Anti-Cancer DNA Vaccine Employing Plasmids Encoding Signal Sequence, Mutant Oncoprotein Antigen, and Heat Shock Protein

20180141983 ยท 2018-05-24

    Inventors

    Cpc classification

    International classification

    Abstract

    Novel nucleic acid vectors comprising sequences encoding (a) an antigen, (b) a signal peptide, and (c) a heat shock protein, are disclosed, as are methods for using such vectors to induce antigen-specific immune responses and to treat tumors.

    Claims

    1. A nucleic acid molecule encoding a fusion polypeptide useful as a vaccine composition, which molecule comprises: (a) a first nucleic acid sequence encoding a first polypeptide or peptide that promotes processing via the MHC class I pathway; (b) fused in frame with the first nucleic acid sequence, a second nucleic acid sequence encoding a signal peptide; and (c) a third nucleic acid sequence that is linked in frame to said first nucleic acid sequence and that encodes an antigenic polypeptide or peptide.

    2. The nucleic acid molecule of claim 1, wherein the antigenic peptide comprises an epitope that binds to a MHC class I protein.

    3. The nucleic acid molecule of claim 1 wherein the first polypeptide or peptide is Hsp70, an active C-terminal domain thereof, or a functional derivative of Hsp70 or of said C-terminal domain.

    4. The nucleic acid molecule of claim 1, wherein the first polypeptide is encoded by SEQ ID NO:9 or a fragment thereof that encodes a functional derivative of said polypeptide or the full length sequence of Hsp70 a set forth in GENBANK Z95324 AL123456 and encoded by nucleotides 10633-12510 of the Mycobacterium tuberculosis genome.

    5. The nucleic acid molecule of claim 1, wherein the first polypeptide is SEQ ID NO:10 of a functional derivative thereof.

    6. The nucleic acid molecule of claim 1 wherein the antigen is one which is present on, or/cross-reactive with an epitope of, a pathogenic organism, cell, or virus.

    7. The nucleic acid molecule of claim 6, wherein the virus is a human papilloma virus.

    8. The nucleic acid molecule of claim 7, wherein the antigen is an E7 polypeptide of HPV-16 having the sequence SEQ ID NO:2, or an antigenic fragment thereof.

    9. The nucleic acid molecule of claim 8, wherein the HPV-16 E7 polypeptide is a non-oncogenic mutant or variant of said E7 polypeptide.

    10. The nononcogenic mutant of claim 9 wherein the sequence of the E7 polypeptide differs from SEQ ID NO:2 by one or more of the following substitutions: (a) Cys at position 24 to Gly or Ala (b) Glu at position 26 to Gly or Ala (c) Cys at position 91 to Gly or Ala.

    11. The nucleic acid molecule of claim 7, wherein the antigen is the E6 polypeptide of HPV-16 having the sequence SEQ ID NO:4 or an antigenic fragment thereof.

    12. The nucleic acid molecule of claim 11, wherein the HPV-16 E6 polypeptide is a non-oncogenic mutant or variant of said E6 polypeptide.

    13. The nononcogenic mutant of claim 12 wherein the sequence of the E6 polypeptide differs from SEQ ID NO:4 by one or more of the following substitutions: (a) Cys at position 70 to Gly or Ala (b) Cys at position 113 to Gly or Ala. (c) Ile at position 135 to Thr

    14. The nucleic acid molecule of claim 1 that is characterized as pNGVL4a-Sig/E7(detox)/HSP70, and has the sequence SEQ ID NO:13.

    15. The nucleic acid molecule of claim 1 operatively linked to a promoter.

    16. An expression vector comprising the nucleic acid molecule of any of claims 1-13 operatively linked to (a) a promoter; and (b) optionally, additional regulatory sequences that regulate expression of said nucleic acid in a eukaryotic cell.

    17. An expression vector comprising the nucleic acid molecule of claim 14. operatively linked to (a) a promoter; and (b) optionally, additional regulatory sequences that regulate expression of said nucleic acid in a eukaryotic cell.

    18. The expression vector of claim 16 which is a plasmid.

    19. The expression vector of claim 18 wherein said plasmid is pNGV4a.

    20. A pharmaceutical composition capable of inducing or enhancing an antigen-specific immune response, comprising: (a) pharmaceutically and immunologically acceptable excipient in combination with; (b) a composition comprising the nucleic acid molecule of any of claims 1-13.

    21. A pharmaceutical composition capable of inducing or enhancing an antigen-specific immune response, comprising: (a) pharmaceutically and immunologically acceptable excipient in combination with; (b) the nucleic acid molecule of claim 14.

    22. A pharmaceutical composition capable of inducing or enhancing an antigen-specific immune response, comprising: (a) pharmaceutically and immunologically acceptable excipient in combination with; (b) the expression vector of claim 16.

    23. A pharmaceutical composition capable of inducing or enhancing an antigen-specific immune response, comprising: (a) pharmaceutically and immunologically acceptable excipient in combination with; (b) the expression vector of claim 19.

    24. A method of inducing or enhancing an antigen specific immune response in a subject comprising administering to the subject an effective amount of the pharmaceutical composition of claim 20, thereby inducing or enhancing said response.

    25. A method of inducing or enhancing an antigen specific immune response in a subject comprising administering to the subject an effective amount of the pharmaceutical composition of claim 21, thereby inducing or enhancing said response.

    26. A method of inducing or enhancing an antigen specific immune response in a subject comprising administering to the subject an effective amount of the pharmaceutical composition of claim 22, thereby inducing or enhancing said response.

    27. A method of inducing or enhancing an antigen specific immune response in a subject comprising administering to the subject an effective amount of the pharmaceutical composition of claim 23, thereby inducing or enhancing said response.

    28. The method of claim 24, wherein the response is mediated at least in part by CD8.sup.+ cytotoxic T lymphocytes (CTL).

    29. The method of claim 24 wherein said subject is a human.

    30. The method of claim 25 wherein said subject is a human.

    31. The method of claim 26 wherein said subject is a human.

    32. The method of claim 27 wherein said subject is a human.

    33. The method of claim 29 wherein said administering is by a intramuscular injection by gene gun administration or by needle-free jet injection.

    34. The method of claim 30 wherein said administering is by a intramuscular injection by gene gun administration or by needle-free jet injection.

    35. The method of claim 31 wherein said administering is by a intramuscular injection by gene gun administration or by needle-free jet injection.

    36. The method of claim 32 wherein said administering is by a intramuscular injection by gene gun administration or by needle-free jet injection.

    37. A method of inhibiting growth or preventing re-growth of a tumor expressing HPV E7 or E6 protein in a subject, comprising administering to said subject an effective amount of a pharmaceutical composition of claim 20, wherein said third nucleic acid sequence encodes one or more epitopes of E7 or E6, thereby inhibiting said growth or preventing said re-growth.

    38. A method of inhibiting growth or preventing re-growth of a tumor expressing HPV E7 or E6 protein in a subject, comprising administering to said subject an effective amount of a pharmaceutical composition of claim 21, wherein said third nucleic acid sequence encodes one or more epitopes of E7 or E6, thereby inhibiting said growth or preventing said re-growth.

    39. A method of inhibiting growth or preventing re-growth of a tumor expressing HPV E7 or E6 protein in a subject, comprising administering to said subject an effective amount of a pharmaceutical composition of claim 22, wherein said third nucleic acid sequence encodes one or more epitopes of E7 or E6, thereby inhibiting said growth or preventing said re-growth.

    40. A method of inhibiting growth or preventing re-growth of a tumor expressing HPV E7 or E6 protein in a subject, comprising administering to said subject an effective amount of a pharmaceutical composition of claim 23, wherein said third nucleic acid sequence encodes one or more epitopes of E7 or E6, thereby inhibiting said growth or preventing said re-growth.

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0032] FIG. 1, contains 2 panels, 1A and 1B, which show intracellular cytokine staining and flow cytometric analysis characterizing IFN-?-secreting E7-specific CD8.sup.+ T cell precursors in mice vaccinated with pNGVL4a-Sig/E7(detox)/HSP70 DNA vaccine via needle i.m., biojector, and gene gun. Flow cytometric analysis was of splenocytes collected from vaccinated mice one week after vaccination, and cultured in vitro with or without the E7 peptide (amino acids 49-57) overnight. Cells were stained for both CD8 and intracellular IFN-?. The number of IFN-? secreting CD8.sup.+ T cell precursors in na?ve and immunized mice was analyzed. FIG. 1A shows representative results of intracellular cytokine staining. The number of CD8.sup.+ IFN-? double-positive T cells in 3?10.sup.5 splenocytes are indicated in the upper right corner. FIG. 1B shows composite result of flow cytometric analysis of IFN-y-secreting E7-specific CD8.sup.+ T cell precursors in naive mice and mice vaccinated with pNGVL4a-Sig/E7(detox)/HSP70 DNA vaccine via needle i.m., biojector, and gene gun. Results are expressed as the mean number of number of E7-specific IFN-? CD8.sup.+ T lymphocytes per 3?10.sup.5 splenocytes; bars, ?SE.

    [0033] FIG. 2 is a graph showing in vivo tumor protection experiments that compare the antitumor effects of the vaccine delivered by different routes. Mice were immunized and challenged with 5?10.sup.4 TC-1 tumor cells. Results are expressed as the percentage of tumor free mice at various days after tumor challenge.

    [0034] FIG. 3 is a graph showing results of in vivo tumor treatment experiments comparing antitumor effects of the vaccine delivered by different routes. Mice were inoculated i.v. with 10.sup.4 TC-1 tumor cells via the tail vein and were subsequently treated with the DNA vaccine administered via needle i.m., by biojector. and by gene gun. FIG. 3 shows the number of pulmonary nodules present in na?ve mice and in the groups of treated mice. Results are expressed as the mean number of lung nodules; bars, ?SE.

    [0035] FIG. 4, like FIG. 3, shows weights of pulmonary nodules present in na?ve mice and in groups of treated mice. Results are expressed as the Mean weight of lung nodules; bars, ?SE.

    [0036] FIG. 5, contains two panels, 5A and 5B. FIG. 5A is a schematic diagram of the pNGVL4a-Sig/E7(detox)/HSP70 plasmid vector used for anti-tumor vaccination. Indicated are various inserts. FIG. 5B shows point mutations introduced to generate detoxified E7/hsp70.

    DESCRIPTION OF THE PREFERRED EMBODIMENTS

    Partial List of Abbreviations Used

    [0037] APC, antigen presenting cell; CTL, cytotoxic T lymphocyte; DC, dendritic cell; ECD, extracellular domain; E6, HPV oncoprotein E6; E7, HPV oncoproteinE7; ELISA, enzyme-linked immunosorbent assay; HPV, human papillomavirus; HSP, heat shock protein; Hsp70, mycobacterial heat shock protein 70; IFN?, interferon-?; i.m., intramuscular(ly); i.v., intravenous(ly); MHC, major histocompatibility complex; PBS, phosphate-buffered saline; PCR, polymerase chain reaction; ?-gal, ?-galactosidase

    [0038] The present inventors and their colleagues have shown that the linkage of Mycobacterium tuberculosis heat shock protein 70 (HSP70) to human papillomavirus type 16 (HPV-16) oncoprotein E7 dramatically increased E7-specific CD8.sup.+ T cell precursors and enhance anti-tumor effects against an E7-expressing tumor in vaccinated mice (Chen et al., 2000, supra; U.S. Pat. No. 6,734,173).

    [0039] They have now adopted this strategy for Phase I/If clinical trials in patients with HPV-16 associated high-grade squamous intraepithelial lesion (HSIL) of the cervix and in patients with advanced HPV-associated head and neck squamous cell carcinoma (HNSCC). To do so, a GMP grade E7/HSP70 DNA vaccine was produced in the form of a naked DNA preparation based on the pNGVL4a plasmid (which plasmid was developed by the National Gene Vector Lab and has been approved for use in humans). The DNA molecule of the present invention has been termed pNGVL4a-Sig/E7(detox)/HSP70). A similar DNA vaccine for the E6 protein is also described below.

    [0040] The pNGVL4a-Sig/E7(detox)/HSP70 DNA vaccine was generated using the pNGVL4a vector as a backbone. This vector was originally derived from the pNGVL3 vector, which has been approved for human vaccine trials. The pNGVL4a vector includes two immunostimulatory sequences (tandem repeats of CpG dinucleotides) in the noncoding region. Whereas any other plasmid DNA that can transform either APCs or other cells which, via cross-priming, transfer the antigenic moiety to APCs, is useful in the present invention, PNGFVLA4 is preferred because of the fact that it has already been approved for human therapeutic use.

    [0041] The pNGVL4a-Sig/E7(detox)/HSP70 DNA vaccine also comprises a signal peptide (Sig) the purpose of which is to enhance the immune response to DNA immunizations via the intramuscular (i.m.) route. The Sig acts by facilitating release of a chimeric E7/HSP70 polypeptide from cells which have taken up and expressed the chimeric polypeptide encoded by the DNA construct. In the case of i.m. immunization, due to the absence in muscle of a high density of professional antigen presenting cells (APC) and the fact that injection of the DNA would not directly target APCs, it is desired to induce immunity via cross-priming. If the immunogenic protein, such as the E7/HSP70 chimeric polypeptide, cannot leave the cell in which it is made, primarily myocytes after i.m. injection, cross-priming will not occur. The Sig sequence is exploited to permit and promote secretion of the E7/HSP70 from the muscle cells in which it is first expressed. Any signal sequence known to promote the sorting of an attached peptide into the rough endoplasmic reticulum, resulting in processing for secretion, may be used in place of the Sig sequence [residues encoded by nucleotides 4056-4127?? of SEQ ID NO:13. In the process of protein secretion, amino-terminal signal sequences are key recognition elements (see below). The limits of variation permitted for functional signal sequences can readily be determined by replacement of the normal signal sequence of a protein that is naturally targeted for secretion, or a reporter protein (e.g., green fluorescent protein), with essentially random peptide sequences and testing for secretion. This has been done, for example, with yeast invertase by Kaiser C A et al., Science 1987, 235:312-317.

    [0042] As a protein begins to be assembled, the very first amino acids in the polypeptide chain indicate whether the protein is to be secreted or used in the cytosol. If a protein is destined for secretion, the first amino acids are a special sequence called the signal sequence. The synthesis halts until the ribosome docks at the rough endoplasmic reticulum (RER). Once docked, the synthesis continues, with the new protein threading into the RER. The signal sequence is then cleaved from the polypeptide chain. Often, too, further enzymes cut the protein in other places. Most secreted proteins are modified before secretion. Next vesicles containing the protein bud from the RER and move to nearby the nearby Golgi apparatus. This is comprised of a stack of large, flattened vesicles. The vesicles from the RER fuse with one end, adding their proteins to the first flattened vesicle. In turn, small vesicles bud from this structure and transfer the protein to the next layer of the stack. This continues until the protein winds up at the opposite end of the Golgi apparatus. Further modification of the protein typically occurs here, for example, glycosylation (if the secreted protein is to be a glycoprotein). This renders the secreted protein more polar. Once the protein has moved through the entire Golgi apparatus, secretion vesicles containing the protein bud off, and move to and attach to the plasma membrane and release their contents into the extracellular fluid through the process of exocytosis.

    [0043] The term signal sequence refers to a signal peptide, which is a peptide sequence that directs post translational uptake by organelles. Signal peptides are about 16-32 amino acids long are cleaved while proteins are still being processed. Signal peptides consist of one or more positively charged amino acids followed by 6-12 hydrophobic amino acids. Examples of such signal sequence may be found in any textbook of biochemistry or cell biology, for example, Albers, B. et al., Molecular Biology of the Cell, 4th Ed., Garland Science, New York, N.Y. (2002). One of ordinary skill in the art will readily appreciate how to select a signal sequence for use in accordance with this invention (as a substitute for the preferred Sig sequence noted herein).

    [0044] I.M. immunization with a secreted form of an antigen, i.e., that includes a signal peptide, will generate stronger CTL responses than i.m. immunization with a cytoplasmic form of antigen, suggesting that the priming of CTL responses after i.m. DNA immunization is facilitated by the cross-presentation of antigen by non-transfected professional APCs that have acquired the immunogen/antigen indirectly. See, for example, Boyle, J S et al., Int Immunol 1997, 9:1897-1906.

    [0045] In addition, when an oncoprotein or an epitope thereof is the immunizing moiety, it is necessary to reduce the tumorigenic risk of the vaccine itself. In the preferred embodiments, the HPV E7 or E6 antigens are oncogenic. Thus the E7 protein was doubly mutated to a form known as E7(detox) by substituting two amino acids at positions C.sup.24G (Cys.fwdarw.Gly) and E.sup.26G (Glu.fwdarw.Gly) and E.sup.26G (Glu.fwdarw.Gly). See SEQ ID NO:2. These substitutions completely eliminate the capacity of the E7 to binding capacity to Rb, as well as transforming activity.

    [0046] Another embodiment of the present invention comprises an antigenic epitope of the HPV E6 protein, preferably from HPV-16. The E6 proteins from cervical cancer-associated HPV types such as HPV-16 induce proteolysis of the p53 tumor suppressor protein through interaction with E6-AP. Human mammary epithelial cells (MECs) immortalized by E6 display low levels of p53. HPV-16 E6 as well as other cancer-related papillomavirus E6 proteins also binds the cellular protein E6BP (ERC-55). Several different E6 mutations are discussed below after the wild type sequence of E6 is presented. The studies describing these mutants (which are incorporated by reference in their entirety) are also discussed in that section.

