MUTANT SUCROSE PHOSPHORYLASES WITH IMPROVED GLYCOSYLATION ACTIVITY TOWARDS POLYPHENOLS
20180142276 ยท 2018-05-24
Assignee
Inventors
- Tom Desmet (Nevele, BE)
- Mareike Dirks-Hofmeister (Laudenbach, DE)
- Karel DE WINTER (Zottegem, BE)
- Tom VERHAEGHE (Zwevegem, BE)
Cpc classification
C07H1/00
CHEMISTRY; METALLURGY
C12P19/44
CHEMISTRY; METALLURGY
C07H15/203
CHEMISTRY; METALLURGY
International classification
Abstract
The present invention relates to glycosylating polyphenols via biocatalysis. More specifically the present invention discloses particular mutants of the thermostable sucrose phosphorylase derived from the microorganism Thermoanaerobacterium thermosaccharolyticum which efficiently glycosylate polyphenols such as resveratrol.
Claims
1. An in vitro method to glycosylate a polyphenol comprising: contacting in vitro a sucrose phosphorylase comprising the amino acid sequence of SEQ ID N 1, SEQ ID N 2, SEQ ID N 3, SEQ ID N 4 or SEQ ID N 5 with sucrose or alpha-glucose-1-phosphate, and, a polyphenol, and glycosylating said polyphenol.
2. The in vitro method according to claim 1 wherein said polyphenol is a stilbenoid.
3. The in vitro method according to claim 2 wherein said stilbenoid is resveratrol.
4. The in vitro method according to claim 1 wherein said polyphenol is a flavonoid.
5. The in vitro method according to claim 4 wherein said flavonoid is apigenine, hesperetin, quercetin or epicatechin
6. The in vitro method according to claim 1 wherein said polyphenol is a phenoxyphenol.
7. An in vitro method to glycosylate a polyphenol comprising: contacting in vitro a sucrose phoshorylase with sucrose or alpha-glucose-1 phosphate, and, a polyphenol, and, glycosylating said polyphenol, wherein said sucrose phoshorylase is a fragment of SEQ ID N 1, 2, 3, 4 or 5 that has at least 90% sequence identity with SEQ ID N 1, 2, 3, 4 or 5 and wherein said fragment comprises, in addition to having the amino acid A,V,T or G at position 134 of SEQ ID N 1-4, respectively, or having a deletion at position 134 as shown by SEQ ID N 5, at least the following 16 catalytic amino acids of SEQ ID N 6: D49, F52, H87, F157, Q165, R195, D197, A198, Y201, E238, H240, H295, D296, D342, Q345 and R399.
8. A variant of the thermostable sucrose phosphorylase derived from the microorganism Thermoanaerobacterium thermosaccharolyticum comprising SEQ ID N 2, 3, 4 or 5, or, comprising a fragment according to claim 7.
Description
BRIEF DESCRIPTION OF FIGURES
[0006]
[0007]
[0008]
DESCRIPTION OF INVENTION
[0009] The present invention discloses improved variants, such as TtSPP_R134A, that can be used for the efficient glycosylation of polyphenols such as resveratrol at gram scales. Indeed, these new biocatalysts are able to (i) reach full and specific conversion of resveratrol in (ii) an aqueous system without the need for solvent additions and (iii) using sucrose as cheap and renewable glycosyl donor. However, it is clear that the variant's improved efficiency is not limited to resveratrol but is also demonstrated on several large acceptors, thereby revealing a substrate promiscuity that is useful for practical applications in various industrial sectors.
[0010] Therefore, the present invention relates to an in vitro method to glycosylate a polyphenol comprising: [0011] contacting in vitro a sucrose phosphorylase comprising the amino acid sequence of SEQ ID N 1 (=variant R134A of TtSPP), SEQ ID N 2 (=variant R134V of TtSPP), SEQ ID N 3 (=variant R134T of TtSPP), SEQ ID N 4 (variant R134G of TtSPP) or SEQ ID N 5 (=variant of TtSPP wherein R134 is deleted) with sucrose (or alternatively with alpha-glucose-1phosphate) and a polyphenol, and [0012] glycosylating said polyphenol.
