling expands functional protein diversity by allowing amino acids to recombine independently. Nat Biotechnol 20: 1251-1255. 10.1038/nbt754 [doi]; nbt754 [pii]. 17. Chang C C, Chen T T, Cox B W, Dawes G N, Stemmer W P, Punnonen J, Patten P A (1999) Evolution of a cytokine using DNA family shuffling. Nat Biotechnol 17: 793-797. 10.1038/11737 [doi]. 18. Burgers W A, van Harmelen J H, Shephard E, Adams C, Mgwebi T, Bourn W, Hanke T, Williamson A L, Williamson C (2006) Design and preclinical evaluation of a multigene human immunodeficiency virus type 1 subtype C DNA vaccine for clinical trial. J Gen Virol 87: 399-410. 87/2/399 [pii]; 10.1099/vir.0.81379-0 [doi]. 19. Callison S, Hilt D, Jackwood M (2005) Using DNA shuffling to create novel infectious bronchitis virus S1 genes: implications for S1 gene recombination. Virus Genes 31: 5-11. 10.1007/s 1262-004-2194-3 [doi]. 20. Osen W, Peiler T, Ohlschlager P, Caldeira S, Faath S, Michel N, Muller M, Tommasino M, Jochmus I, Gissmann L (2001) A DNA vaccine based on a shuffled E7 oncogene of the human papillomavirus type 16 (HPV 16) induces E7-specific cytotoxic T cells but lacks transforming activity. Vaccine 19: 4276-4286. S0264-410X(01)00154-2 [pii]. 21. Raviprakash K, Apt D, Brinkman A, Skinner C, Yang S, Dawes G, Ewing D, Wu S J, Bass S, Punnonen J, Porter K (2006) A chimeric tetravalent dengue DNA vaccine elicits neutralizing antibody to all four virus serotypes in rhesus macaques. Virology 353: 166-173. 22. Apt D, Raviprakash K, Brinkman A, Semyonov A, Yang S, Skinner C, Diehl L, Lyons R, Porter K, Punnonen J (2006) Tetravalent neutralizing antibody response against four dengue serotypes by a single chimeric dengue envelope antigen. Vaccine 24: 335-344. 23. Crameri A, Raillard S A, Bermudez E, Stemmer W P (1998) DNA shuffling of a family of genes from diverse species accelerates directed evolution. Nature 391: 288-291. 10.1038/34663 [doi]. 24. Yassine H M, Khatri M, Zhang Y J, Lee C W, Byrum B A, O'Quin J, Smith K A, Saif Y M (2009) Characterization of triple reassortant H1N1 influenza A viruses from swine in Ohio. Vet Microbiol 139: 132-139. 25. Lorusso A, Vincent A L, Harland M L, Alt D, Bayles D O, Swenson S L, Gramer M R, Russell C A, Smith D J, Lager K M, Lewis N S (2011) Genetic and antigenic characterization of H1 influenza viruses from United States swine from 2008. J Gen Virol 92: 919-930. 26. Hoffmann E, Neumann G, Kawaoka Y, Hobom G, Webster R G (2000) A DNA transfection system for generation of influenza A virus from eight plasmids. Proc Natl Acad Sci USA 97: 6108-6113. 27. Hoffmann E, Krauss S, Perez D, Webby R, Webster R G (2002) Eight-plasmid system for rapid generation of influenza virus vaccines. Vaccine 20: 3165-3170. 