    [0047] The present invention also includes the use of a tandem E6-E7 vaccine, using one or more of the mutations described herein to render the oncoproteins inactive with respect to their oncogenic potential in vivo. Cassetti M C et al., Vaccine. 2004, 22:520-527, described Venezuelan equine encephalitis virus replicon particle (VRP) vaccines encoding the HPV16 E6 and E7 genes in which the E6 and E7 genes were fused to create one open reading frame and mutated at four or at five amino acid positions (see below). Thus, the present constructs may include one or more epitopes of E6 and E7, which may be arranged in their native order, resulting in either a E6-E7 or E7-E6 sequence, or shuffled in any way that permits the expressed protein to bear the E6 and E7 antigenic epitope (in an immunogenic form and result in immunization of the vaccinated recipient. DNA encoding amino acid spacers between E6 and E7 or between individual epitopes of these proteins may be introduced into the vector, provided again, that the spacers permit the expression or presentation of the epitopes in an immunogenic manner after they have been expressed by transduced host cells.

    [0048] The order in which the two (or more) component polypeptides of the fusion protein are arranged, and therefore, the order of the encoding nucleic acid fragments in the nucleic acid vector, can be altered without affecting immunogenicity of the fusion polypeptides proteins and the utility of the composition. For example, the Hsp70-encoding DNA sequences may be located 5 or 3 to the target antigen-encoding sequences. In one embodiment, these polypeptide-encoding nucleic acid domains are in-frame so that the DNA construct encodes a recombinant fusion polypeptide in which the antigen is located N-terminal to the Hsp70 polypeptide. Of course, the signal peptide must be at the N-terminus of a nascent protein. Preferably, the DNA construct encodes a recombinant polypeptide in which the MEC class I restricted antigen, exemplified by mutant (detox) E7 (or E6) is located N-terminal to the HSP-derived residues.

    [0049] Heat Shock Proteins and Homologues

    [0050] Although the preferred DNA construct of the present invention encodes HSP70 from M. tuberculosis, any suitable heat shock protein (or stress protein) can be used in its place. Hsp60 and/or Hsp70 are preferred.

    [0051] Families of stress genes and proteins that can be used in the present invention are those well known in the art and include, for example, Hsp100-200, Hsp100, Hsp90, Lon, Hsp70, Hsp60, TF55, Hsp40, FKBPs, cyclophilins, Hsp20-30, ClpP, GrpE, Hsp10, ubiquitin, calnexin, and protein disulfide isomerases (Macario, A J Cold Spring Harbor Laboratory Res. 25:59-70, 1995; Parsell, D A et al., Ann. Rev. Genet. 27:437-496 (1993); U.S. Pat. No. 5,232,833. A preferred group of stress proteins includes Hsp90, Hsp70, Hsp60, Hsp20-30; most preferred are Hsp70 and Hsp60.

    [0052] Examples of Hsp100-200 include Grp170 (for glucose-regulated protein) which is found in the lumen of the ER, in the pre-Golgi compartment, and may play a role in immunoglobulin folding and assembly. Hsp100 members include mammalian Hsp110, yeast Hsp104, ClpA, ClpB, ClpC, ClpX and ClpY.

    [0053] Examples of Hsp90 proteins include HtpG in E. coli, Hsp83 and Hsc83 yeast, and Hsp90a, Hsp90a and Grp94 in humans. Hsp90 binds cellular regulatory proteins such as steroid hormone receptors, transcription factors and protein kinases that play a role in signal transduction mechanisms. Hsp90 proteins also participate in the formation of large, abundant protein complexes that include other stress proteins.

    [0054] Hsp70 examples include Hsp72 and Hsc73 from mammalian cells, products of the DnaK gene from bacteria, particularly mycobacteria such as M. leprae, M. tuberculosis, and M. bovis (such as BCG referred to herein as Hsp71), E. coli, other prokaryotes and yeast, and BiP and Grp78. Hsp70 can specifically binding ATP as well as unfolded polypeptides and peptides, thereby participating in protein folding and unfolding as well as in the assembly and disassembly of protein complexes.

    [0055] Examples of Hsp60 proteins include Hsp65 from mycobacteria. Bacterial Hsp60 is also commonly known as GroEL, such as the GroEL from E. coli. Hsp60 forms large homo-oligomeric complexes, and appears to play a key role in protein folding. Hsp60 homologues are present in eukaryotic mitochondria and chloroplasts.

    [0056] Examples of TF55 examples include Tcpl, TRiC and thermosome. The proteins typically occur in the cytoplasm of eukaryotes and some archaebacteria, and form multi-membered rings, promoting protein folding. They are also weakly homologous to Hsp60.

    [0057] Examples of Hsp40 include DnaJ gene products from prokaryotes such as E. coli and mycobacteria and HSJ1, 1113J1 and Hsp40. Hsp40 plays a role as a molecular chaperone in protein folding, thermotolerance and DNA replication, among other cellular activities.

    [0058] FKBPs examples include FKBP12, FKBP13, FKBP25, and FKBP59, Fprl and Nepl. The proteins typically have peptidyl-prolyl isomerase activity and interact with immunosuppressants such as FK506 and rapamycin. The proteins are typically found in the cytoplasm and the endoplasmic reticululum.

    [0059] Cyclophilin examples include cyclophilins A, B and C. The proteins have peptidyl-prolyl isomerase activity and interact with the immunosuppressant cyclosporin A. The protein cyclosporin A binds calcineurin (a protein phosphatase).

    [0060] Hsp20-30, also referred to as small Hsp, is typically found in large homo-oligomeric complexes or hetero-oligomeric complexes where an organism or cell expresses several different types of small Hsps. Hsp20-30 interacts with cytoskeletal structures, and may play a regulatory role in actin polymerization/depolymerization. Hsp20-30 is rapidly phosphorylated upon stressor exposure or exposure of resting cells to growth factors. Hsp20-30 homologues include ?-crystalline

    [0061] ClpP is an E. coli protease involved in degradation of abnormal proteins. Homologues of ClpP are found in chloroplasts. ClpP forms a hetero-oligomeric complex with ClpA.

    [0062] GrpE is an E. coli protein of about 20 kDa that is involved in both the rescue of stress-damaged proteins as well as the degradation of damaged proteins GrpE plays a role in the regulation of stress gene expression in E. coli.

    [0063] Hsp10 examples include GroES and Cpn10. Hsp10 is typically found in E. coli and in mitochondria and chloroplasts of eukaryotic cells. Hsp10 forms a seven-membered ring that associates with Hsp60 oligomers. Hsp10 is also involved in protein folding.

    [0064] Ubiquitin binds proteins in conjunction with proteolytic removal of the proteins by ATP-dependent cytosolic proteases.

    [0065] In particular embodiments, the Hsp's of the present invention are derived from enterobacteria, mycobacteria (particularly M. leprae, M. tuberculosis, M. vaccae, M. smegmatis and M. bovis), E. coli, yeast, Drosophila, vertebrates, avians or mammals, including rats, mice and primates, including humans.

    [0066] Homologues or variants of Hsp's as described herein, may also be used, provided that they have the requisite biological activity. These include various substitutions, deletions, or additions of the amino acid or nucleic acid sequences. Due to code degeneracy, for example, there may be considerable variation in nucleotide sequences encoding the same amino acid sequence.

    [0067] The present invention may employ fragments of Hsp's provided such fragments can enhance the immune response to an antigen with which they are paired.

    [0068] A preferred fragment is a C-terminal domain (CD) of Hsp70, which is designated Hsp70co. One Hsp70cD spans from about residue 312 to the C terminus of Hsp70 (SEQ ID NO:10). A preferred shorter polypeptide spans from about residue 517 to the C-terminus of SEQ ID NO:10. Shorter peptides from that sequence that have the ability to promote protein processing via the MHC-1 class I pathway are also included, and may be defined by routine experimentation.

    [0069] A functional derivative of Hsp70 retains measurable Hsp70-like activity, preferably that of promoting immunogenicity of one or more antigenic epitopes fused thereto by promoting presentation by class I pathways. Functional derivatives encompass variants and fragments regardless of whether the terms are used in the conjunctive or the alternative herein.

    [0070] A functional homologue must possess the above biochemical and biological activity. In view of this functional characterization, use of homologous Hsp70 proteins including proteins not yet discovered, fall within the scope of the invention if these proteins have sequence similarity and the recited biochemical and biological activity.

    [0071] To determine the percent identity of two amino acid sequences or of two nucleic acid sequences, the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second amino acid or nucleic acid sequence for optimal alignment and non-homologous sequences can be disregarded for comparison purposes). In a preferred method of alignment, Cys residues are aligned.

    [0072] In a preferred embodiment, the length of a sequence being compared is at least 30%, preferably at least 40%, more preferably at least 50%, even more preferably at least 60%, and even more preferably at least 70%, 80%, or 90% of the length of the reference sequence (e.g., Hsp70, SEQ ID NO:10). The amino acid residues (or nucleotides) at corresponding amino acid (or nucleotide) positions are then compared. When a position in the first sequence is occupied by the same amino acid residue (or nucleotide) as the corresponding position in the second sequence, then the molecules are identical at that position (as used herein amino acid or nucleic acid identity is equivalent to amino acid or nucleic acid homology). The percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences.

    [0073] The comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm. In a preferred embodiment, the percent identity between two amino acid sequences is determined using the Needleman and Wunsch (J. Mol Biol. 48:444-453 (1970) algorithm which has been incorporated into the GAP program in the GCG software package (available at http://wvVw.gcg.com), using either a Blossom 62 matrix or a PAM250 matrix, and a gap weight of 16, 14, 12, 10, 8, 6, or 4 and a length weight of 1, 2, 3, 4, 5, or 6. In yet another preferred embodiment, the percent identity between two nucleotide sequences is determined using the GAP program in the GCG software package (available at http://www.gcg.com), using a NWSgapdna.CMP matrix and a gap weight of 40, 50, 60, 70, or 80 and a length weight of 1, 2, 3, 4, 5, or 6. In another embodiment, the percent identity between two amino acid or nucleotide sequences is determined using the algorithm of E. Meyers and W. Miller (CABIOS, 4:11-17 (1989)) which has been incorporated into the ALIGN prograth (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.

    [0074] The nucleic acid and protein sequences of the present invention can further be used as a query sequence to perform a search against public databases, for example, to identify other family members or related sequences. Such searches can be performed using the NBLAST and) XBLAST programs (version 2.0) of Altschul et al. (1990) J. Mol. Biol. 215:403-10. BLAST nucleotide searches can be performed with the NBLAST program, score=100, wordlength=12 to obtain nucleotide sequences homologous to Hsp70 or FL nucleic acid molecules. BLAST protein searches can be performed with the XBLAST program, score=50, wordlength=3 to obtain amino acid sequences homologous to HVP22 protein molecules. To obtain gapped alignments for comparison purposes, Gapped BLAST can be utilized as described in Altschul et al. (1997) Nucleic Acids Res. 25:3389-3402. When utilizing BLAST and Gapped BLAST programs, the default parameters of the respective programs (e.g., XBLAST and NBLAST) can be used. See http://www.ncbi.nlm.nih.gov.

    [0075] Thus, a homologue of Hsp70 described above is characterized as having (a) functional activity of native Hsp70 and (b) sequence similarity to a native Hsp70 protein (such as SEQ ID NO:10) when determined as above, of at least about 20% (at the amino acid level), preferably at least about 40%, more preferably at least about 70%, even more preferably at least about 90%.

    [0076] It is within the skill in the art to obtain and express such a protein using DNA probes based on the disclosed sequences of Hsp70. Then, the fusion protein's biochemical and biological activity can be tested readily using art-recognized methods such as those described herein, for example, a T cell proliferation, cytokine secretion or a cytolytic assay, or an in vivo assay of tumor protection or tumor therapy. A biological assay of the stimulation of antigen-specific T cell reactivity will indicate whether the homologue has the requisite activity to qualify as a functional homologue.

    [0077] A variant refers to a molecule substantially identical to either the full protein or to a fragment thereof in which one or more amino acid residues have been replaced (substitution variant) or which has one or several residues deleted (deletion variant) or added (addition variant). A fragment of Hsp70 refers to any subset of the molecule, that is, a shorter polypeptide of the full-length protein.

    [0078] A number of processes can be used to generate fragments, mutants and variants of the isolated DNA sequence. Small subregions or fragments of the nucleic acid encoding the spreading protein, for example 1-30 bases in length, can be prepared by standard, chemical synthesis. Antisense oligonucleotides and primers for use in the generation of larger synthetic fragment.

    [0079] A preferred group of variants are those in which at least one amino acid residue and preferably, only one, has been substituted by different residue. For a detailed description of protein chemistry and structure, see Schulz, G E et al., Principles of Protein Structure, Springer-Verlag, New York, 1978, and Creighton, T. E., Proteins: Structure and Molecular Properties, W.H. Freeman & Co., San Francisco, 1983, which are hereby incorporated by reference. The types of substitutions that may be made in the protein molecule may be based on analysis of the frequencies of amino acid changes between a homologous protein of different species, such as those presented in Table 1-2 of Schulz et al. (supra) and FIGS. 3-9 of Creighton (supra). Based on such an analysis, conservative substitutions are defined herein as exchanges within one of the following five groups:

    TABLE-US-00001 1 Small aliphatic, nonpolar or slightly polar Ala, Ser, Thr (Pro, Gly); residues 2 Polar, negatively charged residues and Asp, Asn, Glu, Gln; their amides 3 Polar, positively charged residues His, Arg, Lys; 4 Large aliphatic, nonpolar residues Met, Leu, Ile, Val (Cys) 5 Large aromatic residues Phe, Tyr, Trp.

    [0080] The three amino acid residues in parentheses above have special roles in protein architecture. Gly is the only residue lacking a side chain and thus imparts flexibility to the chain. Pro, because of its unusual geometry, tightly constrains the chain. Cys can participate in disulfide bond formation, which is important in protein folding.

    [0081] More substantial changes in biochemical, functional (or immunological) properties are made by selecting substitutions that are less conservative, such as between, rather than within, the above five groups. Such changes will differ more significantly in their effect on maintaining (a) the structure of the peptide backbone in the area of the substitution, for example, as a sheet or helical conformation, (b) the charge or hydrophobicity of the molecule at the target site, or (c) the bulk of the side chain. Examples of such substitutions are (i) substitution of Gly and/or Pro by another amino acid or deletion or insertion of Gly or Pro; (ii) substitution of a hydrophilicresidue, e.g., Ser or Thr, for (or by) a hydrophobic residue, e.g., Leu, Ile, Phe, Val or Ala; (iii) substitution of a Cys residue for (or by) any other residue; (iv) substitution of a residue having an electropositive side chain, e.g., Lys, Arg or His, for (or by) a residue having an electronegative charge, e.g., Glu or Asp; or (v) substitution of a residue having a bulky side chain, e.g., Phe, for (or by) a residue not having such a side chain, e.g., Gly.

    [0082] Most acceptable deletions, insertions and substitutions according to the present invention are those that do not produce radical changes in the characteristics of the wild-type or native protein in terms of its intercellular spreading activity and its ability to stimulate antigen specific T cell reactivity to an antigenic epitope or epitopes that are fused to the spreading protein. However, when it is difficult to predict the exact effect of the substitution, deletion or insertion in advance of doing so, one skilled in the art will appreciate that the effect can be evaluated by routine screening assays such as those described here, without requiring undue experimentation.

    [0083] Whereas shorter chain variants can be made by chemical synthesis, for the present invention, the preferred longer chain variants are typically made by site-specific mutagenesis of the nucleic acid encoding the polypeptide, expression of the variant nucleic acid in cell culture, and, optionally, purification of the polypeptide from the cell culture, for example, by immunoaffinity chromatography using specific antibody immobilized to a column (to absorb the variant by binding to at least one epitope).