[0013] SEQ ID N 1 is the following amino acid sequence (A134 is indicated in bold & underlined):
TABLE-US-00001 MALKNKVQLITYPDSLGGNLKTLNDVLEKYFSDVFGGVHILPPFPSSGD RGFAPITYSEIEPKFGTWYDIKKMAENFDILLDLMVNHVSRRSIYFQDF LKKGRKSEYADMFITLDKLWKDGKPVKGDIEKMFLARTLPYSTFKIEET GEEEKVWTTFGKTDPSEQIDLDVNSHLVREFLLEVFKTFSNFGVKIVRL DAVGYVIKKIGTSCFFVEPEIYEFLDWAKGQAASYGIELLLEVHSQFEV QYKLAERGFLIYDFILPFTVLYTLINKSNEMLYHYLKNRPINQFTMLDC HDGIPVKPDLDGLIDTKKAKEVVDICVQRGANLSLIYGDKYKSEDGFDV HQINCTYYSALNCDDDAYLAARAIQFFTPGIPQVYYVGLLAGVNDFEAV KKTKEGREINRHNYGLKEIEESVQKNVVQRLLKLIRFRNEYEAFNGEFF IEDCRKDEIRLTWKKDDKRCSLFIDLKTYKTTIDYINENGEEVKYLV
[0014] SEQ ID N 2 is the following amino acid sequence (V134 is indicated in bold & underlined):
TABLE-US-00002 MALKNKVQLITYPDSLGGNLKTLNDVLEKYFSDVFGGVHILPPFPSSGD RGFAPITYSEIEPKFGTWYDIKKMAENFDILLDLMVNHVSRRSIYFQDF LKKGRKSEYADMFITLDKLWKDGKPVKGDIEKMFLVRTLPYSTFKIEET GEEEKVWTTFGKTDPSEQIDLDVNSHLVREFLLEVFKTFSNFGVKIVRL DAVGYVIKKIGTSCFFVEPEIYEFLDWAKGQAASYGIELLLEVHSQFEV QYKLAERGFLIYDFILPFTVLYTLINKSNEMLYHYLKNRPINQFTMLDC HDGIPVKPDLDGLIDTKKAKEVVDICVQRGANLSLIYGDKYKSEDGFDV HQINCTYYSALNCDDDAYLAARAIQFFTPGIPQVYYVGLLAGVNDFEAV KKTKEGREINRHNYGLKEIEESVQKNVVQRLLKLIRFRNEYEAFNGEFF IEDCRKDEIRLTWKKDDKRCSLFIDLKTYKTTIDYINENGEEVKYLV
[0015] SEQ ID N 3 is the following amino acid sequence (T134 is indicated in bold & underlined):
TABLE-US-00003 MALKNKVQLITYPDSLGGNLKTLNDVLEKYFSDVFGGVHILPPFPSSGD RGFAPITYSEIEPKFGTWYDIKKMAENFDILLDLMVNHVSRRSIYFQDF LKKGRKSEYADMFITLDKLWKDGKPVKGDIEKMFLTRTLPYSTFKIEET GEEEKVWTTFGKTDPSEQIDLDVNSHLVREFLLEVFKTFSNFGVKIVRL DAVGYVIKKIGTSCFFVEPEIYEFLDWAKGQAASYGIELLLEVHSQFEV QYKLAERGFLIYDFILPFTVLYTLINKSNEMLYHYLKNRPINQFTMLDC HDGIPVKPDLDGLIDTKKAKEVVDICVQRGANLSLIYGDKYKSEDGFDV HQINCTYYSALNCDDDAYLAARAIQFFTPGIPQVYYVGLLAGVNDFEAV KKTKEGREINRHNYGLKEIEESVQKNVVQRLLKLIRFRNEYEAFNGEFF IEDCRKDEIRLTWKKDDKRCSLFIDLKTYKTTIDYINENGEEVKYLV
[0016] SEQ ID N 4 is the following amino acid sequence (G134 is indicated in bold & underlined):
TABLE-US-00004 MALKNKVQLITYPDSLGGNLKTLNDVLEKYFSDVFGGVHILPPFPSSGD RGFAPITYSEIEPKFGTWYDIKKMAENFDILLDLMVNHVSRRSIYFQDF LKKGRKSEYADMFITLDKLWKDGKPVKGDIEKMFLGRTLPYSTFKIEET GEEEKVWTTFGKTDPSEQIDLDVNSHLVREFLLEVFKTFSNFGVKIVRL DAVGYVIKKIGTSCFFVEPEIYEFLDWAKGQAASYGIELLLEVHSQFEV QYKLAERGFLIYDFILPFTVLYTLINKSNEMLYHYLKNRPINQFTMLDC HDGIPVKPDLDGLIDTKKAKEVVDICVQRGANLSLIYGDKYKSEDGFDV HQINCTYYSALNCDDDAYLAARAIQFFTPGIPQVYYVGLLAGVNDFEAV KKTKEGREINRHNYGLKEIEESVQKNVVQRLLKLIRFRNEYEAFNGEFF IEDCRKDEIRLTWKKDDKRCSLFIDLKTYKTTIDYINENGEEVKYLV