28. Hoffmann E, Webster R G (2000) Unidirectional RNA polymerase I-polymerase II transcription system for the generation of influenza A virus from eight plasmids. J Gen Virol 81: 2843-2847. 29. Soong N W, Nomura L, Pekrun K, Reed M, Sheppard L, Dawes G, Stemmer W P (2000) Molecular breeding of viruses. Nat Genet 25: 436-439. 30. Kilbourne E D (1969) Future influenza vaccines and the use of genetic recombinants. Bull World Health Organ 41: 643-645. 31. Kilbourne E D, Schulman J L, Schild G C, Schloer G, Swanson J, Bucher D (1971) Related studies of a recombinant influenza-virus vaccine. I. Derivation and characterization of virus and vaccine. J Infect Dis 124: 449-462. 32. Vincent A L, Ma W, Lager K M, Richt J A, Janke B H, Sandbulte M R, Gauger P C, Loving C L, Webby R J, Garcia-Sastre A (2012) Live attenuated influenza vaccine provides superior protection from heterologous infection in pigs with maternal antibodies without inducing vaccine-associated enhanced respiratory disease. J Virol 86: 10597-10605. JVI.01439-12 [pii]; 10.1128/JVI.01439-12 [doi]. 33. Jin H, Zhou H, Lu B, Kemble G (2004) Imparting temperature sensitivity and attenuation in ferrets to A/Puerto Rico/8/34 influenza virus by transferring the genetic signature for temperature sensitivity from cold-adapted A/Ann Arbor/6/60. J Virol 78: 995-998. 34. Huber V C, McCullers J A (2006) Live attenuated influenza vaccine is safe and immunogenic in immunocompromised ferrets. J Infect Dis 193: 677-684. 35. Reed L J, Muench H (1938) A simple method of estimating 50% endpoints. Am J Hyg 27: 493-497. 36. Huber V C, McKeon R M, Brackin M N, Miller L A, Keating R, Brown S A, Makarova N, Perez D R, Macdonald G H, McCullers J A (2006) Distinct contributions of vaccine-induced immunoglobulin G1 (IgG1) and IgG2a antibodies to protective immunity against influenza. Clin Vaccine Immunol 13: 981-990. 37. Cwach K T, Sandbulte H R, Klonoski J M, Huber V C (2012) Contribution of murine innate serum inhibitors toward interference within influenza virus immune assays. Influenza Other Respi Viruses 6: 127-135. 38. Rowe T, Abernathy R A, Hu-Primmer J, Thompson W W, Lu X, Lim W, Fukuda K, Cox N J, Katz J M (1999) Detection of antibody to avian influenza A (H5N1) virus in human serum by using a combination of serologic assays. J Clin Microbiol 37: 937-943. 39. World Health Organization (2002) WHO Manual on Animal Influenza Diagnosis and Surveillance. In: Webster R G, Cox N, Stohr K, editors. World Health Organization. pp. 1-135. 40. Chaussee M S, Sandbulte H R, Schuneman M J, DePaula F P, Addengast L A, Schlenker E H, Huber V C (2011) Inactivated and live, attenuated influenza vaccines protect mice against influenza: Streptococcus pyogenes super-infections. Vaccine 29: 3773-3781. S0264-410X(11)00383-5 [pii]; 10.1016/j.vaccine.2011.03.031 [doi]. 41. Cai Z, Zhang T, Wan X F (2012) Antigenic distance measurements for seasonal influenza vaccine selection. Vaccine 30: 448-453. 