    [0084] In the above composition, the HSP70 or other stress protein preferably acts in potentiating an immune response by promoting: processing of the linked antigenic polypeptide via the MHC class I pathway or targeting of a cellular compartment that increases the processing. This basic strategy may be combined with an additional strategy pioneered by the present inventors and colleagues, that involve linking DNA encoding another protein, generically termed a targeting polypeptide, to the antigen-encoding DNA. Again, for the sake of simplicity, the DNA encoding such a targeting polypeptide will be referred to herein as a targeting DNA. That strategy has been shown to be effective in enhancing the potency of the vectors carrying only antigen-encoding DNA. See for example: Wu et al., WO 01/29233; Wu et al., WO 02/009645; Wu et al., WO 02/061113; Wu et al., WO 02/074920; Wu et al., WO 02/12281, all of which are incorporated by reference in their entirety. The other strategies include the use of DNA encoding polypeptides that promote or enhance: [0085] (a) development, accumulation or activity of antigen presenting cells or targeting of antigen to compartments of the antigen presenting cells leading to enhanced antigen presentation; [0086] (b) intercellular transport and spreading of the antigen; or [0087] (c) any combination of (a) and (b). [0088] (d) sorting of the lysosome-associated membrane protein type 1 (Sig/LAMP-1) [0089] (e) a viral intercellular spreading protein selected from the group of herpes simplex virus-1 VP22 protein, Marek's disease virus VP22 protein or a functional homologue or derivative thereof; [0090] (f) an endoplasmic reticulum chaperone polypeptide selected from the group of calreticulin, ER60, GRP94, gp96, or a functional homologue or derivative thereof [0091] (g) a cytoplasmic translocation polypeptide domains of a pathogen toxin selected from the group of domain II of Pseudomonas exotoxin ETA or a functional homologue or derivative thereof; [0092] (h) a polypeptide that targets the centrosome compartment of a cell selected from y-tubulin or a functional homologue or derivative thereof; or [0093] (i) a polypeptide that stimulates dendritic cell precursors or activates dendritic cell activity selected from the group of GM-CSF; Flt3-ligand extracellular domain, or a functional homologue or derivative thereof; or [0094] (j) a costimulatory signal, such as a B7 family protein, including B7-DC (see U.S. Ser. No. 09/794,210), B7.1, B7.2, soluble CD40, etc.). [0095] (k) an anti-apoptotic polypeptide preferably selected from the group consisting of (1) BCL-xL, (2) BCL2, (3) XIAP, (4) FLICEc-s, (5) dominant-negative caspase-8, (6) dominant negative caspase-9, (7) SPI-6, and (8) a functional homologue or derivative of any of (1)-(7).

    [0096] The details of the various targeting polypeptide strategies will not be discussed in detail herein, although such vectors are used in the present examples, and their sequences are provided below. The preferred targeting polypeptide include the sorting signal of the lysosome-associated membrane protein type 1 (Sig/LAMP-1), which is the Sig in the preferred construct, the translocation domain (domain II or dII) of Pseudomonas aeruginosa exotoxin A (ETA(dI1) (or from similar toxins from Diphtheria, Clostridium, Botulinum, Bacillus, Yersinia, Vibrio cholerae, or Bordetella), an endoplasmic reticulum chaperone polypeptide exemplified by calreticulin (CRT) but also including ER60, GRP94 or gp96, well-characterized ER chaperone polypeptide that representatives of the HSP90 family of stress-induced proteins (see WO 02/012281), VP22 protein from herpes simplex virus and related herpes viruses such as Marek's disease virus (see WO 02/09645), and ?-tubulin. DNA encoding each of these polypeptides, or fragments or variants thereof with substantially the same biological activity, when linked to an antigen-encoding or epitope-encoding DNA molecule, and an HSP70 sequence result in more potent T cell mediate responses to the antigen compared to immunization with the antigen-encoding DNA alone or the antigen-HSP-70 chimeric construct. These polypeptide can be considered as molecular adjuvants. These effects are manifest primarily with CD8.sup.+ T cells, although some of these approaches induce potent CD4.sup.+ T cell mediated effects as well.

    [0097] The experiments described herein demonstrate that the methods of the invention can enhance a cellular immune response, particularly, tumor-destructive CTL reactivity, induced by a DNA vaccine encoding an epitope of a human pathogen. Human HPV-16 E7 was used as a model antigen for vaccine development because human papillomaviruses (HPVs), particularly HPV-16, are associated with most human cervical cancers. The oncogenic HPV proteins E7 and E6 are important in the induction and maintenance of cellular transformation and co-expressed in most HPV-containing cervical cancers and their precursor lesions. Therefore, cancer vaccines, such as the compositions of the invention, that target E7 or E6 can be used to control of HPV-associated neoplasms (Wu (1994) Curr. Opin. Immunol. 6:746-754).

    [0098] However, the present invention is not limited to the exemplified antigen(s). Rather, one of skill in the art will appreciate that the same results are expected for any antigen (and epitopes thereof) for which a T cell-mediated response is desired. The response so generated will be effective in providing protective or therapeutic immunity, or both, directed to an organism or disease in which the epitope or antigenic determinant is involvedfor example as a cell surface antigen of a pathogenic cell or an envelope or other antigen of a pathogenic virus, or a bacterial antigen, or an antigen expressed as or as part of a pathogenic molecule.

    [0099] Thus, in one embodiment, the antigen (e.g., the MHC class I-binding peptide epitope) is derived from a pathogen, e.g., it comprises a peptide expressed by a pathogen. The pathogen can be a virus, such as, e.g., a papilloma virus, a herpesvirus, a retrovirus (e.g., an immunodeficiency virus, such as HIV-1), an adenovirus, and the like. The papilloma virus can be a human papilloma virus; for example, the antigen (e.g., the Class I-binding peptide) can be derived from an HPV-16 E6 or E7 polypeptide. In a preferred embodiment, the HPV-16 E6 or E7 polypeptide used as an immunogen is substantially non-oncogenic, i.e., it does not bind retinoblastoma polypeptide (pRB) or binds pRB with such low affinity that the HPV-16 E7 polypeptide is effectively non-oncogenic when expressed or delivered in vivo, which is accomplished as described herein.

    [0100] In alternative embodiments, the pathogen is a bacteria, such as Bordetella pertussis; Ehrlichia chaffeensis; Staphylococcus aureus; Toxoplasma gondii; Legionella pneumophila; Brucella suis; Salmonella enterica; Mycobacterium avium; Mycobacterium tuberculosis; Listeria monocytogenes; Chlamydia trachomatis; Chlamydia pneumoniae; Rickettsia rickettsii; or, a fungus, such as, e.g., Paracoccidioides brasiliensis; or other pathogen, e.g., Plasmodium falciparum.

    [0101] In another embodiment, the MHC class 1-binding antigenic peptide epitope is derived from a tumor cell. The tumor cell-derived peptide epitope can comprise a tumor associated antigen, e.g., a tumor specific antigen, such as, e.g., a HER-2/neu antigen, or one of a number of known melanoma antigens, etc.

    [0102] In one embodiment, the isolated or recombinant nucleic acid molecule is operatively linked to a promoter, such as, e.g., a constitutive, an inducible or a tissue-specific promoter. The promoter can be expressed in any cell, including cells of the immune system, including, e.g., antigen presenting cells (APCs), e.g., in a constitutive, an inducible or a tissue-specific manner.

    [0103] Unless defined otherwise, all technical and scientific terms used herein have the meaning commonly understood by a person skilled in the art of this invention. As used herein, the following terms have the meanings ascribed to them unless specified otherwise.

    [0104] The term antigen or immunogen as used herein refers to a compound or composition comprising a peptide, polypeptide or protein which is antigenic or immunogenic when administered (or expressed in vivo by an administered nucleic acid, e.g., a DNA vaccine) in an appropriate amount (an immunogenically effective amount), i.e., capable of inducing, eliciting, augmenting or boosting a cellular and/or humoral immune response either alone or in combination or linked or fused to another substance (which can be administered at once or over several intervals). An immunogenic composition can comprise an antigenic peptide of at least about 5 amino acids, a peptide of 10 amino acids in length, a polypeptide fragment of 15 amino acids in length, 20 amino acids in length or longer. Smaller immunogens may require presence of a carrier polypeptide e.g., as a fusion protein, aggregate, conjugate or mixture, preferably linked (chemically or otherwise) to the immunogen. The immunogen can be recombinantly expressed from a vaccine vector, which can be naked DNA comprising the immunogen's coding sequence operably linked to a promoter, e.g., an expression cassette as described herein. The immunogen includes one or more antigenic determinants or epitopes which may vary in size from about 3 to about 15 amino acids.

    [0105] The term vaccine is used interchangeably with immunogen when referring to the DNA compositions of the present invention. Similarly, the terms vaccinate and immDni7e are used interchangeably here.

    [0106] The term epitope as used herein refers to an antigenic determinant or antigenic site that interacts with an antibody or a T cell receptor (TCR), e.g., the MHC class I-binding peptide compositions (or expressed products of the nucleic acid compositions of the invention) used in the methods of the invention. An antigen is a molecule or chemical structure that either induces an immune response or is specifically recognized or bound by the product or mediator of an immune response, such as an antibody or a CTL. The specific conformational or stereochemical domain to which an antibody or a TCR bind is an antigenic determinant or epitope. TCRs bind to peptide epitopes which are physically associated with a third molecule, a major histocompatibility complex (MHC) class I or class II protein.

    [0107] The term recombinant refers to (1) a nucleic acid or polynucleotide synthesized or otherwise manipulated in vitro, (2) methods of using recombinant DNA technology to produce gene products in cells or other biological systems, or (3) a polypeptide encoded by a recombinant nucleic acid. For example, the HSP70-encoding nucleic acid or polypeptide, the nucleic acid encoding an MHC class I-binding peptide epitope (antigen) or the peptide itself can be recombinant. Recombinant means includes ligation of nucleic acids having various coding regions or domains or promoter sequences from different sources into a single unit in the form of an expression cassette or vector for expression of the coding sequences in the vectors resulting in production of the encoded polypeptide.

    [0108] The term self-replicating RNA replicon refers to a construct based on an RNA viruses, such as alphavirus genome RNAs (e.g., Sindbis virus, Semliki Forest virus, etc.), that have been engineered to allow expression of heterologous RNAs and proteins. These recombinant vectors are self-replicating (replicons) which can be introduced into cells as naked RNA or DNA, as described in detail in co-pending, commonly assigned U.S. and PCT patent applications by several of the present inventors (U.S. Ser. No. 10/060,274, and WO 02/061113).

    [0109] Sequences of Polypeptides and Nucleic Acids

    [0110] Plasmid and Vector Sequences

    [0111] The wild-type HPV E7 sequence (nucleotide sequence is SEQ ID NO:1 used in the present invention, albeit with several mutations, and the wild-type amino acid sequence is SEQ ID NO:2) is shown below. Underlined codons and amino acids are those which are preferably mutated in the present constructs.

    TABLE-US-00002 1/131/11 atgcatggagatacacctacattgcatgaatatatgttagatttgcaaccagagacaact MetHisGlyAspThrProThrLeuHisGluTyrMetLeuAspLeuGlnProGluThrThr 61/2191/31 gatctctactgttatgagcaattaaatgacagctcagaggaggaggatgaaatagatggt AspLeuTyrCysTyrGluGlnLeuAsnAspSerSerGluGluGluAspGluIleAspGly 121/41151/51 ccagctggacaagcagaaccggacagagcccattacaatattgtaaccttttgttgcaag ProAlaGlyGlnAlaGluProAspArgAlaHisTyrAsnIleValThrPheCysCysLys 181/61211/71 tgtgactctacgcttcggttgtgcgtacaaagcacacacgtagacattcgtactttggaa CysAspSerThrLeuArgLeuCysValGlnSerThrHisValAspIleArgThrLeuGlu 241/81271/91 gacctgttaatgggcacactaggaattgtgtgccccatctgttctcaggataagctt AspLeuLeuMetGlyThrLeuGlyIleValCysProIleCysSerGlnAspLysLeu

    [0112] The above sequence differs from the GENEBANK Accession Number NC_001526 for the E7 protein which is:

    TABLE-US-00003 MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCK CDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP97(SEQIDNO:3)

    [0113] The HPV16 E7 protein binds Rb through an L-X-C-X-E motif. Mutations at positions Cys24 and Glu26 of this motif destroy Rb binding and degradation. In addition to these two point mutations in E7, a mutation at a third amino acid, Cys91, destroys the single zinc finger in E7. In a preferred embodiment, all wild type amino acids are mutated to Gly. In another embodiment, these residues are mutated to Ala. In fact, they can be mutated to any residue that will permit the protein to be expressed in transduced cells, secreted in immunogenic form, taken up by professional APCs, and presented to T cells in a way that will preserve antigenic specificity, while at the same time preventing or lowering the probability that the protein will have oncogenic transforming capacity. The above statement is true with respect to the HPV E6 protein described below.

    [0114] To reduce oncogenic potential of E7 in a construct of this invention, one or more of the following positions of E7 is mutated:

    TABLE-US-00004 Preferred in Original Mutant condon Position residue residue mutation SEQIDNO:2 Cys Gly(orAla) TGT.fwdarw.GGT 24 Glu Gly(orAla) GAG.fwdarw.GGG 26 (orGCG) Cys Gly(orAla) TGC.fwdarw.GGC 91

    [0115] The E7 (detox) mutant sequence included in the preferred vaccine vector (SEQ ID NO:13) has the mutations shown in FIG. 5Bnamelya tgt.fwdarw.ggt mutation resulting in a Cys.fwdarw.Gly substitution at position 24 of SEQ ID NO:2 and a gag.fwdarw.gg mutation resulting in a Glu.fwdarw.Gly substitution at position 26 or SEQ ID NO:2.

    E6 Protein

    [0116] The wild type I-IPV E6 amino acid sequence (GENEBANK Accession Number NC_001526) (SEQ ID NO:4) is shown below. This sequence has 158 amino acids.

    TABLE-US-00005 MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVYC KQQLLRREVYDFAFRDLCIVYRDGNPYAVCDKCLKFYSKI SEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPE EKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL

    [0117] The preferred amino acid residues to be mutated (as discussed below) are underscored above. The studies of E6 mutants discussed below are based upon a different E6 sequence, of 151 nucleic acids, wherein the N-terminal residue was considered to be the Met at position 8 in SEQ ID NO:4. That shorter version of E6 is shown below as SEQ ID NO:5.

    TABLE-US-00006 MFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRR EVYDFAFRDLCIVYRDGNPYAVCDKCLKFYSKISEYRHYC YSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPEEKQRHLD KKQRFHNIRGRWTGRCMSCCRSSRTRRETQL

    [0118] The preferred amino acid residues to be mutated (as discussed below) are underscored above.

    [0119] Any nucleotide sequence that encodes encoding this E6 polypeptide, or preferably, one of the mutants thereof discussed below, or an antigenic fragment or epitope thereof, can be used in the present vectors. Other mutations can be tested and used in accordance with the methods described herein, or those described by Cassatti et al., supra.

    [0120] To reduce oncogenic potential of E6 in a construct of this invention, one or more of the following positions of E6 is mutated:

    TABLE-US-00007 Position in Position in Original residue Mutant residue SEQ ID NO: 4 SEQ ID NO: 5 Ile Thr 135 128 Cys Gly (or Ala) 70 63 Cys Gly (or Ala) 113 106

    [0121] These mutations can be achieved using any appropriate coding sequences by mutation of the coding DNA.

    [0122] The studies describing these mutants (which are incorporated by reference in their entirety) are discussed below. Nguyen M et al., J Virol. 2002, 6:13039-13048, described a mutant of HPV-16 E6 deficient in binding a-helix partners which displays reduced oncogenic potential in vivo. This mutant, that involves a replacement of Ile with Thr as position 128 (of SEQ ID NO:5), may be used in accordance with the present invention to make an E6 DNA vaccine that has a lower risk of being oncogenic. This E6(I.sup.128T) mutant is defective for binding at least a subset of the a-helix partners, including E6AP, the ubiquitin ligase that mediates E6-dependent degradation of the p53 protein,

    [0123] Cassetti et al., supra, examined the effects of mutations four or five amino acid positions in E6 and E7 to inactivate their oncogenic potential. The following mutations were examined (positions based on SEQ ID NO:5): E6-C.sup.63G; E6 C.sup.106G; E7-C.sup.24G, E7-E.sup.26G, and E7 C.sup.91G. Vaccines encoding mutant or wild type E6 and E7 proteins elicited comparable CTL responses and generated comparable antitumor responses in several HPV16 E6(+)E7(+) tumor challenge models: protection from either C3 or TC-1 tumor challenge was observed in 100% of vaccinated mice. Eradication of C3 tumors was observed in approximately 90%. The predicted inactivation of, E6 and E7 oncogenic potential was confirmed by demonstrating normal levels of both p53 and Rb proteins in human mammary epithelial cells infected with VRP expressing mutant E6 and E7 genes.

    [0124] Approaches for Mutagenesis of E6 and E7

    [0125] The HPV16 E6 protein contains two zinc fingers important for structure and function; one cysteine (C) amino acid position in each pair of CXXC (where X is any amino acid) zinc finger motifs are preferably was mutated at E6 positions 63 and 106 (based on SEQ ID NO:5). Mutants are created, for example, using the Quick Change Site-Directed Mutagenesis Kit (Stratagene, La Jolla, Calif.). HPV16 E6 containing a single point mutation at Cys106 (of Cys 113 per SEQ ID NO:4). Cys neither binds nor facilitates degradation of p53 and is incapable of immortalizing human mammary epithelial cells (MEC), a phenotype dependent upon p53 degradation. A single amino acid substitution at position Cys63 of SEQ ID NO:3 (=Cys70 in SEQ ID NO:4) destroys several HPV16 E6 functions: p53 degradation, E6TP-1 degradation, activation of telomerase, and, consequently, immortalization of primary epithelial cells.

    Sequences of DNA Encoding Immunogenicity-Potentiating Polypeptides and Their Vectors

    [0126] The preferred nucleotide [SEQ ID NO:6] and amino acid sequence [SEQ ID NO:7] of Sig/E7 are as follows: the Sig sequence is underscored:

    TABLE-US-00008 MAAPGARRPLLLLLLAGLAHGASALFEDLIMHGDTPTLHE YMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRA HYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIV CPICSQP

    [0127] A preferred nucleic acid sequence encoding a 30 residue Sig sequence is shown below (SEQ ID NO:8).