[0017] SEQ ID N 5 is the following amino acid (amino acid 134 of TtSPP is deleted):
TABLE-US-00005 MALKNKVQLITYPDSLGGNLKTLNDVLEKYFSDVFGGVHILPPFPSSGD RGFAPITYSEIEPKFGTWYDIKKMAENFDILLDLMVNHVSRRSIYFQDF LKKGRKSEYADMFITLDKLWKDGKPVKGDIEKMFLRTLPYSTFKIEETG EEEKVWTTFGKTDPSEQIDLDVNSHLVREFLLEVFKTFSNFGVKIVRLD AVGYVIKKIGTSCFFVEPEIYEFLDWAKGQAASYGIELLLEVHSQFEVQ YKLAERGFLIYDFILPFTVLYTLINKSNEMLYHYLKNRPINQFTMLDCH DGIPVKPDLDGLIDTKKAKEVVDICVQRGANLSLIYGDKYKSEDGFDVH QINCTYYSALNCDDDAYLAARAIQFFTPGIPQVYYVGLLAGVNDFEAVK KTKEGREINRHNYGLKEIEESVQKNVVQRLLKLIRFRNEYEAFNGEFFI EDCRKDEIRLTWKKDDKRCSLFIDLKTYKTTIDYINENGEEVKYLV
[0018] The term polyphenol' relates to hydroxylated molecules that contain at least two benzene rings. The latter polyphenols comprise the flavonoids and stilbenoids. The structural formula of the latter polyphenols and specific, representatives is/are the following:
TABLE-US-00006
[0019] wherein R is at least one H and/or attached glycosides.
[0020] Therefore, the present invention further specifically relates to an in vitro as indicated above method wherein said polyphenol is a stilbenoid, an in vitro method as indicated above wherein said stilbenoid is resveratrol, an in vitro method as indicated above wherein said polyphenol is a flavonoid, and an in vitro method as indicated above wherein said flavonoid is apigenine, hesperetin, quercetin or epicatechin.
[0021] Moreover the present invention relates to an in vitro as indicated above wherein said polyphenol is a phenoxyphenol having the following structural formula:
##STR00003##
wherein R is at least one H and/or attached glycosides
[0022] The present invention further relates to an in vitro method as described above wherein said sucrose phosphorylase is a fragment of SEQ ID N 1, 2, 3, 4 or 5, wherein said fragment comprises, in addition to having the amino acid A,V,T or G at position 134 of SEQ ID N 1-4, respectively, or having a deletion at position 134 as shown by SEQ ID N 5, at least the 16 catalytic amino acids on the amino acid positions as shown in SEQ ID N 6.