42. Schurmann N, Trabuco L G, Bender C, Russell R B, Grimm D (2013) Molecular dissection of human Argonaute proteins by DNA shuffling. Nat Struct Mol Biol 20: 818-826. nsmb.2607 [pii]; 10.1038/nsmb.2607 [doi]. 43. Caton A J, Brownlee G G, Yewdell J W, Gerhard W (1982) The antigenic structure of the influenza virus A/P R/8/34 hemagglutinin (H1 subtype). Cell 31: 417-427. 44. Hensley S E, Yewdell J W (2009) Que sera, sera: evolution of the swine H1N1 influenza A virus. Expert Rev Anti Infect Ther 7: 763-768. 45. Almansour I, Chen H, Wang S, Lu S (2013) Cross reactivity of serum antibody responses elicited by DNA vaccines expressing H A antigens from H1N1 subtype influenza vaccines in the past 30 years. Hum Vaccin Immunother 9: 2049-2059. 25735 [pii]; 10.4161/hv.25735 [doi]. 46. Fulvini A A, Ramanunninair M, Le J, Pokorny B A, Arroyo J M, Silverman J, Devis R, Bucher D (2011) Gene constellation of influenza a virus reassortants with high growth phenotype prepared as seed candidates for vaccine production. PLoS One 6: e20823. 47. Ramanunninair M, Le J, Onodera S, Fulvini A A, Pokorny B A, Silverman J, Devis R, Arroyo J M, He Y, Boyne A, Bera J, Halpin R, Hine E, Spiro D J, Bucher D (2013) Molecular signature of high yield (growth) influenza a virus reassortants prepared as candidate vaccine seeds. PLoS One 8: e65955. 10.1371/journal.pone.0065955 [doi]; PONE-D-12-25674 [pii]. 48. Brown I H, Ludwig S, Olsen C W, Hannoun C, Scholtissek C, Hinshaw V S, Harris P A, McCauley J W, Strong I, Alexander D J (1997) Antigenic and genetic analyses of H1N1 influenza A viruses from European pigs. J Gen Virol 78 (Pt 3): 553-562. 49. Lorusso A, Vincent A L, Harland M L, Alt D, Bayles D O, Swenson S L, Gramer M R, Russell C A, Smith D J, Lager K M, Lewis N S (2011) Genetic and antigenic characterization of H1 influenza viruses from United States swine from 2008. J Gen Virol 92: 919-930. vir.0.027557-0 [pii]; 10.1099/vir.0.027557-0 [doi]. 50. Shinde V, Bridges C B, Uyeki T M, Shu B, Balish A, Xu X, Lindstrom S, Gubareva L V, Deyde V, Garten R J, Harris M, Gerber S, Vagasky S, Smith F, Pascoe N, Martin K, Dufficy D, Ritger K, Conover C, Quinlisk P, Klimov A, Bresee J S, Finelli L (2009) Triple-reassortant swine influenza A (H1) in humans in the United States, 2005-2009. N Engl J Med 360: 2616-2625. 51. Rowe T, Leon A J, Crevar C J, Carter D M, Xu L, Ran L, Fang Y, Cameron C M, Cameron M J, Banner D, Ng D C, Ran R, Weirback H K, Wiley C A, Kelvin D J, Ross T M (2010) Modeling host responses in ferrets during A/California/07/2009 influenza infection. Virology 401: 257-265. 