    TABLE-US-00009 atggcggcccccggcgcccggcggccgctgctcctg ctgctgctggcaggccttgcacatggcgcctcagca ctctttgaggatctaatc

    [0128] In another embodiment, the sequence is a C-terminally truncated version of SEQ ID NO:8, encoding from about 15-25 of the N-terminal residues of SEQ ID NO:8. As noted elsewhere, any known signal sequence may be substituted for this one in the present construct.

    HSP70 From M. tuberculosis

    [0129] The nucleotide sequence encoding HSP70 (SEQ ID NO:9) is shown below and is deposited in GENBANK; nucleotides 10633-12510 of the M. tuberculosis genome.

    TABLE-US-00010 atggctcgtgcggtcgggatcgacctcgggaccaccaa ctccgtcgtctcggttctggaaggtggcga cccggtcgtcgtcgccaactccgagggctccaggaccacc ccgtcaattgtcgcgttcgcccgcaacggt gaggtgctggtcggccagcccgccaagaaccaggcagtga ccaacgtcgatcgcaccgtgcgctcggtca agcgacacatgggcagcgactggtccatagagattgacgg caagaaatacaccgcgccggagatcagcgc ccgcattctgatgaagctgaagcgcgacgccgaggcctac ctcggtgaggacattaccgacgcggttatc acgacgcccgcctacttcaatgacgcccagcgtcaggcca ccaaggacgccggccagatcgccggcctca acgtgctgcggatcgtcaacgagccgaccgcggccgcgct ggcctacggcctcgacaagggcgagaagga gcagcgaatcctggtcttcgacttgggtggtggcactttc gacgtttccctgctggagatcggcgagggt gtggttgaggtccgtgccacttcgggtgacaaccacctcg gcggcgacgactgggaccagcgggtcgtcg attggctggtggacaagttcaagggcaccagcggcatcga tctgaccaaggacaagatggcgatgcagcg gctgcgggaagccgccgagaaggcaaagatcgagctgagt tcgagtcagtccacctcgatcaacctgccc tacatcaccgtcgacgccgacaagaacccgttgttcttag acgagcagctgacccgcgcggagttccaac ggatcactcaggacctgctggaccgcactcgcaagccgtt ccagtcggtgatcgctgacaccggcatttc ggtgtcggagatcgatcacgttgtgctcgtgggtggttcg acccggatgcccgcggtgaccgatctggtc aaggaactcaccggcggcaaggaacccaacaagggcgtca accccgatgaggttgtcgcggtgggagccg ctctgcaggccggcgtcctcaagggcgaggtgaaagacgt tctgctgcttgatgttaccccgctgagcct gggtatcgagaccaagggcggggtgatgaccaggctcatc gagcgcaacaccacgatccccaccaagcgg tcggagactttcaccaccgccgacgacaaccaaccgtcgg tgcagatccaggtctatcagggggagcgtg agatcgccgcgcacaacaagttgctcgggtccttcgagct gaccggcatcccgccggcgccgcgggggat tccgcagatcgaggtcactttcgacatcgacgccaacggc attgtgcacgtcaccgccaaggacaagggc accggcaaggagaacacgatccgaatccaggaaggctcgg gcctgtccaaggaagacattgaccgcatga tcaaggacgccgaagcgcacgccgaggaggatcgcaagcg tcgcgaggaggccgatgttcgtaatcaagc cgagacattggtctaccagacggagaagttcgtcaaagaa cagcgtgaggccgagggtggttcgaaggta cctgaagacacgctgaacaaggttgatgccgcggtggcgg aagcgaaggcggcacttggcggatcggata tttcggccatcaagtcggcgatggagaagctgggccagga gtcgcaggctctggggcaagcgatctacga agcagctcaggctgcgtcacaggccactggcgctgcccac cccggcggcgagccgggcggtgcccacccc ggctcggctgatgacgttgtggacgcggaggtggtcgacg acggccgggaggccaagtga
    The amino acid sequence of HSP70 [SEQ ID NO:10] is:

    TABLE-US-00011 MARAVGIDLGTTNSVVSVLEGGDPVVVANSEGSRTTPSIVAFARNGEVLVGQPAKNQAVTNVDRTVRSVK RHMGSDWSIEIDGKKYTAPEISARILMKLKRDAEAYLGEDITDAVITTPAYFNDAQRQATKDAGQIAGLN VLRIVNEPTAAALAYGLDKGEKEQRILVFDLGGGTFDVSLLEIGEGVVEVRATSGDNHLGGDDWDQRVVD WLVDKFKGTSGIDLTKDKMAMQRLREAAEKAKIELSSSQSTSINLPYITVDADKNPLFLDEQLTRAEFQR ITQDLLDRTRKPFQSVIADTGISVSEIDHVVLVGGSTRMPAVTDLVKELTGGKEPNKGVNPDEVVAVGAA LQAGVLKGEVKDVLLLDVTPLSLGIETKGGVMTRLIERNTTIPTKRSETFTTADDNQPSVQIQVYQGERE IAAHNKLLGSFELTGIPPAPRGIPQIEVTFDIDANGIVHVTAKDKGTGKENTIRIQEGSGLSKEDIDRMI KDAEAEAEEDRKRREEADVRNQAETLVYQTEKFVKEQREAEGGSKVPEDTLNKVDAAVAEAKAALGGSDI SAIKSAMEKLGQESQALGQAIYEAAQAASQATGAAHPGGEPGGAHPGSADDVVDAEVVDDGREAK 625

    [0130] A preferred E7-Hsp70 chimera or fusion (nucleic acid is SEQ ID NO:11; amino acids are SEQ ID NO:12) is shown below (using the wild-type E7 coding sequence which is capitalized, is shown below. For the present construct, the relevant condons/residues discussed above are mutated as described.

    TABLE-US-00012 1/131/11 ATGCATGGAGATACACCTACATTGCATGAATATATGTTAGATTTGCAACCAGAGACAACT Methisglyaspthrprothrleuhisglutyrmetleuaspleuglnprogluthrthr 61/2191/31 GATCTCTACTGTTATGAGCAATTAAATGACAGCTCAGAGGAGGAGGATGAAATAGATGGT aspleutyrcystyrgluglnleuasnaspsersergluglugluaspgluileaspgly 121/41151/51 CCAGCTGGACAAGCAGAACCGGACAGAGCCCATTACAATATTGTAACCTTTTGTTGCAAG proalaglyglnalagluproaspargalahistyrasnilevalthrphecyscyslys 181/61211/71 TGTGACTCTACGCTTCGGTTGTGCGTACAAAGCACACACGTAGACATTCGTACTTTGGAA cysaspserthrleuargleucysvalglnserthrhisvalaspileargthrleuglu 241/81271/91 GACCTGTTAATGGGCACACTAGGAATTGTGTGCCCCATCTGTTCTCAAGGATCCATGGCT aspleuleumetglythrleuglyilevalcysproilecysserglnglysermetala 301/101331/111 cgtgcggtcgggatcgacctcgggaccaccaactccgtcgtctcggttctggaaggtggc argalavalglyileaspleuglythrthrasnservalvalservalleugluglygly 361/121391/131 gaccoggtcgtcgtcgccaactccgagggctccaggaccacccogtcaattgtcgcgttc aspprovalvalvalalaasnsergluglyserargthrthrproserilevalalaphe 421/141451/151 gcccgcaacggtgaggtgctggtcggccagcccgccaagaaccaggcagtgaccaacgtc alaargasnglygluvalleuvalglyglnproalalysasnglnalavalthrasnval 481/161511/171 gatcgcaccgtgcgctcggtcaagcgacacatgggcagcgactggtccatagagattgac aspargthrvalargservallysarghismetglyserasptrpserilegluileasp 541/181571/191 ggcaagaaatacaccgcgccggagatcagcgcccgcattctgatgaagctgaagcgcgac glylyslystyrthralaprogluileseralaargileleumetlysleulysargasp 601/201631/211 gccgaggcctacctcggtgaggacattaccgacgcggttatcacgacgcccgcctacttc alaglualatyrleuglygluaspilethraspalavalilethrthrproalatyrphe 661/221691/231 aatgacgcccagcgtcaggccaccaaggacgccggccagatcgccggcctcaacgtgctg asnaspalaglnargglnalathrlysaspalaglyglnilealaglyleuasnvalleu 721/241751/251 cggatcgtcaacgagccgaccgcggccgcgctggcctacggcctcgacaagggcgagaag argilevalasngluprothralaalaalaleualatyrglyleuasplysglyglulys 781/261811/271 gagcagcgaatcctggtcttcgacttgggtggtggcactttcgacgtttccctgctggag gluglnargileleuvalpheaspleuglyglyglythrpheaspvalserleuleuglu 841/281871/291 atcggcgagggtgtggttgaggtccgtgccacttcgggtgacaaccacctcggcggcgac ileglygluglyvalvalgluvalargalathrserglyaspasnhisleuglyglyasp 901/301931/331 gactgggaccagcgggtcgtcgattggctggtggacaagttcaagggcaccagcggcatc asptrpaspglnargvalvalasptrpleuvalasplysphelysglythrserglyile 961/321991/331 gatctgaccaaggacaagatggcgatgcagcggctgcgggaagccgccgagaaggcaaag aspleuthrlysasplysmetalametglnargleuargglualaalaglulysalalys 1021/3411051/351 atcgagctgagttcgagtcagtccacctcgatcaacctgccctacatcaccgtcgacgcc ilegluleuserserserglnserthrserileasnleuprotyrilethrvalaspala 1081/3611111/371 gacaagaacccgttgttcttagacgagcagctgacccgcgcggagttccaacggatcact asplysasnproleupheleuaspgluglnleuthrargalaglupheglnargilethr 1141/3811171/391 caggacctgctggaccgcactcgcaagccgttccagtcggtgatcgctgacaccggcatt glnaspleuleuaspargthrarglyspropheglnservalilealaaspthrglyile 1201/4011231/411 tcggtgtcggagatcgatcacgttgtgctcgtgggtggttcgacccggatgcccgcggtg servalsergluileasphisvalvalleuvalglyglyserthrargmetproalaval 1261/4211291/431 accgatctggtcaaggaactcaccggcggcaaggaacccaacaagggcgtcaaccccgat thraspleuvallysgluleuthrglyglylysgluproasnlysglyvalasnproasp 1321/4411351/451 gaggttgtcgcggtgggagccgctctgcaggccggcgtcctcaagggcgaggtgaaagac gluvalvalalavalglyalaalaleuglnalaglyvalleulysglygluvallysasp 1381/4611411/471 gttctgctgcttgatgttaccccgctgagcctgggtatcgagaccaagggcggggtgatg valleuleuleuaspvalthrproleuserleuglyilegluthrlysglyglyvalmet 1441/4811471/491 accaggctcatcgagcgcaacaccacgatccccaccaagcggtcggagactttcaccacc thrargleuilegluargasnthrthrileprothrlysargsergluthrphethrthr 1501/5011531/511 gccgacgacaaccaaccgtcggtgcagatccaggtctatcagggggagcgtgagatcgcc alaaspaspasnglnproservalglnileglnvaltyrglnglygluarggluileala 1561/5211591/531 gcgcacaacaagttgctcgggtccttcgagctgaccggcatcccgccggcgccgcggggg alahisasnlysleuleuglyserphegluleuthrglyileproproalaproarggly 1621/5411651/551 attccgcagatcgaggtcactttcgacatcgacgccaacggcattgtgcacgtcaccgcc ileproglnilegluvalthrpheaspileaspalaasnglyilevalhisvalthrala 1681/5611711/571 aaggacaagggcaccggcaaggagaacacgatccgaatccaggaaggctcgggcctgtcc lysasplysglythrglylysgluasnthrileargileglngluglyserglyleuser 1741/5811771/591 aaggaagacattgaccgcatgatcaaggacgccgaagcgcacgccgaggaggatcgcaag lysgluaspileaspargmetilelysaspalaglualahisalaglugluasparglys 1801/6011831/611 cgtcgcgaggaggccgatgttcgtaatcaagccgagacattggtctaccagacggagaag argarggluglualaaspvalargasnglnalagluthrleuvaltyrglnthrglulys 1861/6211891/631 ttcgtcaaagaacagcgtgaggccgagggtggttcgaaggtacctgaagacacgctgaac phevallysgluglnargglualagluglyglyserlysvalprogluaspthrleuasn 1921/6411951/651 aaggttgatgccgcggtggcggaagcgaaggcggcacttggcggatcggatatttcggcc lysvalaspalaalavalalaglualalysalaalaleuglyglyseraspileserala 1981/6612011/671 atcaagtcggcgatggagaagctgggccaggagtcgcaggctctggggcaagcgatctac ilelysseralametglulysleuglyglngluserglnalaleuglyglnalailetyr 2041/6812071/691 gaagcagctcaggctgcgtcacaggccactggcgctgcccaccccggctcggctgatgaa glualaalaglnalaalaserglnalathrglyalaalahisproglyseralaaspglu 2101/701 agca ser

    [0131] A preferred nucleotide sequence for the entire DNA vaccine vector is shown below (SEQ ID NO:13