[0023] SEQ ID N 6 is thus the amino acid sequence of TtSPP indicating in bold the 16 catalytic amino acids of TtSPP in addition to X on position 134 of SEQ ID N 1-4, wherein X=the amino acid A,V,T or G at position 134 of SEQ ID N 1-4, or is deleted as shown by SEQ ID N 5:
TABLE-US-00007
[0024] In other words, the present invention relates to an in vitro method to glycosylate a polyphenol comprising: [0025] contacting in vitro a sucrose phoshorylase with sucrose or alpha-glucose-1 phosphate, and, a polyphenol, and, [0026] glycosylating said polyphenol, wherein said sucrose phoshorylase is a fragment of SEQ ID N 1, 2, 3, 4 or 5 wherein said fragment comprises, in addition to having the amino acid A,V,T or G at position 134 of SEQ ID N 1-4, respectively, or having a deletion at position 134 as shown by SEQ ID N 5, at least the following 16 catalytic amino acids of SEQ ID N 6: D49, F52, H87, F157, Q165, R195, D197, A198, Y201, E238, H240, H295, D296, D342, Q345 and R399.
[0027] The terms a fragment of SEQ ID N 1, 2, 3, 4 or 5 refer to a part of SEQ ID N 1, 2, 3, 4 or 5 containing less amino acids than SEQ ID N 1, 2, 3, 4 or 5 and that has 100% sequence identity with SEQ ID N 1, 2, 3,4 or 5.
[0028] More specifically, the present invention relates to an in vitro method to glycosylate a polyphenol comprising: [0029] contacting in vitro a sucrose phoshorylase with sucrose or alpha-glucose-1 phosphate, and, a polyphenol, and, [0030] glycosylating said polyphenol, wherein said sucrose phoshorylase is a fragment of SEQ ID N 1, 2, 3, 4 or 5 that has at least 90% sequence identity with SEQ ID N 1, 2, 3, 4 or 5 and wherein said fragment comprises, in addition to having the amino acid A,V,T or G at position 134 of SEQ ID N 1-4, respectively, or having a deletion at position 134 as shown by SEQ ID N 5, at least the following 16 catalytic amino acids of SEQ ID N 6: D49, F52, H87, F157, Q165, R195, D197, A198, Y201, E238, H240, H295, D296, D342, Q345 and R399.
[0031] The terms at least 90% sequence identity refers to a sequence identity of 90, 91, 92, 93, 94, 95, 96, 97, 98, 99 or 100% sequence identity with SEQ ID N 1, 2, 3, 4 or 5.
[0032] The present invention further relates to a variant of the thermostable sucrose phosphorylase derived from the microorganism Thermoanaerobacterium thermosaccharolyticum comprising SEQ ID N 2, 3, 4 or 5, or, comprising a fragment as defined above.
EXAMPLES
[0033] Materials & Methods
[0034] Chemicals. All chemicals were of analytical grades and purchased either from Sigma-Aldrich or Carbosynth.
[0035] Cloning, expression and mutagenesis. Vector constructs for heterologous expression of BaSP- and TtSPP-gene sequences, as well as the designed variants, were inserted into the pCXP34h vector and continuously expressed in E. coli BL21 cells as previously described (Verhaeghe et al, 2014). Site-specific mutations were introduced using phosphorylated primers for whole plasmid PCRs and successive ligation. Generation of the single site-saturation library of position R134 was done likewise using a whole plasmid amplification method with NNK-degeneracy primers. Successful randomization and final plasmids were checked by sequencing.
[0036] Protein extraction and purification. Recombinant proteins were produced and heat-purified as previously described (Cerdobbel et al, 2010). Crude protein extracts for screening purposes were generated by exposing frozen cell pellets from production cultures to lysis buffer (50 mM MOPS-buffer, 50 mM Na.sub.2SO.sub.4, 4 mM MgSO.sub.4, 1 mM EDTA, 1 gL.sup.1 lysozyme, 100 M PMSF, pH 7.5) for 30 min at 37 C. Supernatants after centrifugation were assigned as crude protein extracts. Protein contents were determined according to Bradford using BSA as standard. All proteins were stored at 4 C. until further usage.