52. Robertson J S, Nicolson C, Harvey R, Johnson R, Major D, Guilfoyle K, Roseby S, Newman R, Collin R, Wallis C, Engelhardt O G, Wood J M, Le J, Manojkumar R, Pokorny B A, Silverman J, Devis R, Bucher D, Verity E, Agius C, Camuglia S, Ong C, Rockman S, Curtis A, Schoofs P, Zoueva O, Xie H, Li X, Lin Z, Ye Z, Chen L M, O'Neill E, Balish A, Lipatov A S, Guo Z, Isakova I, Davis C T, Rivailler P, Gustin K M, Belser J A, Maines T R, Tumpey T M, Xu X, Katz J M, Klimov A, Cox N J, Donis R O (2011) The development of vaccine viruses against pandemic A(H1N1) influenza. Vaccine 29: 1836-1843. 53. Fiore A E, Uyeki T M, Broder K, Finelli L, Euler G L, Singleton J A, Iskander J K, Wortley P M, Shay D K, Bresee J S, Cox N J (2010) Prevention and control of influenza with vaccines: recommendations of the Advisory Committee on Immunization Practices (ACIP), 2010. MMWR Recomm Rep 59: 1-62. 54. Hobson D, Curry R L, Beare A S, Ward-Gardner A (1972) The role of serum haemagglutination-inhibiting antibody in protection against challenge infection with influenza A2 and B viruses. J Hyg (Lond) 70: 767-777. 55. Black S, Nicolay U, Vesikari T, Knuf M, Del G G, Della C G, Tsai T, Clemens R, Rappuoli R (2011) Hemagglutination inhibition antibody titers as a correlate of protection for inactivated influenza vaccines in children. Pediatr Infect Dis J 30: 1081-1085. 56. 2013) Prevention and control of influenza with vaccines: interim recommendations of the Advisory Committee on Immunization Practices (ACIP), 2013. MMWR Morb Mortal Wkly Rep 62: 356. mm6218a3 [pii]. 57. Flannery B, Clippard J, Zimmerman R K, Nowalk M P, Jackson M L, Jackson L A, Monto A S, Petrie J G, McLean H Q, Belongia E A, Gaglani M, Berman L, Foust A, Sessions W, Thaker S N, Spencer S, Fry A M (2015) Early estimates of seasonal influenza vaccine effectivenessUnited States, january 2015. MMWR Morb Mortal Wkly Rep 64: 10-15. mm6401a4 [pii]. 58. Vincent A L, Ma W, Lager K M, Gramer M R, Richt J A, Janke B H (2009) Characterization of a newly emerged genetic cluster of H1N1 and H1N2 swine influenza virus in the United States. Virus Genes.

(82) TABLE-US-00004 SEQUENCELISTING SEQIDNO:1(HA:107_Chimeric_H1N1|segment4:HA) DTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCKLGGIAPL HLGKCNIAGWLLGNPECELLLTVSSWSYIVETSNSDNGTCYPGDFINYEE LREQLSSVSSFERFEIFPKTSSWPDHETNRGVTAACPHAGAKSFYRNLIW LVKKGNSYPKLSKSYVNNKGKEVLVLWGIHHPPTSTDQQSLYQNADAYVF VGSSKYNRKFKPEIAARPKVRDQEGRMNYYWTLVEPGDKITFEATGNLVV PRYAFAMNRGSGSGIIISDAPVHDCNTKCQTPKGAINTSLPFQNIHP VTIGECPKYVKSTKLRMATGLRNIPSIQSRGLF SEQIDNO:2(HA:111_Chimeric_H1N1|segment4:HA) DTLC1GYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCKLGGIAPL HLGKCNIAGWLLGNPECELLLTVSSWSYIVETSNSDNGTCYPGDFINYEE LREQLSSVSSFERFEIFPKTSSWPDHETNRGVTAACPYAGANSFYRNLIW LVKKGNSYPKLSKSY1NDKEKEVLVLWAIHHPSTSADQQSLYQNADAYVF VGSSRYSKKFKPEIAIRPKVRDQAGRMNYYWTLVEPGDKITFEATGNLVV PRYAFAMERNAGSGIIISDTSVHDCDTTCQTPNGAINTSLPFQNIHPVTI GECPKYVKSTKLRMATGLRNIPSIQSRGLF