    TABLE-US-00013 1 GCTCCGCCCCCCTGACGAGCATCACAAAAATCGACGCTCAAGTCAGAGGT 51 GGCGAAACCCGACAGGACTATAAAGATACCAGGCGTTTCCCCCTGGAAGC 101 TCCCTCGTGCGCTCTCCTGTTCCGACCCTGCCGCTTACCGGATACCTGTC 151 CGCCTTTCTCCCTTCGGGAAGCGTGGCGCTTTCTCATAGCTCACGCTGTA 201 GGTATCTCAGTTCGGTGTAGGTCGTTCGCTCCAAGCTGGGCTGTGTGCAC 251 GAACCCCCCGTTCAGCCCGACCGCTGCGCCTTATCCGGTAACTATCGTCT 301 TGAGTCCAACCCGGTAAGACACGACTTATCGCCACTGGCAGCAGCCACTG 351 GTAACAGGATTAGCAGAGCGAGGTATGTAGGCGGTGCTACAGAGTTCTTG 401 AAGTGGTGGCCTAACTACGGCTACACTAGAAGAACAGTATTTGGTATCTG 451 CGCTCTGCTGAAGCCAGTTACCTTCGGAAAAAGAGTTGGTAGCTCTTGAT 501 CCGGCAAACAAACCACCGCTGGTAGCGGTGGTTTTTTTGTTTGCAAGCAG 551 CAGATTACGCGCAGAAAAAAAGGATCTCAAGAAGATCCTTTGATCTTTTC 601 TACGGGGTCTGACGCTCAGTGGAACGAAAACTCACGTTAAGGGATTTTGG 651 TCATGAGATTATCAAAAAGGATCTTCACCTAGATCCTTTTAAATTAAAAA 701 TGAAGTTTTAAATCAATCTAAAGTATATATGAGTAAACTTGGTCTGACAG 751 TTACCAATGCTTAATCAGTGAGGCACCTATCTCAGCGATCTGTCTATTTC 801 GTTCATCCATAGTTGCCTGACTCGGGGGGGGGGGGCGCTGAGGTCTGCCT 851 CGTGAAGAAGGTGTTGCTGACTCATACCAGGGCAACGTTGTTGCCATTGC 901 TACAGGCATCGTGGTGTCACGCTCGTCGTTTGGTATGGCTTCATTCAGCT 951 CCGGTTCCCAACGATCAAGGCGAGTTACATGATCCCCCATGTTGTGCAAA 1001 AAAGCGGTTAGCTCCTTCGGTCCTCCGATCGTTGTCAGAAGTAAGTTGGC 1051 CGCAGTGTTATCACTCATGGTTATGGCAGCACTGCATAATTCTCTTACTG 1101 TCATGCCATCCGTAAGATGCTTTTCTGTGACTGGTGAGTACTCAACCAAG 1151 TCATTCTGAGAATAGTGTATGCGGCGACCGAGTTGCTCTTGCCCGGCGTC 1201 AATACGGGATAATACCGCGCCACATAGCAGAACTTTAAAAGTGCTCATCA 1251 TTGGAAAACGTTCTTCGGGGCGAAAACTCTCAAGGATCTTACCGCTGTTG 1301 AGATCCAGTTCGATGTAACCCACTCGTGCACCTGAATCGCCCCATCATCC 1351 AGCCAGAAAGTGAGGGAGCCACGGTTGATGAGAGCTTTGTTGTAGGTGGA 1401 CCAGTTGGTGATTTTGAACTTTTGCTTTGCCACGGAACGGTCTGCGTTGT 1451 CGGGAAGATGCGTGATCTGATCCTTCAACTCAGCAAAAGTTCGATTTATT 1501 CAACAAAGCCGCCGTCCCGTCAAGTCAGCGTAATGCTCTGCCAGTGTTAC 1551 AACCAATTAACCAATTCTGATTAGAAAAACTCATCGAGCATCAAATGAAA 1601 CTGCAATTTATTCATATCAGGATTATCAATACCATATTTTTGAAAAAGCC 1651 GTTTCTGTAATGAAGGAGAAAACTCACCGAGGCAGTTCCATAGGATGGCA 1701 AGATCCTGGTATCGGTCTGCGATTCCGACTCGTCCAACATCAATACAACC 1751 TATTAATTTCCCCTCGTCAAAAATAAGGTTATCAAGTGAGAAATCACCAT 1801 GAGTGACGACTGAATCCGGTGAGAATGGCAAAAGCTTATGCATTTCTTTC 1851 CAGACTTGTTCAACAGGCCAGCCATTACGCTCGTCATCAAAATCACTCGC 1901 ATCAACCAAACCGTTATTCATTCGTGATTGCGCCTGAGCGAGACGAAATA 1951 CGCGATCGCTGTTAAAAGGACAATTACAAACAGGAATCGAATGCAACCGG 2001 CGCAGGAACACTGCCAGCGCATCAACAATATTTTCACCTGAATCAGGATA 2051 TTCTTCTAATACCTGGAATGCTGTTTTCCCGGGGATCGCAGTGGTGAGTA 2101 ACCATGCATCATCAGGAGTACGGATAAAATGCTTGATGGTCGGAAGAGGC 2151 ATAAATTCCGTCAGCCAGTTTAGTCTGACCATCTCATCTGTAACATCATT 2201 GGCAACGCTACCTTTGCCATGTTTCAGAAACAACTCTGGCGCATCGGGCT 2251 TCCCATACAATCGATAGATTGTCGCACCTGATTGCCCGACATTATCGCGA 2301 GCCCATTTATACCCATATAAATCAGCATCCATGTTGGAATTTAATCGCGG 2351 CCTCGAGCAAGACGTTTCCCGTTGAATATGGCTCATAACACCCCTTGTAT 2401 TACTGTTTATGTAAGCAGACAGTTTTATTGTTCATGATGATATATTTTTA 2451 TCTTGTGCAATGTAACATCAGAGATTTTGAGACACAACGTGGCTTTCCCC 2501 CCCCCCCCATTATTGAAGCATTTATCAGGGTTATTGTCTCATGAGCGGAT 2551 ACATATTTGAATGTATTTAGAAAAATAAACAAATAGGGGTTCCGCGCACA 2601 TTTCCCCGAAAAGTGCCACCTGACGTCTAAGAAACCATTATTATCATGAC 2651 ATTAACCTATAAAAATAGGCGTATCACGAGGCCCTTTCGTCTCGCGCGTT 2701 TCGGTGATGACGGTGAAAACCTCTGACACATGCAGCTCCCGGAGACGGTC 2751 ACAGCTTGTCTGTAAGCGGATGCCGGGAGCAGACAAGCCCGTCAGGGCGC 2801 GTCAGCGGGTGTTGGCGGGTGTCGGGGCTGGCTTAACTATGCGGCATCAG 2851 AGCAGATTGTACTGAGAGTGCACCATATGCGGTGTGAAATACCGCACAGA 2901 TGCGTAAGGAGAAAATACCGCATCAGATTGGCTATTGGCCATTGCATACG 2951 TTGTATCCATATCATAATATGTACATTTATATTGGCTCATGTCCAACATT 3001 ACCGCCATGTTGACATTGATTATTGACTAGTTATTAATAGTAATCAATTA 3051 CGGGGTCATTAGTTCATAGCCCATATATGGAGTTCCGCGTTACATAACTT 3101 ACGGTAAATGGCCCGCCTGGCTGACCGCCCAACGACCCCCGCCCATTGAC 3151 GTCAATAATGACGTATGTTCCCATAGTAACGCCAATAGGGACTTTCCATT 3201 GACGTCAATGGGTGGAGTATTTACGGTAAACTGCCCACTTGGCAGTACAT 3251 CAAGTGTATCATATGCCAAGTACGCCCCCTATTGACGTCAATGACGGTAA 3301 ATGGCCCGCCTGGCATTATGCCCAGTACATGACCTTATGGGACTTTCCTA 3351 CTTGGCAGTACATCTACGTATTAGTCATCGCTATTACCATGGTGATGCGG 3401 TTTTGGCAGTACATCAATGGGCGTGGATAGCGGTTTGACTCACGGGGATT 3451 TCCAAGTCTCCACCCCATTGACGTCAATGGGAGTTTGTTTTGGCACCAAA 3501 ATCAACGGGACTTTCCAAAATGTCGTAACAACTCCGCCCCATTGACGCAA 3551 ATGGGCGGTAGGCGTGTACGGTGGGAGGTCTATATAAGCAGAGCTCGTTT 3601 AGTGAACCGTCAGATCGCCTGGAGACGCCATCCACGCTGTTTTGACCTCC 3651 ATAGAAGACACCGGGACCGATCCAGCCTCCGCGGCCGGGAACGGTGCATT 3701 GGAACGCGGATTCCCCGTGCCAAGAGTGACGTAAGTACCGCCTATAGACT 3751 CTATAGGCACACCCCTTTGGCTCTTATGCATGCTATACTGTTTTTGGCTT 3801 GGGGCCTATACACCCCCGCTTCCTTATGCTATAGGTGATGGTATAGCTTA 3851 GCCTATAGGTGTGGGTTATTGACCATTATTGACCACTCCAACGGTGGAGG 3901 GCAGTGTAGTCTGAGCAGTACTCGTTGCTGCCGCGCGCGCCACCAGACAT 3951 AATAGCTGACAGACTAACAGACTGTTCCTTTCCATGGGTCTTTTCTGCAG 4001 TCACCGTCGTCGACGGTATCGATAAGCTTGATATCGAATTCCTCGACGGA 4051 TCTTATGGCGGCCCCCGGCGCCCGGCGGCCGCTGCTCCTGCTGCTGCTGG 4101 CAGGCCTTGCACATGGCGCCTCAGCACTCTTTGAGGATCTAATCATGCAT 4151 GGAGATACACCTACATTGCATGAATATATGTTAGATTTGCAACCAGAGAC 4201 AACTGATCTCTACGGTTATGGGCAATTAAATGACAGCTCAGAGGAGGAGG 4251 ATGAAATAGATGGTCCAGCTGGACAAGCAGAACCGGACAGAGCCCATTAC 4301 AATATTGTAACCTTTTGTTGCAAGTGTGACTCTACGCTTCGGTTGTGCGT 4351 ACAAAGCACACACGTAGACATTCGTACTTTGGAAGACCTGTTAATGGGCA 4401 CACTAGGAATTGTGTGCCCCATCTGTTCTCAAGGATCCATGGCTCGTGCG 4451 GTCGGGATCGACCTCGGGACCACCAACTCCGTCGTCTCGGTTCTGGAAGG 4501 TGGCGACCCGGTCGTCGTCGCCAACTCCGAGGGCTCCAGGACCACCCCGT 4551 CAATTGTCGCGTTCGCCCGCAACGGTGAGGTGCTGGTCGGCCAGCCCGCC 4601 AAGAACCAGGCGGTGACCAACGTCGATCGCACCGTGCGCTCGGTCAAGCG 4651 ACACATGGGCAGCGACTGGTCCATAGAGATTGACGGCAAGAAATACACCG 4701 CGCCGGAGATCAGCGCCCGCATTCTGATGAAGCTGAAGCGCGACGCCGAG 4751 GCCTACCTCGGTGAGGACATTACCGACGCGGTTATCACGACGCCCGCCTA 4801 CTTCAATGACGCCCAGCGTCAGGCCACCAAGGACGCCGGCCAGATCGCCG 4851 GCCTCAACGTGCTGCGGATCGTCAACGAGCCGACCGCGGCCGCGCTGGCC 4901 TACGGCCTCGACAAGGGCGAGAAGGAGCAGCGAATCCTGGTCTTCGACTT 4951 GGGTGGTGGCACTTTCGACGTTTCCCTGCTGGAGATCGGCGAGGGTGTGG 5001 TTGAGGTCCGTGCCACTTCGGGTGACAACCACCTCGGCGGCGACGACTGG 5051 GACCAGCGGGTCGTCGATTGGCTGGTGGACAAGTTCAAGGGCACCAGCGG 5101 CATCGATCTGACCAAGGACAAGATGGCGATGCAGCGGCTGCGGGAAGCCG 5151 CCGAGAAGGCAAAGATCGAGCTGAGTTCGAGTCAGTCCACCTCGATCAAC 5201 CTGCCCTACATCACCGTCGACGCCGACAAGAACCCGTTGTTCTTAGACGA 5251 GCAGCTGACCCGCGCGGAGTTCCAACGGATCACTCAGGACCTGCTGGACC 5301 GCACTCGCAAGCCGTTCCAGTCGGTGATCGCTGACACCGGCATTTCGGTG 5351 TCGGAGATCGATCACGTTGTGCTCGTGGGTGGTTCGACCCGGATGCCCGC 5401 GGTGACCGATCTGGTCAAGGAACTCACCGGCGGCAAGGAACCCAACAAGG 5451 GCGTCAACCCCGATGAGGTTGTCGCGGTGGGAGCCGCTCTGCAGGCCGGC 5501 GTCCTCAAGGGCGAGGTGAAAGACGTTCTGCTGCTTGATGTTACCCCGCT 5551 GAGCCTGGGTATCGAGACCAAGGGCGGGGTGATGACCAGGCTCATCGAGC 5601 GCAACACCACGATCCCCACCAAGCGGTCGGAGACTTTCACCACCGCCGAC 5651 GACAACCAACCGTCGGTGCAGATCCAGGTCTATCAGGGGGAGCGTGAGAT 5701 CGCCGCGCACAACAAGTTGCTCGGGTCCTTCGAGCTGACCGGCATCCCGC 5751 CGGCGCCGCGGGGGATTCCGCAGATCGAGGTCACTTTCGACATCGACGCC 5801 AACGGCATTGTGCACGTCACCGCCAAGGACAAGGGCACCGGCAAGGAGAA 5851 CACGATCCGAATCCAGGAAGGCTCGGGCCTGTCCAAGGAAGACATTGACC 5901 GCATGATCAAGGACGCCGAAGCGCACGCCGAGGAGGATCGCAAGCGTCGC 5951 GAGGAGGCCGATGTTCGTAATCAAGCCGAGACATTGGTCTACCAGACGGA 6001 GAAGTTCGTCAAAGAACAGCGTGAGGCCGAGGGTGGTTCGAAGGTACCTG 6051 AAGACACGCTGAACAAGGTTGATGCCGCGGTGGCGGAAGCGAAGGCGGCA 6101 CTTGGCGGATCGGATATTTCGGCCATCAAGTCGGCGATGGAGAAGCTGGG 6151 CCAGGAGTCGCAGGCTCTGGGGCAAGCGATCTACGAAGCAGCTCAGGCTG 6201 CGTCACAGGCCACTGGCGCTGCCCACCCCGGCTCGGCTGATGAAAGCTTA 6251 AGTTTAAACCGCTAGCCTAGAGCGGCCGCGGATCCAGATCTTTTTCCCTC 6301 TGCCAAAAATTATGGGGACATCATGAAGCCCCTTGAGCATCTGACTTCTG 6351 GCTAATAAAGGAAATTTATTTTCATTGCAATAGTGTGTTGGAATTTTTTG 6401 TGTCTCTCACTCGGAAGGACATATGGGAGGGCAAATCATTTAAAACATCA 6451 GAATGAGTATTTGGTTTAGAGTTTGGCAACATATGCCCATTCTTCCGCTT 6501 CCTCGCTCACTGACTCGCTGCGCTCGGTCGTTCGGCTGCGGCGAGCGGTA 6551 TCAGCTCACTCAAAGGCGGTAATACGGTTATCCACAGAATCAGGGGATAA 6601 CGCAGGAAAGAACATGTGAGCAAAAGGCCAGCAAAAGGCCAGGAACCGTA 6651 AAAAGGCCGCGTTGCTGGCGTTTTTCCATAG

    [0132] The plasmid pNGVL4a-SigF7(detox) HSP70-3 is schematically illustrated in FIG. 5a. A summary of this plasmid's components is shown below in Table I, as well as their position and origin.

    TABLE-US-00014 TABLE I Plasmid Position Genetic Construct Source of Construct 6491-0823 E. coli ORI (ColEI) pBR/E. coli-derived 0837-0881 portion of transposase (tpnA) Common plasmid seq, Tn5/Tn903 0882-1332 ?-Lactamase (AmpR) pBRpUC derived plasmid 1331-2496 AphA (KanR) Tn903 2509-2691 P3 Promoter DNA binding Tn3/pBR322 site 2692-2926 pUC backbone Common plasmid seq. pBR322- derived 2931-4009 NF1 binding and promoter HHV-5(HCMV UL-10 IE1 gene) 4010-4044 Poly-cloning site Common plasmid seq, pBlueScript (?) 4055-4144 Signal Peptide (Sig) Mammalian lysosomal membrane glycoprotein A 4145-4432 dE7 gene (detoxified partial) HPV-16 (E7 gene) 4437-6243 DNA K gene M. tuberculosis HSP70 6243-6289 Poly-cloning site Common plasmid sequence 6289-6493 Poly-Adenylation site Mammalian signal, pHCMV-derived

    [0133] A portion of SEQ ID NO:13 above vector showing by annotation the Sig, E7 (detox) and HSP-70 regions is shown below. The vector sequence is in lower case; the signal peptide (Sig) is bold italic and annotated over the lines. The E7(detox) sequence is upper case underscored (and annotated over the lines). The HSP70 sequence is italicized and underscored. (not bolded) and is also annotated over the lines.

    TABLE-US-00015 ... 3951 aatagctgacagactaacagactgttcctttccatgggtcttttctgcag 4001 tcaccgtcgtcgacggtatcgataagcttgatatcgaattcctcgacgga <---------------------SignalPeptide------------------ 4051 tcttATGGCGGCCCCCGGCGCCCGGCGGCCGCTGCTCCTGCTGCTGCTGG ------------------------------------------------------ 4101 CAGGCCTTGCACATGGCGCCTCAGCACTCTTTGAGGATCTAATCATGCAT -----------E7(detox)---------------------------------- 4151 GGAGATACACCTACATTGCATGAATATATGTTAGATTTGCAACCAGAGAC 4201 AACTGATCTCTACGGTTATGGGCAATTAAATGACAGCTCAGAGGAGGAGG 4251 ATGAAATAGATGGTCCAGCTGGACAAGCAGAACCGGACAGAGCCCATTAC 4301 AATATTGTAACCTTTTGTTGCAAGTGTGACTCTACGCTTCGGTTGTGCGT 4351 ACAAAGCACACACGTAGACATTCGTACTTTGGAAGACCTGTTAATGGGCA -----------------------------------> <----------- 4401 ACACTAGGAATTGTGTGCCCCATCTGTTCTCAAggatccATGGCTCGTGCG -----------HSP70(E.coliDNAK)---------------------... 4451 GTCGGGATCGACCTCGGGACCACCAACTCCGTCGTCTCGGTTCTGGAAGG 4501 TGGCGACCCGGTCGTCGTCGCCAACTCCGAGGGCTCCAGGACCACCCCGT 4551 CAATTGTCGCGTTCGCCCGCAACGGTGAGGTGCTGGTCGGCCAGCCCGCC 4601 AAGAACCAGGCGGTGACCAACGTCGATCGCACCGTGCGCTCGGTCAAGCG 4651 ACACATGGGCAGCGACTGGTCCATAGAGATTGACGGCAAGAAATACACCG 4701 CGCCGGAGATCAGCGCCCGCATTCTGATGAAGCTGAAGCGCGACGCCGAG 4751 GCCTACCTCGGTGAGGACATTACCGACGCGGTTATCACGACGCCCGCCTA 4801 CTTCAATGACGCCCAGCGTCAGGCCACCAAGGACGCCGGCCAGATCGCCG 4851 GCCTCAACGTGCTGCGGATCGTCAACGAGCCGACCGCGGCCGCGCTGGCC 4901 TACGGCCTCGACAAGGGCGAGAAGGAGCAGCGAATCCTGGTCTTCGACTT 4951 GGGTGGTGGCACTTTCGACGTTTCCCTGCTGGAGATCGGCGAGGGTGTGG 5001 TTGAGGTCCGTGCCACTTCGGGTGACAACCACCTCGGCGGCGACGACTGG 5051 GACCAGCGGGTCGTCGATTGGCTGGTGGACAAGTTCAAGGGCACCAGCGG 5101 CATCGATCTGACCAAGGACAAGATGGCGATGCAGCGGCTGCGGGAAGCCG 5151 CCGAGAAGGCAAAGATCGAGCTGAGTTCGAGTCAGTCCACCTCGATCAAC 5201 CTGCCCTACATCACCGTCGACGCCGACAAGAACCCGTTGTTCTTAGACGA 5251 GCAGCTGACCCGCGCGGAGTTCCAACGGATCACTCAGGACCTGCTGGACC 5301 GCACTCGCAAGCCGTTCCAGTCGGTGATCGCTGACACCGGCATTTCGGTG 5351 TCGGAGATCGATCACGTTGTGCTCGTGGGTGGTTCGACCCGGATGCCCGC 5401 GGTGACCGATCTGGTCAAGGAACTCACCGGCGGCAAGGAACCCAACAAGG 5451 GCGTCAACCCCGATGAGGTTGTCGCGGTGGGAGCCGCTCTGCAGGCCGGC 5501 GTCCTCAAGGGCGAGGTGAAAGACGTTCTGCTGCTTGATGTTACCCCGCT 5551 GAGCCTGGGTATCGAGACCAAGGGCGGGGTGATGACCAGGCTCATCGAGC 5601 GCAACACCACGATCCCCACCAAGCGGTCGGAGACTTTCACCACCGCCGAC 5651 GACAACCAACCGTCGGTGCAGATCCAGGTCTATCAGGGGGAGCGTGAGAT 5701 CGCCGCGCACAACAAGTTGCTCGGGTCCTTCGAGCTGACCGGCATCCCGC 5751 CGGCGCCGCGGGGGATTCCGCAGATCGAGGTCACTTTCGACATCGACGCC 5801 AACGGCATTGTGCACGTCACCGCCAAGGACAAGGGCACCGGCAAGGAGAA 5851 CACGATCCGAATCCAGGAAGGCTCGGGCCTGTCCAAGGAAGACATTGACC 5901 GCATGATCAAGGACGCCGAAGCGCACGCCGAGGAGGATCGCAAGCGTCGC 5951 GAGGAGGCCGATGTTCGTAATCAAGCCGAGACATTGGTCTACCAGACGGA 6001 GAAGTTCGTCAAAGAACAGCGTGAGGCCGAGGGTGGTTCGAAGGTACCTG 6051 AAGACACGCTGAACAAGGTTGATGCCGCGGTGGCGGAAGCGAAGGCGGCA 6101 CTTGGCGGATCGGATATTTCGGCCATCAAGTCGGCGATGGAGAAGCTGGG 6151 CCAGGAGTCGCAGGCTCTGGGGCAAGCGATCTACGAAGCAGCTCAGGCTG ----------------------------------------------> 6201 CGTCACAGGCCACTGGCGCTGCCCACCCCGGCTCGGCTGATGAaagctta 6251 agtttaaaccgctagcctagagcggccgcggatccagatctttttccctc 6301 tgccaaaaattatggggacatcatgaagccccttgagcatctgacttctg ...