[0037] Screening assays. Heat-purified proteins (for tests on different acceptors) or crude protein extracts (for library screening) were incubated to a final concentration of 1 gL.sup.1 with 10 gL.sup.1 acceptor and 1 M sucrose in 50 mM MOPS-buffer at pH 6.5. Assays were performed at 37 C. in microtiterplates shaking at 200 rpm. The product amounts were evaluated after 16 h by semi-quantitative TLC-analysis: 1 l of each sample solution was spotted on a Silica-plate (TLC-Silica gel 60 F254, Merck Millipore) and run in a solvent system from ethylacetate:methanol:water (30:5:4, v/v/v). Plates were oxidized with 10% sulphuric acid and spot intensities were determined using ImagaJ.
[0038] Enzyme kinetics. Kinetics of enzyme variants on resveratrol were determined in an aqueous system containing 20% ionic liquid AMMOENG 101 (kindly provided by Evonik Industries AG) to dissolve the acceptor in a range of 0 to 200 mM. At this concentration of ionic liquid, the kinetic parameters of the enzyme for its natural substrates are not affected. Reactions were started combining 8.5 M heat purified enzymes, 1 M sucrose and the respective acceptor-concentration at 55 C. To determine the initial velocity, samples were taken every 15 minutes for one hour, and inactivated by ten-fold dilution in pure ethanol. Product formation was again quantified by TLC and ImageJ analysis, using purified resveratrol 3-alpha-glucoside as TLC-standard and a respective standard curve for calculations. Kinetic parameters were calculated by non-linear regression of the Michaelis-Menten equation with Sigma Plot v13.0. All experiments were performed in triplicate to obtain kinetic parameters as reproducible mean valuesstandard errors.
[0039] Production and purification of resveratrol 3-alpha-glucoside. Up-scaling of the transglycosylation reactions on resveratrol was performed up to 400 ml volumes. Reactors were stirred continuously at 55 C. for 24 h, and contained 1 M sucrose, 1 mgL.sup.1 enzyme and 10 gL.sup.1 of resveratrol (suspension) in 50 mM MOPS-buffer pH 6.5. Thanks to the quantitative conversion of resveratrol, its glucoside could be simply isolated by repeated ethylacetate extractions to a purity of >90%. The solvent was evaporated and the dried product analyzed by HPLC to determine purity and yield. To verify the identity of the compound by NMR and to produce the standards (TLC, H PLC), further purification was performed by column chromatography on silica gel (EtOAC:MeOH:H.sub.2O; 30:5:4; v/v/v) as described earlier (De Winter et al, 2013).
[0040] HPLC analysis. Reactions were followed for 24 h. Samples were taken at several time points by inactivating aliquots at 100 C. for 10 min, followed by centrifugation. Supernatants were filtered through a 0.2 m polystyrol filter, diluted in DMSO and analyzed by HPLC using a polar Waters XBridge Amide column (2504.6 mm, 3.5 m) and an Alltech 2000ES ELSD-detector (40 C., gas flow 1.5 Lmin.sup.1), supplied with a gradient mixture of eluent A (acetonitrile, 0.2% triehtylamine) and eluent B (0.2% triethylamine): 90% solvent A (6 min), 10-25% solvent B (stepwise, 3% min.sup.1), 25% solvent B (20 min) and 90% solvent A (10 min). Concentrations of ingredients and respective yields were calculated according to standards of fructose, glucose and resveratrol 3-alpha-glucoside.
[0041] NMR analysis of the resveratrol 3-alpha-glucoside. The chemical structure of the purified resveratrol glycoside was inferred from the combination of 1D NMR (.sup.1H NMR and .sup.13C NMR) and 2D NMR (gCOSY, gHSQC and gHMBC) spectroscopic analysis; J values are given in Hz.
[0042] .sub.H(400 MHz; CD.sub.3OD) 7.39 (2H, d, J=8.6, 2-H and 6-H), 7.04 (1H, d, J=16.3, 8-H), 6.87 (1H, d, J=16.3, 7-H), 6.86 (1H,s, 2-H),6.80 (2H, d, J=8.6, 3-H and 5-H), 6.62 (1H, s, 6-H), 6.54 (1H, s, 4-H), 5.50 (1H, d, J=3.5, 1-H), 3.87 (1H, dd, J=9.7 and 8.9, 3-H), 3.76 (2H, m, 6-Ha, 6-Hb), 3.72 (1H, ddd, J=9.7, 4.2 and 2.5, 5-H), 3.60 (1H, dd, J=9.7 and 3.6, 2-H) and 3.48 (1H, dd, J=9.7 and 8.9, 4-H).