SEQIDNO:3(HA:113_Chimeric_H1N1|segment4:HA) DTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCKLRGVAPL HLGKCNIAGWLLGNPECELLLTVSSWSYIVETSNSDNGTCYPGDFINYEE LREQLSSVSSFERFEIFPKTSSWPDHETNRGVTAACPYAGANSFYRNLIW LVKKGNSYPKLSKSYVNNKGKEVLVLWGIHHPSTSADQQSLYQNADAYVF VGSSRYSKKFKPE1AIRPKVRDQEGRMNYYWTLVEPGDKITFEATGNLVV PRYAFAMERNAGSGIIISDTPVHDCNTTCQTPKGAINTSLPFQNIHPVTI GECPKYVKSTKLRMATGLRNIPSIQSRGLF SEQIDNO:4(HA:116_Chimeric_H1N1|segment4:HA) DTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCKLGGIAPL HLGKCNIAGWLLGNPECELLLTVSSWSYIVETSNSDNGTCYPGDFIDYEE LREQLSSVSSFERFEIFPKTSSWPNHDTNRGVTAACPHAGTNSFYRNLIW LVKKGNSYPKINKSYINNKEKEVLVLWAIHHPSTSADQQSLYQNADAYVF VGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTLVEPGDKITFEATGNLVV PRYAFAMNRGSGSGIIISDAPVHDCNTKCQTPKGAINTSLPFQNIHPVTI GECPKYVKSTKLRMATGLRNIPSIQSRGLF SEQIDNO:5(HA:123_Chimeric_H1N1|segment4:HA) DTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCKLRGVAPL HLGKCNIAGWILGNPECESLSTASSWSYIVETPSSDNGTCYPGDFIDYEE LREQLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIW LVKKGNSYPKLSKSYVNNKGKEVLVLWAIHHPSTSADQQSLYQNADAYVF VGSSRYSRKFEPEIAARPKVRGQAGRMNYYWTLIEPGDTITFEATGNLVV PRYAFAMNRGSGSGIIISDAPVHDCNTKCQTPKGAINTSLPFQNIHPVTI GECPKYVKSTKLRMATGLRNIPSIQSRGLF SEQIDNO:6(HA:124_Chimeric_H1N1|segment4:HA) DTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCKLGGIAPL HLGKCNIAGWLLGNPECESLSTASSWSYIVETPSSDNGTCYPGDFIDYEE LREQLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPYAGANSFYRNLIW LVKKGNSYPKINKSYINNKEKEVLVLWAIHRPSTSADQQSLYQNADAYVF VGSSRYSRKFEPEIATRPKVRDQAGRMNYYWTLVEPGDKITFEATGNLVV PRYAFAMNRGSGSGIIISDAPVHDCNTKCQTPKGAINTSLPFQNIHPVTI GECPKYVKSTKLRMATGLRNIPSIQSRGLF SEQIDNO:7(HA:126_Chimeric_H1N1|segment4:HA) DTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCKLRGVAPL HLGKCNIAGWLLGNPECESLSTASSWSYIVETSNSDNGTCYPGDFIDYEE LREQLSSVSSFERFEIFPKTSSWPDHETNRGVTAACPYAGANSFYRNLIW LVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVF VGSSRYSRKFEPEIATRPKVRGQAGRMNYYWTLIEPGDTITFEATGNLVV PRYAFAMNRGSGSGIIISDAPVHDCNTKCQTPKGAINTSLPFQNIHPVTI GECPKYVKSTKLRMATGLRNIPSIQSRGLF SEQIDNO:8(HA:129_Chimeric_H1N1|segment4:HA) DTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCKLRGVAPL HLGKCNIAGWLLGNPECELLLTVSSWSYIVETSNSDNGTCYPGDFINYEE LREQLSSVSSFERFEIFPKTSSWPDHETNRGVTAACPYAGANSFYRNLIW LVKKGNSYPKLSKSYVNNKGKEVLVLWGIHHPPTSTDQQSLYQNADAYVF VGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTLVEPGDKITFEATGNLVV PRYAFAMERNAGSGIIISDTPVHDCNTTCQTPKGAINTSLPFQNIHPITI GKCPKYVKSTKLRLATGLRNIPSIQSRGLF SEQIDNO:9(HA:208_Chimeric_H1N1|segment4:HA) DTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCKLGGIAPL HLGKCNIAGWLLGNPECELLLTVSSWSYIVETSNSDNGTCYPGDFIDYEE LREQLSSVSSFERFEIFPKTSSWPNHDTNRGVTAACPHAGTNSFYRNLIW LVKKGNSYPKINKSYINNKEKEVLVLWAIHHPSTSADQQSLYQNADAYVF VGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTLVEPGDKITFEATGNLVV PRYAFAMNRGSGSGIIISDAPVHDCNTKCQTPKGAINTSLPFQNIHPVTI GECPKYVKSTKLRMATGLRNIPSIQSRGLF