    General Recombinant DNA Methods

    [0134] Basic texts disclosing general methods of molecular biology, all of which are incorporated by reference, include: Sambrook, J. et al , Molecular Cloning: A Laboratory Manual, 2nd Edition, Cold Spring Harbor Press, Cold Spring Harbor, N.Y., 1989; Ausubel, F M et al. Current Protocols in Molecular Biology, Vol. 2, Wiley-Interscience, New York, (current edition); Kriegler, Gene Transfer and Expression: A Laboratory Manual (1990); Glover, D M, ed, DNA Cloning: A Practical Approach, vol. I & II, IRL Press, 1985; Albers, B. et al., Molecular Biology of the Cell, 2nd Ed., Garland Publishing, Inc., New York, N.Y. (1989); Watson, J D et al., Recombinant DNA, 2nd Ed., Scientific American Books, New York, 1992; and Old, R W et al., Principles of Gene Manipulation: An Introduction to Genetic Engineering, 2nd Ed., University of California Press, Berkeley, Calif. (1981).

    [0135] Techniques for the manipulation of nucleic acids, such as, e.g., generating mutations in sequences, subcloning, labeling probes, sequencing, hybridization and the like are well described in the scientific and patent literature. See, e.g., Sambrook, ed., MOLECULAR CLONING: A LABORATORY MANUAL (2ND ED.), Vols. 1-3, Cold Spring Harbor Laboratory, (1989); CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, Ausubel, ed. John Wiley & Sons, Inc., New York (1997); LABORATORY TECHNIQUES IN BIOCHEMISTRY AND MOLECULAR BIOLOGY: HYBRIDIZATION WITH NUCLEIC ACID PROBES, Part I. Tijssen, ed. Elsevier, N.Y. (1993).

    [0136] Nucleic acids, vectors, capsids, polypeptides, and the like can be analyzed and quantified by any of a number of general means well known to those of skill in the art. These include, e.g., analytical biochemical methods such as NMR, spectrophotometry, radiography, electrophoresis, capillary electrophoresis, high performance liquid chromatography (HPLC), thin layer chroma-tography (TLC), and hyper diffusion chromatography, various immunological methods, e.g. fluid or gel precipitin reactions, immunodiffusion, immuno-electrophoresis, radioimmunoassays (Rios), enzyme-linked immunosorbent assays (ELISAs), immunofluorescence assays, Southern analysis, Northern analysis, dot-blot analysis, gel electrophoresis (e.g., SDS-PAGE), RTF-PCR, quantitative PCR, other nucleic acid or target or signal amplification methods, radiolabeling, scintillation counting, and affinity chromatography.

    Amplification of Nucleic Acids

    [0137] Oligonucleotide primers can be used to amplify nucleic acids to generate fusion protein coding sequences used to practice the invention, to monitor levels of vaccine after in vivo administration (e.g., levels of a plasmid or virus), to confirm the presence and phenotype of activated CTLs, and the like. The skilled artisan can select and design suitable oligonucleotide amplification primers using known sequences. Amplification methods are also well known in the art, and include, e.g., polymerase chain reaction, PCR (PCR Protocols, A Guide to Methods and Applications, Academic Press, N.Y. (1990) and PCR Strategies (1995), Academic Press, Inc., N.Y., ligase chain reaction (LCR) (Wu (1989) Genomics 4:560; Landegren (1988) Science 241:1077; Barringer (1990) Gene 89:117); transcription amplification. (Kwoh (1989) Proc. Natl. Acad. Sci. USA 86:1173); and, self-sustained sequence replication (Guatelli (1990) Proc. Natl. Acad. Sci. USA 87:1874); QO replicase amplification (Smith (1997) J. Clin. Microbiol. 35:1477-1491; Burg (1996) Mol. Cell. Probes 10:257-271) and other RNA polymerase mediated techniques (NASBA, Cangene, Mississauga, Ontario; Berger (1987) Methods Enzymol. 152:307-316; U.S. Pat. Nos. 4,683,195 and 4,683,202; Sooknanan (1995) Biotechnology 13:563-564).

    [0138] Unless otherwise indicated, a particular nucleic acid sequence is intended to encompasses conservative substitution variants thereof (e.g., degenerate codon substitutions) and a complementary sequence. The term nucleic acid is synonymous with polynucleotide and is intended to include a gene, a cDNA molecule, an mRNA molecule, as well as a fragment of any of these such as an oligonucleotide, and further, equivalents thereof (explained more fully below). Sizes of nucleic acids are stated either as kilobases (kb) or base pairs (bp). These are estimates derived from agarose or polyacrylamide gel electrophoresis (PAGE), from nucleic acid sequences which are determined by the user or published. Protein size is stated as molecular mass in kilodaltons (kDa) or as length (number of amino acid residues). Protein size is estimated from PAGE, from sequencing, from presumptive amino acid sequences based on the coding nucleic acid sequence or from published amino acid sequences.

    [0139] Specifically, cDNA molecules encoding the amino acid sequence corresponding to the fusion polypeptide of the present invention or fragments or derivatives thereof can be synthesized by the polymerase chain reaction (PCR) (see, for example, U.S. Pat. No. 4,683,202) using primers derived the sequence of the protein disclosed herein. These cDNA sequences can then be assembled into a eukaryotic or prokaryotic expression vector and the resulting vector can be used to direct the synthesis of the fusion polypeptide or its fragment or derivative by appropriate host cells, for example COS or CHO cells.

    [0140] This invention includes isolated nucleic acids having a nucleotide sequence encoding the novel fusion polypeptides that comprise a translocation polypeptide and an antigen, fragments thereof or equivalents thereof. The term nucleic acid as used herein is intended to include such fragments or equivalents. The nucleic acid sequences of this invention can be DNA or RNA.

    [0141] A cDNA nucleotide sequence the fusion polypeptide can be obtained by isolating total mRNA from an appropriate cell line. Double stranded cDNA is prepared from total mRNA. cDNA can be inserted into a suitable plasmid, bacteriophage or viral vector using any one of a number of known techniques.

    [0142] In reference to a nucleotide sequence, the term equivalent is intended to include sequences encoding structurally homologous and/or a functionally equivalent proteins. For example, a natural polymorphism in a nucleotide sequence encoding an anti-apoptotic polypeptide according to the present invention (especially at the third base of a codon) may be manifest as silent mutations which do not change the amino acid sequence. Furthermore, there may be one or more naturally occurring isoforms or related, immunologically cross-reactive family members of these proteins. Such isoforms or family members are defined as proteins that share function amino acid sequence similarity to the reference polypeptide.

    [0143] Fragment of Nucleic Acid

    [0144] A fragment of the nucleic acid sequence is defined as a nucleotide sequence having fewer nucleotides than the nucleotide sequence encoding the full length translocation polypeptide, antigenic polypeptide or the fusion thereof. This invention includes such nucleic acid fragments that encode polypeptides which retain (1) the ability of the fusion polypeptide to induce increases in frequency or reactivity of T cells, preferably CD8.sup.+ T cells, that are specific for the antigen part of the fusion polypeptide.

    [0145] For example, a nucleic acid fragment as intended herein encodes an anti-apoptotic polypeptide that retains the ability to improve the immunogenicity of an antigenic composition when administered as a chimeric DNA with antigen-encoding sequence, or when co-administered therewith.

    [0146] Generally, the nucleic acid sequence encoding a fragment of an anti-apoptotic polypeptide comprises of nucleotides from the sequence encoding the mature protein (or an active fragment thereof).

    [0147] Nucleic acid sequences of this invention may also include linker sequences, natural or modified restriction endonuclease sites and other sequences that are useful for manipulations related to cloning, expression or purification of encoded protein or fragments. These and other modifications of nucleic acid sequences are described herein or are well-known in the art.

    [0148] The techniques for assembling and expressing DNA coding sequences for translocation types of proteins, and DNA coding sequences for antigenic polypeptides, include synthesis of oligonucleotides, PCR, transforming cells, constructing vectors, expression systems, and the like; these are well-established in the art such that those of ordinary skill are familiar with standard resource materials, specific conditions and procedures.

    Expression Vectors and Host Cells

    [0149] This invention includes an expression vector comprising a nucleic acid sequence encoding an anti-apoptotic polypeptide or a targeting polypeptide operably linked to at least one regulatory sequence. These vectors are also in the process of producing the final vaccine vector.

    [0150] The term expression vector as used herein refers to a nucleotide sequence which is capable of affecting expression of a protein coding sequence in a host compatible with such sequences. Expression cassettes include at least a promoter operably linked with the polypeptide coding sequence; and, optionally, with other sequences, e.g., transcription termination signals. Additional factors necessary or helpful in effecting expression may also be included, e.g., enhancers.

    [0151] Operably linked means that the coding sequence is linked to a regulatory sequence in a manner that allows expression of the coding sequence. Known regulatory sequences are selected to direct expression of the desired protein in an appropriate host cell. Accordingly, the term regulatory sequence includes promoters, enhancers and other expression control elements. Such regulatory sequences are described in, for example, Goeddel, Gene Expression Technology. Methods in Enzymology, vol. 185, Academic Press, San Diego, Calif. (1990)).

    [0152] Thus, expression cassettes include plasmids, recombinant viruses, any form of a recombinant naked DNA vector, and the like. A vector comprises a nucleic acid which can infect, transfect, transiently or permanently transduce a cell. It will be recognized that a vector can be a naked nucleic acid, or a nucleic acid complexed with protein or lipid. The vector optionally comprises viral or bacterial nucleic acids and/or proteins, and/or membranes (e.g., a cell membrane, a viral lipid envelope, etc.). Where a vector is being maintained by a host cell, the vector may either be stably replicated by the cells during mitosis as an autonomous structure, or is incorporated within the host's genome.

    [0153] Those skilled in the art appreciate that the particular design of an expression vector of this invention depends on considerations such as the host cell to be transfected and/or the type of protein to be expressed.

    [0154] The present expression vectors comprise the full range of nucleic acid molecules encoding the various embodiments of the fusion polypeptide and its functional derivatives (defined herein) including polypeptide fragments, variants, etc.

    [0155] Such expression vectors are used to transfect host cells (in vitro, ex vivo or in vivo) for expression of the DNA and production of the encoded proteins which include fusion proteins or peptides. It will be understood that a genetically modified cell expressing the fusion polypeptide may transiently express the exogenous DNA for a time sufficient for the cell to be useful for its stated purpose. Host cells may also be transfected with one or more expression vectors that singly or in combination comprise DNA encoding at least a portion of the fusion polypeptide and DNA encoding at least a portion of a second protein, so that the host cells produce yet further fusion polypeptides that include both the portions. A culture typically includes host cells, appropriate growth media and other byproducts. Suitable culture media are well known in the art. The fusion polypeptide can be isolated from medium or cell lysates using conventional techniques for purifying proteins and peptides, including ammonium sulfate precipitation, fractionation column chromatography (e.g. ion exchange, gel filtration, affinity chromatography, etc.) and/or electrophoresis (see generally, Enzyme Purification and Related Techniques, Methods in Enzymology, 22:233-577 (1971)). Once purified, partially or to homogeneity, the recombinant polypeptides of the invention can be utilized in pharmaceutical compositions as described in more detail herein.

    [0156] The term isolated as used herein, when referring to a molecule or composition, such as a nucleic acid, means that the molecule or composition is separated from at least one other compound (protein, other nucleic acid, etc.) or from other contaminants with which it is natively associated or becomes associated during processing. An isolated composition can also be substantially pure. An isolated composition can be in a homogeneous state and can be dry or in aqueous solution. Purity and homogeneity can be determined, for example, using analytical chemical techniques.

    [0157] Prokaryotic or eukaryotic host cells transformed or transfected to express the fusion polypeptide or a homologue or functional derivative thereof are within the scope of the invention. For example, the fusion polypeptide may be expressed in bacterial cells such as E. coli, insect cells (baculovirus), yeast, or mammalian cells such as Chinese hamster ovary cells (CHO) or human cells. Other suitable host cells may be found in Goeddel, (1990) supra or are otherwise known to those skilled in the art.

    [0158] Expression in eukaryotic cells leads to partial or complete glycosylation and/or formation of relevant inter- or intra-chain disulfide bonds of the recombinant protein.

    [0159] Often, in fusion expression vectors, a proteolytic cleavage site is introduced at the junction of the reporter group and the target protein to enable separation of the target protein from the reporter group subsequent to purification of the fusion protein. Proteolytic enzymes for such cleavage and their recognition sequences include Factor Xa, thrombin and enterokinase.

    [0160] Typical fusion expression vectors include pGEX (Amrad Corp., Melbourne, Australia), pMAL (New England Biolabs, Beverly, Mass.) and pRIT5 (Pharmacia, Piscataway, N.J.) which fuse glutathione S-transferase, maltose .E binding protein, or protein A, respectively, to the target recombinant protein.

    [0161] Inducible non-fusion expression vectors include pTrc (Amann et al., (1988) Gene 69:301-315) and pET 11ld (Studier et al., Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, Calif. (1990) 60-89). While target gene expression relies on host RNA polymerase transcription from the hybrid trp-lac fusion promoter in pTrc, expression of target genes inserted into pET 11d relies on transcription from the T7 gni10-lacO fusion promoter mediated by coexpressed viral RNA polymerase (T7gn1). This viral polymerase is supplied by host strains BL21(DE3) or HMS174(DE3) from a resident A, prophage harboring a T7gn1 under the transcriptional control of the lacUV 5 promoter.

    Vector Construction

    [0162] Construction of suitable vectors comprising the desired coding and control sequences employs standard ligation and restriction techniques which are well understood in the art. Isolated plasmids, DNA sequences, or synthesized oligonucleotides are cleaved, tailored, and re-ligated in the form desired.

    [0163] The DNA sequences which form the vectors are available from a number of sources. Backbone vectors and control systems are generally found on available host vectors which are used for the bulk of the sequences in construction. For the pertinent coding sequence, initial construction may be, and usually is, a matter of retrieving the appropriate sequences from cDNA or genomic DNA libraries. However, once the sequence is disclosed it is possible to synthesize the entire gene sequence in vitro starting from the individual nucleotide derivatives. The entire gene sequence for genes of sizeable length, e.g., 500-1000 bp may be prepared by synthesizing individual overlapping complementary oligonucleotides and filling in single stranded nonoverlapping portions using DNA polymerase in the presence of the deoxyribonucleotide triphosphates. This approach has been used successfully in the construction of several genes of known sequence. See, for example, Edge, M. D., Nature (1981) 292:756; Nambair, K. P., et al., Science (1984) 223:1299; and Jay, E., J Biol Chem (1984) 259:6311.

    [0164] Vector DNA can be introduced into mammalian cells via conventional techniques such as calcium phosphate or calcium chloride co-precipitation, DEAE-dextran-mediated transfection, lipofection, or electroporation. Suitable methods for transforming host cells can be found in Sambrook et al. supra and other standard texts.

    [0165] Often, in fusion expression vectors, a proteolytic cleavage site is introduced at the junction of the reporter group and the target protein to enable separation of the target protein from the reporter group subsequent to purification of the fusion protein. Proteolytic enzymes for such cleavage and their recognition sequences include Factor Xa, thrombin and enterokinase.