[0043] .sub.C(100 MHz; CD.sub.3OD) 160.23 (C-3), 159.87 (c-5), 158.73 (C-4), 141.75 (C-1), 130.63 (C-1), 130.25 (C- 8), 129.18 (C-2 and C-6), 127.01 (C-7), 116.83 (C-3 and C-5), 108.70 (C-6), 107.85 (C-2), 104.88 (C-4), 99.61 (C-1), 75.28 (C-3), 74.63 (C-5), 73.64 (C-2), 71.81 (C-4), 62.63 (C-6).
[0044] According to the COSY experiment, the proton spectrum displays a CHCH-group, AABB and AMX spin systems of para-disubstituted and 1,3,5-trisubstituted aromatic rings, and one saccharide unit. The set of extracted vicinal constants (d,J=3.5 Hz) identified a-glucose, while the magnitude of J.sub.7-H, 8-H (16.3 Hz) proved the trans-conformation of resveratrol. The position of the glycosylation was confirmed by the HMBC contact of the C-3 with 1-H.
[0045] Results
[0046] Two (thermo)stable SP enzymes have so far been identified, i.e. one in Bifidobacterium adolescentis (BaSP) and one in Thermoanaerobacterium thermosaccharolyticum (TtSPP)..sup.[9] The latter actually prefers sucrose 6-phosphate as substrate (EC 2.4.1.329) but can still efficiently use sucrose as glycosyl donor (K.sub.m=77 mM)..sup.[9b] Neither of these enzymes display significant activity on resveratrol or other polyphenolic compounds as acceptor.
[0047] We tested the corresponding R134A variant for transglycosylation activity on resveratrol and smaller building blocks (
[0048] Interestingly, the unbolted R134 variants enabled us to determine kinetic parameters for the glycosylation of resveratrol (Table 1), which has never been possible with the wild-type enzyme. These measurements revealed that the affinity for resveratrol is quite reasonable, with K.sub.m-values in the range of 50-200 mM. As expected, the improvements in accessibility strongly influence the k.sub.cat-value, which gradually increases to 2.4 s.sup.1 when smaller side chains are introduced at position 134. The highest catalytic efficiency (12.8 M.sup.1 s.sup.1) is observed with variant R134A, which thus is the enzyme of choice for application in glycoside synthesis.
TABLE-US-00008 TABLE 1 Kinetic parameters of TtSPP variants for resveratrol glycosylation.sup.[a] enzyme K.sub.m [mM] k.sub.cat [s.sup.1] k.sub.cat/K.sub.m [M.sup.1 s.sup.1] R134A 185 32 2.36 0.25 12.8 2.6 R134V 110 9 0.45 0.02 4.1 0.4 R134T 56 8 0.08 0.004 1.4 0.2 .sup.[a]Using as co-substrate 1M sucrose at pH 6.5 and 55 C.
[0049] The improved accessibility of the active site should be not exclusive for resveratrol but should also be noticeable with other large acceptors. Therefore, variant R134A was tested on a variety of (poly)phenols to evaluate its full promiscuity and potential as biocatalyst. Similar to the meta-benzenediol series (resorcinolorcinolresveratrol) shown in
[0050] When comparing these three enzymes on more phenolic acceptors, the increased promiscuity of R134A towards large molecules became even more obvious (
[0051] The feasibility to use variant R134A as biocatalyst for the glycosylation of resveratrol in an aqueous system was then demonstrated by mixing the enzyme and 1 M sucrose with a saturated suspension of 10 g.L.sup.1 resveratrol. After 24 h incubation at 55 C., complete conversion of the acceptor was achieved (
REFERENCES
[0052] Aerts, D., Verhaeghe, T. F., Roman, B. I., Stevens, C. V., Desmet, T. and Soetaert, W. (2011b). Transglucosylation potential of six sucrose phosphorylases toward different classes of acceptors. Carbohydr. Res. 346:1860-1867.