    Promoters and Enhancers

    [0166] The preferred promoter sequences of the present invention must be operable in mammalian cells and may be either eukaryotic or viral promoters. Although preferred promoters are described in the Examples, other useful promoters and regulatory elements are discussed below. Suitable promoters may be inducible, repressible or constitutive. A constitutive promoter is one which is active under most conditions encountered in the cell's environmental and throughout development. An inducible promoter is one which is under environmental or developmental regulation. A tissue specific promoter is active in certain tissue types of an organism. An example of a constitutive promoter is-the viral promoter MSV-LTR, which is efficient and active in a variety of cell types, and, in contrast to most other promoters, has the same enhancing activity in arrested and growing cells. Other preferred viral promoters include that present in the CMV-LTR (from cytomegalovirus) (Bashart, M. et al., Cell 41:521 (1985)) or in the RSV-LTR (from Rous sarcoma virus) (Gorman, C. M., Proc. Natl. Acad. Sci. USA 79:6777 (1982). Also useful are the promoter of the mouse metallothionein I gene (Hamer, D., et al., J. Mol Appl. Gen. 1:273-288 (1982)); the TK promoter of Herpes virus (McKnight, S., Cell 31:355-365 (1982)); the SV40 early promoter (Benoist, C., et al., Nature 290:304-310 (1981)); and the yeast gal4 gene promoter (Johnston, S. A., et al., Proc. Natl. Acad. Sci. (USA) 79:6971-6975 (1982); Silver, P. A., et al., Proc. Natl. Acad. Sci. (USA) 81:5951-5955 (1984)). Other illustrative descriptions of transcriptional factor association with promoter regions and the separate activation and DNA binding of transcription factors include: Keegan et al., Nature (1986) 231:699; Fields et al., Nature (1989) 340:245; Jones, Cell (1990) 61:9; Lewin, Cell (1990) 61:1161; Ptashne et al., Nature (1990) 346:329; Adams et al., Cell (1993) 72:306. The relevant disclosure of all of these above-listed references is hereby incorporated by reference.

    [0167] The promoter region may further include an octamer region which may also function as a tissue specific enhancer, by interacting with certain proteins found in the specific tissue. The enhancer domain of the DNA construct of the present invention is one which is specific for the target cells to be transfected, or is highly activated by cellular factors of such target cells. Examples of vectors (plasmid or retrovirus) are disclosed in (Roy-Burman et al., U.S. Pat. No. 5,112,767). For a general discussion of enhancers and their actions in transcription, see, Lewin, B. M., Genes IV, Oxford University Press, Oxford, (1990), pp. 552-576. Particularly useful are retroviral enhancers (e.g., viral LTR). The enhancer is preferably placed upstream from the promoter with which it interacts to stimulate gene expression. For use with retroviral vectors, the endogenous viral LTR may be rendered enhancer-less and substituted with other desired enhancer sequences which confer tissue specificity or other desirable properties such as transcriptional efficiency.

    [0168] Nucleic acids of the invention can also be chemically synthesized using standard techniques. Various methods of chemically synthesizing polydeoxynucleotides are known, including solid-phase synthesis which, like peptide synthesis, has been fully automated with commercially available DNA synthesizers (See, e.g., Itakura et al. U.S. Pat. No. 4,598,049; Caruthers et al. U.S. Pat. No. 4,458,066; and Itakura U.S. Pat. Nos. 4,401,796 and 4,373,071, incorporated by reference herein).

    Proteins and Polypeptides

    [0169] The terms polypeptide, protein, and peptide when referring to compositions of the invention are meant to include variants, analogues, and mimetics with structures and/or activity that substantially correspond to the polypeptide or peptide from which the variant, etc., was derived.

    [0170] The present invention includes the expression in vivo of fusion polypeptides comprising a targeting polypeptide linked to an antigenic polypeptide.

    [0171] The term chimeric or fusion polypeptide or protein refers to a composition comprising at least one polypeptide or peptide sequence or domain that is chemically bound in a linear fashion with a second polypeptide or peptide domain. One embodiment of this invention is an isolated or recombinant nucleic acid molecule encoding a fusion protein comprising at least two domains, wherein the first domain comprises an anti-apoptotic polypeptide and the second domain comprising an antigenic epitope, e.g., an MHC class I-binding peptide epitope. Additional domains can comprise a targeting polypeptide or the like. The fusion can be an association generated by a peptide bond, a chemical linking, a charge interaction (e.g., electrostatic attractions, such as salt bridges, H-bonding, etc.) or the like. If the polypeptides are recombinant, the fusion protein can be translated from a common mRNA. Alternatively, the compositions of the domains can be linked by any chemical or electrostatic means. The chimeric molecules of the invention (e.g., targeting polypeptide fusion proteins) can also include additional sequences, e.g., linkers, epitope tags, enzyme cleavage recognition sequences, signal sequences, secretion signals, and the like. Alternatively, a peptide can be linked to a carrier simply to facilitate manipulation or identificationlocation of the peptide.

    [0172] Therapeutic Compositions and Their Administration

    [0173] A vaccine composition comprising the nucleic acid encoding the fusion polypeptide, or a cell expressing this nucleic acid is administered to a mammalian subject, preferably a human.

    [0174] The vaccine composition is administered in a pharmaceutically acceptable carrier in a biologically effective or a therapeutically effective amount, Certain preferred conditions are disclosed in the Examples. The composition may be given alone or in combination with another protein or peptide such as an immunostimulatory molecule. Treatment may include administration of an adjuvant, used in its broadest sense to include any nonspecific immune stimulating compound such as an interferon. Adjuvants contemplated herein include resorcinols, non-ionic surfactants such as polyoxyethylene oleyl ether and n-hexadecyl polyethylene ether.

    [0175] A therapeutically effective amount is a dosage that, when given for an effective period of time, achieves the desired immunological or clinical effect.

    [0176] A therapeutically active amount of a nucleic acid encoding the fusion polypeptide may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the peptide to elicit a desired response in the individual. Dosage regimes may be adjusted to provide the optimum therapeutic response. For example, several divided doses may be administered daily or the dose may be proportionally reduced as indicated by the exigencies of the therapeutic situation. A therapeutically effective amounts of the protein, in cell associated form may be stated in terms of the protein or cell equivalents.

    [0177] Thus an effective amount is between about 1 nanogram and about 1 gram per kilogram of body weight of the recipient, more preferably between about 0.1 ?g/kg and about 10 mg/kg, more preferably between about 1 ?g/kg and about 1 mg/kg. Dosage forms suitable for internal administration preferably contain (for the latter dose range) from about 0.1 ?g to 100 ?g of active ingredient per unit. The active ingredient may vary from 0.5 to 95% by weight based on the total weight of the composition. Alternatively, an effective dose of cells expressing the nucleic acid is between about 10.sup.4 and 10.sup.8 cells. Those skilled in the art of immunotherapy will be able to adjust these doses without undue experimentation.

    [0178] The active compound may be administered in a convenient manner, e.g., injection by a convenient and effective route. Preferred routes include intradermal gene gun delivery, and intramuscular routes. For the treatment of existing tumors which have not been completely resected or which have recurred, direct intratumoral injection may also be used.

    [0179] Depending on the route of administration, the nucleic acid may be coated in a material to protect the compound from the action of enzymes, acids and other natural conditions which may inactivate the compound. Thus it may be necessary to coat the composition with, or co-administer the composition with, a material to prevent its inactivation. For example, an enzyme inhibitors of nucleases or proteases or in an appropriate carrier such as liposomes (including water-in-oil-in-water emulsions as well as conventional liposomes (Strejan et al., (1984) J. Neuroimmunol 7:27).

    [0180] As used herein pharmaceutically acceptable carrier includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like. The use of such media and agents for pharmaceutically active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the therapeutic compositions is contemplated. Supplementary active compounds can also be incorporated into the compositions.

    [0181] Preferred pharmaceutically acceptable diluents include saline and aqueous buffer solutions. Pharmaceutical compositions suitable for injection include sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion. Isotonic agents, for example, sugars, polyalcohols such as mannitol, sorbitol, sodium chloride may be included in the pharmaceutical composition. In all cases, the composition should be sterile and should be fluid. It should be stable under the conditions of manufacture and storage and must include preservatives that prevent contamination with microorganisms such as bacteria and fungi. Dispersions can also be prepared in glycerol, liquid polyethylene glycols, and mixtures thereof and in oils. Under ordinary conditions of storage and use, these preparations may contain a preservative to prevent the growth of microorganisms.

    [0182] The carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof. The proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.

    [0183] Prevention of the action of microorganisms can be achieved by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, ascorbic acid, thimerosal, and the like.

    [0184] Compositions are preferably formulated in dosage unit form for ease of administration and uniformity of dosage. Dosage unit form refers to physically discrete units suited as unitary dosages for a mammalian subject; each unit contains a predetermined quantity of active material (e.g., the nucleic acid vaccine) calculated to produce the desired therapeutic effect, in association with the required pharmaceutical carrier. The specification for the dosage unit forms of the invention are dictated by and directly dependent on (a) the unique characteristics of the active material and the particular therapeutic effect to be achieved, and (b) the limitations inherent in the art of compounding such an active compound for the treatment of, and sensitivity of, individual subjects

    [0185] Other pharmaceutically acceptable carriers for the nucleic acid vaccine compositions according to the present invention are liposomes, pharmaceutical compositions in which the active protein is contained either dispersed or variously present in corpuscles consisting of aqueous concentric layers adherent to lipidic layers. The active protein is preferably present in the aqueous layer and in the lipidic layer, inside or outside, or, in any event, in the non-homogeneous system generally known as a liposomic suspension. The hydrophobic layer, or lipidic layer, generally, but not exclusively, comprises phospholipids such as lecithin and sphingomyelin, steroids such as cholesterol, more or less ionic surface active substances such as dicetylphosphate, stearylarnine or phosphatidic acid, and/or other materials of a hydrophobic nature. Those skilled in the art will appreciate other suitable embodiments of the present liposomal formulations.

    Antigens Associated With Pathogens

    [0186] A major use for the present invention is the use of the present nucleic acid compositions in therapeutic vaccine for cancer and for major chronic viral infections that cause morbidity and mortality worldwide. Such vaccines are designed to eliminate infected cellsthis requires T cell responses as antibodies are often ineffective. The vaccines of the present invention are designed to meet these needs.

    [0187] Preferred antigens are epitopes of pathogenic microorganisms against which the host is defended by effector T cells responses, including cytotoxic T lymphocyte (CTL) and delayed type hypersensitivity. These typically include viruses, intracellular parasites such as malaria, and bacteria that grow intracellularly such as Mycobacteria and Listeria species. Thus, the types of antigens included in the vaccine compositions of this invention are any of those associated with such pathogens (in addition, of course, to tumor-specific antigens). It is noteworthy that some viral antigens are also tumor antigens in the case where the virus is a causative factor in cancer.

    [0188] In fact, the two most common cancers worldwide, hepatoma and cervical cancer, are associated with viral infection. Hepatitis B virus(HBV) (Beasley, R. P. et al., Lancet 2, 1129-1133 (1981) has been implicated as etiologic agent of hepatomas. 80-90% of cervical cancers express the E6 and E7 antigens (exemplified herein) from one of four high risk human papillomavirus types: HPV-16, HPV-18, HPV-31 and HPV-45 (Gissmann, L. et al., Ciba Found Symp. 120, 190-207 (1986); Beaudenon, S., et al. Nature 321, 246-249 (1986). The HPV E6 and E7 antigens are the most promising targets for virus associated cancers in immunocompetent individuals because of their ubiquitous expression in cervical cancer. In addition to their importance as targets for therapeutic cancer vaccines, virus associated tumor antigens are also ideal candidates for prophylactic vaccines. Indeed, introduction of prophylactic HBV vaccines in Asia have decreased the incidence of hepatoma (Chang, M. H., et al. New Engl. J. Med. 336, 1855-1859 (1997), representing a great impact on cancer prevention.

    [0189] Among the most important viruses in chronic human viral infections are HPV, HBV, hepatitis C Virus (HCV), human immunodeficiency virus (HIV-1 and HIV-2), herpesviruses such as Epstein Barr Virus (EBV), cytomegalovirus (CMV) and HSV-1 and HSV-2 and influenza virus. Useful antigens include HBV surface antigen or HBV core antigen; ppUL83 or pp89 of CMV; antigens of gp120, gp41 or p24 proteins of HIV-1; ICP27, gD2, gB of HSV; or influenza nucleoprotein (Anthony, L S et al., Vaccine 1999; 17:373-83). Other antigens associated with pathogens that can be utilized as described herein are antigens of various parasites, includes malaria, preferably malaria peptide (NANP)40.

    [0190] In addition to its applicability to human cancer and infectious diseases, the present invention is also intended for use in treating animal diseases in the veterinary medicine context. Thus, the approaches described herein may be readily applied by one skilled in the art to treatment of veterinary herpesvirus infections including equine herpesviruses, bovine viruses such as bovine viral diarrhea virus (for example, the E2 antigen), bovine herpesviruses, Marek's disease virus in chickens and other fowl; animal retroviral and lentiviral diseases (e.g., feline leukemia, feline immunodeficiency, simian immunodeficiency viruses, etc.); pseudorabies and rabies; and the like.

    [0191] As for tumor antigens, any tumor-associated or tumor-specific antigen that can be recognized by T cells, preferably by CTL, can be used. In addition to the HPV-E7 antigen exemplified herein is mutant p53 or HER2/neu or a peptide thereof. Any of a number of melanoma-associated antigens may be used, such as MAGE-1, MAGE-3, MART-1/Melan-A, tyrosinase, gp75, gp100, BAGE, GAGE-1, GAGE-2, GnT-V, and p15 (see, U.S. Pat. No. 6,187,306).

    [0192] The following references set forth principles and current information in the field of basic, medical and veterinary virology and are incorporated by reference: Fields Virology, Fields, B N et al., eds., Lippincott Williams & Wilkins, NY, 1996; Principles of Virology: Molecular Biology, Pathogenesis, and Control, Flint, S. J. et al., eds., Amer. Society for Microbiology, Washington, 1999; Principles and Practice of Clinical Virology, 4th Edition, Zuckerman. A. J. et al., eds, John Wiley & Sons, NY, 1999; The Hepatitis C Viruses, by Hagedorn, C H et al., eds., Springer Verlag, 1999; Hepatitis B Virus: Molecular Mechanisms in Disease and Novel Strategies for Therapy, Koshy, R. et al., eds, World Scientific Pub Co, 1998; Veterinary Virology, Murphy, F. A. et al., eds., Academic Press, NY, 1999; Avian Viruses: Function and Control, Ritchie, B. W., Iowa State University Press, Ames, 2000; Virus Taxonomy: Classification and Nomenclature of Viruses: Seventh Report of the International Committee on Taxonomy of Viruses, by M. H. V. Van Regenmortel, MHV et al., eds., Academic Press; NY, 2000.

    Delivery of Vaccine Nucleic Acid to Cells and Animals

    [0193] The Examples below describe certain preferred approaches to delivery of the vaccines of the present invention. A broader description of other approaches including viral and nonviral vectors and delivery mechanisms follow.

    [0194] DNA delivery involves introduction of a foreign DNA into a cell ex vivo and ultimately, into a live animal or directly into the animal. Several general strategies for gene delivery (=delivery of nucleic acid vectors) for purposes that include gene therapy have been studied and reviewed extensively (Yang, N-S., Crit. Rev. Biotechnol. 12:335-356 (1992); Anderson, W. F., Science 256:808-813 (1992); Miller, A. S., Nature 357:455-460 (1992); Crystal, R. G., Amer. J. Med. 92(suppl 6A):44S-52S (1992); Zwiebel, J. A. et al., Ann. N.Y. Acad. Sci. 618:394-404 (1991); McLachlin, J. R. et al., Prog. Nucl. Acid Res. Molec. Biol. 38:91-135 (1990); Kohn, D. B. et al., Cancer Invest. 7:179-192 (1989), which references are herein incorporated by reference in their entirety).

    [0195] For accomplishing the objectives of the present invention, nucleic acid therapy would be accomplished by direct transfer of a the functionally active DNA into mammalian somatic tissue or organ in vivo. DNA transfer can be achieved using a number of approaches described herein. These systems can be tested for successful expression in vitro by use of a selectable marker (e.g., G418 resistance) to select transfected clones expressing the DNA, followed by detection of the presence of the antigen-containing expression product (after treatment with the inducer in the case of an inducible system) using an antibody to the product in an appropriate immunoassay. Efficiency of the procedure, including DNA uptake, plasmid integration and stability of integrated plasmids, can be improved by linearizing the plasmid DNA using known methods, and co-transfection using high molecular weight mammalian DNA as a carrier.

    [0196] In addition to virus-mediated gene transfer in vivo, physical means well-known in the art can be used for direct transfer of DNA, including administration of plasmid DNA (Wolff et al., 1990, supra) and particle-bombardment mediated gene transfer (Yang, N.-S., et al., Proc. Natl. Acad. Sci. USA 87:9568 (1990); Williams, R. S. et al., Proc. Natl. Acad. Sci. USA 88:2726 (1991); Zelenin, A. V. et al., FEBS Lett. 280:94 (1991); Zelenin, A. V. et al., FEBS Lett. 244:65 (1989); Johnston, S. A. et al., In Vitro Cell. Dev. Biol. 27:11 (1991)). Furthermore, electroporation, a well-known means to transfer genes into cell in vitro, can be used to transfer DNA molecules according to the present invention to tissues in vivo (Titomirov, A. V. et al., Biochim. Biophys. Acta 1088:131 ((1991)).