[0053] Biagi, M. and Bertelli, A. A. E. (2015). Wine, alcohol and pills: What future for the French paradox? Life Sci.
[0054] Bornscheuer, U. T., Huisman, G. W., Kazlauskas, R. J., Lutz, S., Moore, J. C. and Robins, K. (2013). Engineering the third wave of biocatalysis. Nature. 485:185-194.
[0055] Breton, C., Fournel-Gigleux, S. and Palcic, M. M. (2012). Recent structures, evolution and mechanisms of glycosyltransferases. Curr. Opin. Struct. Biol.1-10.
[0056] Bungaruang, L., Gutmann, A. and Nidetzky, B. (2013). Leloir Glycosyltransferases and Natural Product Glycosylation: Biocatalytic Synthesis of the C-Glucoside Nothofagin, a Major Antioxidant of Redbush Herbal Tea. Adv. Synth. Catal. 355:2757-2763.
[0057] Cerdobbel A, De Winter K, Desmet T, Soetaert W (2010) Sucrose phosphorylase as cross-linked enzyme aggregate: Improved thermal stability for industrial applications Biotechnol J, 5:1-6.
[0058] Cerdobbel, A., De Winter, K., Aerts, D., Kuipers, R., Joosten, H. J., Soetaert, W. and Desmet, T. (2011). Protein Eng., Des. Sel. 24:829-834.
[0059] Chaloupkova, R., Sykorova, J., Prokop, Z., Jesenska, A., Monincova, M., Pavlova, M., Tsuda, M., Nagata, Y. and Damborsky, J. (2003). Modification of Activity and Specificity of Haloalkane Dehalogenase from Sphingomonas paucimobilis UT26 by Engineering of Its Entrance Tunnel. J. Biol. Chem. 278:52622-52628.
[0060] de Roode, B. M., Franssen, M. C. R., van der Padt, A. and Boom, R. M. (2003). Perspectives for the Industrial Enzymatic Production of Glycosides. Biotechnol. Prog. 19:1391-1402.
[0061] De Winter, K., Desmet, T., Devlamynck, T., Van Renterghem, L., Verhaeghe, T., Pelantov, H., Ken, V. and Soetaert, W. (2014). Biphasic Catalysis with Disaccharide Phosphorylases: Chemoenzymatic Synthesis of -d-Glucosides Using Sucrose Phosphorylase. Org. Process Res. Dev. 18:781-787.
[0062] De Winter, K., Verlinden, K., Ken, V., Weignerov, L., Soetaert, W. and Desmet, T. (2013). Green Chem. 15:1949-1955.
[0063] Desmet, T. and Soetaert, W. (2012). Process Biochemistry. Process Biochem. 47:11-17.
[0064] Desmet, T., Soetaert, W., Bojarov, P., Ken, V., Dijkhuizen, L., Eastwick-Field, V. and Schiller, A. (2012). Enzymatic Glycosylation of Small Molecules: Challenging Substrates Require Tailored Catalysts. Chem. Eur. J. 18:10786-10801.
[0065] Espn, J.C., Garcia-Conesa, M. T. and Tomas-Barbern, F. A. (2007). Nutraceuticals: Facts and fiction. Phytochemistry. 68:2986-3008.
[0066] Frmont (2000). Biological Effects of Resveratrol. Life Sci. 66:663-673.
[0067] Gantt, R. W., Peltier-Pain, P., Cournoyer, W. J. and Thorson, J. S. (2011). Using simple donors to drive the equilibria of glycosyltransferase-catalyzed reactions. Nat. Chem. Biol. 7:685-691.
[0068] Goedl, C., Sawangwan, T., Mueller, M., Schwarz, A. and Nidetzky, B. (2008). A High-Yielding Biocatalytic Process for the Production of 2-O-(-D-glucopyranosyl)-sn-glycerol, a Natural Osmolyte and Useful Moisturizing Ingredient. Angew. Chem. Int. Ed. 47:10086-10089.
[0069] Gora, A., Brezovsky, J. and Damborsky, J. (2013). Gates of Enzymes. Chem. Rev. 113:5871-5923.
[0070] Kingsley, L. J. and Lill, M. A. (2015). Substrate tunnels in enzymes: Structure-function relationships and computational methodology. Proteins: Struct., Funct., Bioinf. 83:599-611.
[0071] Kitao, S., Ariga, T., Matsudo, T. and Sekine, H. (2014). The Syntheses of Catechin-glucosides by Transglycosylation with Leuconostoc mesenteroidesSucrose Phosphorylase. Biosci., Biotechnol., Biochem. 57:2010-2015.
[0072] Lairson, L. L., Henrissat, B., Davies, G. J. and Withers, S. G. (2008). Glycosyltransferases: Structures, Functions, and Mechanisms. Annu. Rev. Biochem. 77:521-555.
[0073] Maldonado O S, Lucas R, Comelles F, Gonzlez M J, Parra J L, Medinac I, Morales J C (2011). Synthesis and characterization of phenolic antioxidants with surfactant properties: glucosyl- and glucuronosyl alkyl gallates. Tetrahedron 67: 7268-7279.
[0074] Mirza, O., Skov, L. K., Sprogoe, D., van den Broek, L. A. M., BeId man, G., Kastrup, J. S. and Gajhede, M. (2006). Structural Rearrangements of Sucrose Phosphorylase from Bifidobacterium adolescentis during Sucrose Conversion. J. Biol. Chem. 281:35576-35584.
[0075] Monsan, P., Remaud-Simon, M. and Andr, I. (2010). Transglucosidases as efficient tools for oligosaccharide and glucoconjugate synthesis. Curr. Opin. Microbiol. 13:293-300.
[0076] Nestl, B. M. and Hauer, B. (2014). Engineering of Flexible Loops in Enzymes. ACS Catal. 4:3201-3211.
[0077] Novelle, M. G., Wahl, D., Diguez, C., Bernier, M. and de Cabo, R. (2015). Resveratrol supplementation: Where are we now and where should we go? Ageing Res. Rev. 21:1-15.
[0078] Ozaki, S.-I., Imai, H., Iwakiri, T., Sato, T., Shimoda, K., Nakayama, T. and Hamada, H. (2011). Regioselective glucosidation of trans-resveratrol in Escherichia coli expressing glucosyltransferase from Phytolacca americana. Biotechnol. Lett. 34:475-481.
[0079] Palcic, M. M. (2011). Glycosyltransferases as biocatalysts. Curr. Opin. Chem. Biol.1-8.
[0080] Park, E.-J. and Pezzuto, J. M. (2015). The pharmacology of resveratrol in animals and humans. Biochim. Biophys. Acta, Mol. Basis Dis. 1852:1071-1113.
[0081] Puchart, V. (2015). Glycoside phosphorylases: Structure, catalytic properties and biotechnological potential. Biotechnol. Adv.1-16.
[0082] Quideau, S., Deffieux, D., Douat-Casassus, C. and Pouysgu, L. (2011). Plant Polyphenols: Chemical Properties, Biological Activities, and Synthesis. Angew. Chem. Int. Ed. 50:586-621.
[0083] Sproge, D., van den Broek, L. A. M., Mirza, O., Kastrup, J. S., Voragen, A. G. J., Gajhede, M. and Skov, L. K. (2004). Crystal Structure of Sucrose Phosphorylase from Bifidobacterium adolescentist. Biochemistry. 43:1156-1162.
[0084] Thuan, N. H. and Sohng, J. K. (2013). Recent biotechnological progress in enzymatic synthesis of glycosides. J. Ind. Microbiol. Biotechnol. 40:1329-1356.
[0085] Torres, P., Poveda, A., Jimenez-Barbero, J., Parra, J. L., Comelles, F., Ballesteros, A. O. and Plou, F. J. (2011). Enzymatic Synthesis of a-Glucosides of Resveratrol with Surfactant Activity. Adv. Synth. Cata I. 353:1077-1086.
[0086] Verhaeghe, T., Aerts, D., Diricks, M., Soetaert, W. and Desmet, T. (2014). The quest for a thermostable sucrose phosphorylase reveals sucrose 6-phosphate phosphorylase as a novel specificity. Appl. Microbiol. Biotechnol. 98:7027-7037.