    [0197] Carrier mediated gene transfer has also been described (Wu, C. H. et al., J. Biol. Chem. 264:16985 (1989); Wu, G. Y. et al., J. Biol. Chem. 263:14621 (1988); Soriano, P. et al., Proc. Natl. Acad. Sci. USA 80:7128 (1983); Wang, C-Y. et al., Proc. Natl. Acad. Sci. USA 84:7851 (1982); Wilson, J. M. et al., J. Biol. Chem. 267:963 (1992)). Preferred carriers are targeted liposomes (Nicolau, C. et al., Proc. Natl. Acad. Sci. USA 80:1068 (1983); Soriano et al., supra) such as immunoliposomes, which can incorporate acylated mAbs into the lipid bilayer (Wang et al., supra). Polycations such as asialoglycoprotein/polylysine (Wu et al., 1989, supra) may be used, where the conjugate includes a molecule which recognizes the target tissue (e.g., asialoorosomucoid for liver) and a DNA binding compound to bind to the DNA to be transfected. Polylysine is an example of a DNA binding molecule which binds DNA without damaging it. This conjugate is then complexed with plasmid DNA according to the present invention for transfer.

    [0198] Plasmid DNA used for transfection or microinjection may be prepared using methods well-known in the art, for example using the Quiagen procedure (Quiagen), followed by DNA purification using known methods, such as the methods exemplified herein.

    [0199] Having now generally described the invention, the same will be more readily understood through reference to the following examples which are provided by way of illustration, and are not intended to be limiting of the present invention, unless specified.

    EXAMPLE I

    Materials and Methods

    [0200] Mice: Six- to eight-week-old female C57BL/6 mice were purchased from the National Cancer Institute (Frederick, Md.) and kept in the oncology animal facility of the Johns Hopkins Hospital (Baltimore, Md.). All animal procedures were performed according to approved protocols and in accordance with the recommendations for the proper use and care of laboratory animals.

    [0201] Plasmid DNA Construction: The E7/70 gene was cloned into pNGVL4a (National Gene Vector Laboratory) using the EcoRI and KpnI restriction sites. Using site-directed mutagenesis, two point mutations, which had previously been found to reduce Rb binding (Munger, K et al., EMBO J 1989, 8:4099-4105), were introduced into the E7 gene. The primers used to introduce these mutations were as follows:

    [0202] mE7 Forward: 5 ctgatctotacggttatgggcaattaaatgacagetc 3 [SEQ ID NO: 14] and

    [0203] mE7 Reverse: 5 gagctgtcatttaattgcccataaccgtagagatca 3 [SEQ ID NO: 15].

    [0204] For construction of pNGVL4a-Sig/E7(detox)/HSP70, Sig was cut from pCMV-neoSig/E7/LAMP-1 (Chen, C H et al., Gene Ther 1999, 6:1972-1981) by EcoRI/NsiI, and E7(detox)/HSP70 was cut from pNGVL4a-E7(detox)/HSP70 by NsiI/XbaI. Sig and E7(detox)/HSP70 were ligated and cloned into pNGVL4a vector cut with EcoRI/XbaI. The accuracy of DNA constructs was confirmed by DNA sequencing.

    [0205] The production and maintenance of TC-1 cells has been described previously (Lin, K Y et al., Cancer Res 1996, 56:21-26.). In brief, HPV-16 E6, E7 and ras oncogene were used to transform primary C57BL/6 mice lung epithelial cells to generate TC-1.

    [0206] Needle IM Mediated DNA Vaccination: The pNGVL4a-Sig/E7(detox)/HSP70 vaccine was administered to groups of mice by three different methods. For needle i.m. mediated DNA vaccination, 50 ?g/mouse of pNGVL4a-Sig/E7(detox)/HSP70 DNA vaccines were delivered intramuscularly by syringe needle injection. The dose was chosen based on the optimal dosage conditions most commonly used in other studies [Gurunathan, S et al., Annu Rev Immunol 2000, 18:927-974]. These mice received a booster with the same regimen one week later.

    [0207] Biojector Mediated DNA Vaccination: The Biojector 2000 (Bioject Inc., Portland, Oreg.) is a needle-free jet injection device consisting of an injector and a disposable syringe. The orifice size controls the depth of penetration. 50 ?g/mouse of pNGVL4a-Sig/E7(detox)/HSP70 were delivered to the shaved flank region of C57BL/6 mice using the Biojector with no. 2 syringe nozzle. We have adopted the same dosage used in needle i.m. for the biojector administrations. These mice received a booster with the same regimen one week later.

    [0208] Gene Gun Mediated DNA Vaccination: DNA-coated gold particles (1 ?g DNA/bullet) were delivered to the shaved abdominal region of C57BL/6 mice using a helium-driven gene gun (BioRad, Hercules, Calif) with a discharge pressure of 400 p.s.i. C57BL/6 Mice were vaccinated via gene gun with 2? of pNGVL4a-Sig/E7(detox)/HSP70 DNA vaccine. The dose was chosen based on the optimal dosage conditions most commonly used in other studies (Gurunathan et al., supra). These mice received a booster with the same regimen one week later.

    [0209] Intracellular Cytokine Staining with Flow Cytometry Analysis to Detect IFN-? Secretion by E7-Specific CD8.sup.+ T Cells: Cell surface marker staining for CD8 and intracellular cytokine staining for IFN-? as well as FACScan analysis were performed using conditions described previously (Chen, C H et al., Vaccine 2000, 18:2015-2022). Prior to FACScan, splenocytes from different vaccinated groups of mice were collected and incubated for 20 hours either with or without 1 ?g/ml of E7 peptide (aa 49-57, RAHYNIVTF (SEQ ID NO:16) [Feltkamp, M C et al., Eur J Immunol 1993, 23:2242-2249] containing an MHC class I epitope for detecting E7-specific CD8 T cell precursors. The number of IFN-?-secreting CD8.sup.+ T cells was analyzed using flow cytometry. Analysis was performed on a Becton-Dickinson FACScan with CELLQuest software (Becton Dickinson Immunocytometry System, Mountain View, Calif.).

    [0210] In vivo Tumor Treatment Experiment: An in vivo tumor treatment experiment was performed using the conditions described previously (Ji, H et al., Int J Cancer 1998, 78:41-45]. Mice (5 per group) were intravenously challenged with 1?10.sup.4 cells/mouse TC-1 tumor cells via tail vein. Three days after tumor challenge, mice were administered 50 ?g/mouse of DNA vaccine by i.m. or biojector or were administered 2 ?g/mouse of DNA vaccine by gene gun. One week after the first vaccination, these mice were boosted with the same regimen and method as the first vaccination. Mice were sacrificed and lungs were explanted on day 28 after TC-1 challenge. The number of pulmonary tumor nodules and the total pulmonary weight in each mouse were evaluated.

    [0211] In Vivo Tumor Protection Experiment: An in vivo tumor protection experiment was performed using the conditions described previously [Lin et al., supra]. Mice (5 per group) received 50 ?g/mouse of DNA vaccines by i.m. or biojector, or mice received 2 ?g/mouse by gene gun. One week later, mice were boosted with the same regimen and method as the first vaccination. Mice were subcutaneously challenged with 5?10.sup.4 cells/mouse TC-1 tumor cells one week after the last vaccination. Tumor growth was examined by palpation and inspection twice a week. Percentage of tumor free mice were recorded.

    [0212] Statistical Analysis: All data expressed as means?SE are representative of at least two different experiments. Data for intracellular cytokine staining with flow cytometry analysis and tumor treatment experiments were evaluated by analysis of variance (ANOVA). Comparisons between individual data points were made using a student's t-test. In the tumor protection experiment, the principal outcome of interest was time to development of tumor. The event time distributions for different mice were compared by use of the method of Kaplan and Meier and by use of the log-

    EXAMPLE II

    pNGVL4a-Sig/E7(Detox)/FISP70 DNA Vector Administered by Gene Gun Generated Highest Number of E7-Specific CD8.SUP.+ T Cells in Immunized Mice

    [0213] This study compared the ability of the pNGVL4a-Sig/E7(detox)/HSP70 DNA vaccine composition to generate E7-specific CD8.sup.+ T cell precursors by evaluation intracellular cytokines in splenocytes from mice vaccinated with the same DNA construct by three different modes of administration: needle i.m., biojector, and gene gun. Splenocytes from nave or immunized vaccinated groups of mice were incubated with or without the MHC class I (H-2 D.sup.b)-restricted E7 peptide (aa 49-57) (SEQ ID NO:2) to detect E7-specific CD8.sup.+ T cells.

    [0214] Results are shown in FIGS. 1A and 1B/Mice vaccinated via gene gun exhibited significantly higher numbers (p<0.05) of E7-specific IFN-?.sup.+ CD8.sup.+ T cell precursors per fixed number of splenocyte (832.5) compared to mice vaccinated via biojector (445.5) and needle i.m. (375.5). These findings suggest that the gene gun approach was somewhat more potent in this setting. However, i.m. injection was also effective.

    EXAMPLE III

    Vaccinated Mice Were Protected In Vivo Against E7-Expressing Tumors

    [0215] The next study investigated protection against TC-1 tumor, expressing the same antigen, E7, as the pNGVL4a-Sig/E7(detox)/HSP70 vaccine, administered by the three routes. In vivo tumor protection experiment (vaccination before tumor challenge) used the well-characterized E7-expressing tumor model, TC-1. As shown in FIG. 2, mice receiving pNGVL4a-Sig/E7(detox)/HSP70 via gene gun, biojector, or needle i.m. remained 100% tumor free after TC-1 tumor challenge. Thus, this vaccine vector administered by different routes generated total protection against growth of later-administered tumor cells expressing the E7 antigen.

    EXAMPLE IV

    The E7 Vaccine was Therapeutic in Mice Bearing the TC-1 Tumor

    [0216] Sig/E7(detox)/HSP70 vaccine was administered to mice bearing the TC-1 tumor under conditions where, in untreated controls, tumor metastasis to the lungs occurred by hematogenous spread. Metastasis was assessed by enumeration of lung nodules and by weighing lungs. As shown in FIGS. 3 and 4, mice receiving pNGVL4a-Sig/E7(detox)/HSP70 via gene gun exhibited the lowest number of pulmonary nodules and lowest pulmonary weight of the three groups of vaccinated mice and na?ve controls. The differences between the three vaccinated groups did not reach statistical significance.

    [0217] Furthermore, the variance (standard deviation and standard error (SE)) in the number of pulmonary nodules and pulmonary weight was smaller in the animals vaccinated by gene gun and biojector as compared to the groups vaccinated by injection i.m. with a syringe.

    Discussion of Examples I-IV

    [0218] The foregoing studies focused on the immune and anti-tumor responses of mice immunized with pNGVL4a-Sig/E7(detox)/HSP70 DNA vaccine administered via needle i.m., biojector, and gene gun in mice. The studies employed doses and conditions shown by the present inventors and their colleagues to be optimal

    [0219] The results indicated that the DNA vaccine administered via gene gun generated the highest immune response, measured as the number of E7-specific CD8.sup.? T cells. The efficacy of this approach was further supported by the fact that gene gun immunization required the least amount of the immunogen to generate a similar or slightly higher anti-tumor effects.

    [0220] These observed differences may be attributable to the capacity of these routes of administration to generate professional antigen presenting cells (APCs) that express the antigen. Intradermal immunization by gene gun can directly target antigen to the skin's professional APCs-, Langerhans cells (Condon, C et al., Nat Med 1996, 2:1122-1128; Porgador, A et al., J Exp Med 1998, 188:1075-1082), allowing improved direct presentation of antigen to T cells by

    [0221] DNA-transfected DCs. In comparison, intramuscular immunization likely targets antigen to myocytes and the antigen encoded by the DNA vaccine is eventually is presented through bone marrow-derived APCs [Fu, T M et al., Mol Med 1997, 3(6), 362-37119]. In this setting, the number of professional APCs expressing antigen may be lower. In these ways, it appears that the route of administration may influence the ability of the present inventors' strategy to enhance DNA vaccine potency.

    [0222] Although gene gun-mediated vaccination may have generated the highest number of antigen-specific CD8.sup.+ T cells, mice receiving the DNA vector via all three routes were protected, remaining 100% tumor free, after TC-1 tumor challenge (FIG. 2). It may be that that the experimental window (i.e., time frame of observation and size of tumor inoculum) may not have been sufficient to allow a clear distinction among the three routes.

    [0223] However, using a more stringent tumor treatment model, only slight and statistically insignificant differences were observed in the number of pulmonary nodules and pulmonary weight among the mice vaccinated with syringe, biojector, and gene gun.

    [0224] CD8.sup.+ T cells are clearly important for the observed antitumor effects of the pNGVL4a-Sig/E7(detox)/HSP70 DNA vaccine.

    [0225] Using human papillomavirus type 16 E7 as a model antigen, the present inventors and colleagues previously evaluated the impact of linking antigen-encoding DNA to DNA encoding HSP70 on the potency of antigen-specific immunity generated by naked DNA vaccines. Vaccines comprising E7-HSP70 fusion genes increased the frequency of E7-specific CD8.sup.+ T cells relative to vaccines containing the wild-type E7 gene alone. More importantly, in vivo antibody depletion experiment demonstrated that E7-HSP70 fusion vaccines exclusively targeted CD8.sup.+ T cells; immunological and antitumor effects were completely independent of CD4.sup.+ T cells and NK cells.

    [0226] The addition of a signal peptide (Sig) to E7/HSP70 may lead to exogenous release of chimeric E7/HSP70 protein. Suto et al. Science 1995, 269:1585-1588, demonstrated that an exogenous antigen chaperoned by a heat shock protein can be channeled into the endogenous pathway, presented by MHC class I molecules, and recognized by CD8.sup.+ T lymphocytes in the classical phenomenon known as cross-priming. Additionally, in vivo studies by Chu et. al., Clin Exp Immunol 2000, 121:216-225, using mice depleted of CD8 or CD4 lymphocyte subsets demonstrated that tumor regression following therapeutic hspE7 protein immunization was CD8-dependent and CD4-independent. Moreover, Huang et al. J Exp Med 2000, 191:403-408, showed that Hsp70 fusion proteins elicit CD4-independent CTL responses. Thus, there are several bases for the conclusion that fusion of HSP70 to E7 enhances the potency of vaccines via CD8-dependent pathways.

    [0227] The administration of the pNGVL4a-Sig/E7(detox)/HSP70 DNA vaccine via the gene gun and biojector may provide more consistency (i.e., lower variance) than intramuscular administration via syringe. Results appearing in FIGS. 3 and 4 showed that the variance in the number of pulmonary nodules and pulmonary weight was smaller when the DNA vaccine is administered by gene gun and biojector than by syringe.

    [0228] Thus, it appears that the instrumentation and method of delivery may influence the consistency of response to this vaccine. Both the gene gun apparatus and the biojector device utilize a standard mechanical method of delivering DNA and may avoid some of the inconsistency introduced by a method that is inherently more variable. Results of previous studies suggested that the biojector apparatus may be a more consistent means than a syringe in delivering such vaccines (Lemon, S M et al., J Med Virol 1983, 12:129-136; Aguiar, J C et al., Vaccine 2001, 20:275-280; Rogers, W O et al., Infect Immun 2001, 69:5565-5572).

    [0229] For mass immunization of humans, safety is an important consideration. First, the DNA may integrate into the host genome, resulting in the inactivation of tumor suppresser genes or the activation of oncogenes which could lead to malignant transformation of the host cell. Because it is estimated that the frequency of integration is much lower than that of spontaneous mutation, integration should not pose any real risk (Nichols, W W et al., Ann N Y Acad Sci 1995, 772:30-39). A second concerns is the potential risk associated with the presence of HPV-16 E7 oncoprotein in host cells. The same concern holds true for the HPV E6 protein. E7 is an oncoprotein that disrupts cell cycle regulation by binding to tumor suppressor pRB protein in nuclei [Lukas, J, J Cell Biol 1994, 125:625-638]. The presence of E7 in host cells may lead to an accumulation of genetic aberrations and eventual malignant transformation. The pNGVL4a-Sig/E7(detox)/HSP70 DNA vaccine allays the latter concern by introducing two key mutations into E7 which preserve its immunogenicity but alleviate its oncogenicity by destroying its ability to bind pRB. A third concern is the risk of inducing for autoimmunity mediated by CTL clones specific for mycobacterial HSP that might cross-react to host HSP. Pathological examination of the vital organs in the pNGVL4a-Sig/E7(detox)/HSP70 DNA vaccinated mice (and recipients of all other similar DNA vaccines that the present inventors have tested) did not reveal any detrimental or other autoimmune pathology.

    [0230] In summary, as shown herein, vaccination with pNGVL4a-Sig/E7(detox)/HSP70 DNA is a safe and effective way to enhance antigen-specific CD8.sup.+ T cell immune responses and antigen-specific antitumor effects.

    [0231] The references cited above are all incorporated by reference herein, whether specifically incorporated or not. All publications, patents, patent applications, GenBank sequences and ATCC deposits, cited herein are hereby expressly incorporated by reference for all purposes.

    [0232] Citation of the documents herein is not intended as an admission that any of them is pertinent prior art. All statements as to the date or representation as to the contents of these documents is based on the information available to the applicant and does not constitute any admission as to the correctness of the dates or contents of these documents.