ENGINEERED PHOTOSYNTHETIC ORGANISMS, PHOTOSYNTHETIC ELECTRODES INCLUDING THE ENGINEERED PHOTOSYNTHETIC ORGANISMS, PHOTOSYNTHETIC BIOELECTROCHEMICAL CELLS AND PHOTOSYNTHETIC FUEL CELLS
20180138538 ยท 2018-05-17
Inventors
Cpc classification
C12P3/00
CHEMISTRY; METALLURGY
Y02P20/133
GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
C12N9/0071
CHEMISTRY; METALLURGY
C07K19/00
CHEMISTRY; METALLURGY
H01M8/16
ELECTRICITY
H01M14/00
ELECTRICITY
C12N15/74
CHEMISTRY; METALLURGY
Y02E60/50
GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
C12N9/0095
CHEMISTRY; METALLURGY
International classification
H01M8/16
ELECTRICITY
C12N15/74
CHEMISTRY; METALLURGY
Abstract
The present disclosure provides engineered photosynthetic cells and organisms, methods for engineering photosynthetic cells and organisms with increased extracellular electron transport, photo-bioelectrochemical cells (PBECs), anodes for a PBECs and/or photosynthetic microbial fuel cells (PMFCs), methods of generating an electrical current with PBECs, and methods and systems for generating H.sub.2 fuel.
Claims
1-30. (canceled)
31. An engineered photosynthetic cell or organism comprising: an exogenous nucleic acid molecule encoding a non-native redox enzyme capable of extracellular electron transport and a promoter operatively linked to the exogenous nucleic acid molecule encoding the redox enzyme, such that the redox enzyme is expressed in the cell or organism into which it is transformed, wherein the engineered photosynthetic cell or organism has increased extracellular electron transport compared to a corresponding wild-type cell or organism.
32. The engineered photosynthetic cell or organism of claim 31, wherein the cell or organism is a cyanobacterium.
33. The engineered photosynthetic cell or organism of claim 32, wherein the cyanobacterium is selected from the group of cyanobacterium consisting of: Synechococcus elongatus PCC 7942 and Synechocystis sp. PCC6803.
34. The engineered photosynthetic cell or organism of claim 31, wherein the redox enzyme capable of extracellular electron transport is an electro active terminal reductase from an exoelectrogenic organism.
35. The engineered photosynthetic cell or organism of claim 34, wherein the electro active terminal reductase is an outer membrane cytochrome (Omc).
36. The engineered photosynthetic cell or organism of claim 34, wherein the exoelectrogenic organism is a microorganism selected from a genus Geobacter or Shewanella.
37. The engineered photosynthetic cell or organism of claim 31, wherein the redox enzyme is outer membrane cytochrome S (OmcS) from Geobacter sulfurreducens.
38. The engineered photosynthetic cell or organism of claim 37, wherein the exogenous nucleic acid molecule encoding the outer membrane cytochrome S (OmcS) from Geobacter sulfurreducens comprises SEQ ID NO: 3.
39. The engineered photosynthetic cell or organism of claim 35, further comprising one or more exogenous nucleic acid molecules encoding one or more intermediate cytochromes capable of electron transfer to the outer membrane cytochrome (Omc), wherein the one or more intermediate cytochromes are selected from the group consisting of: outer membrane cytochrome B (OmcB), MacA, and PpcA from Geobacter sulfurreducens, MtrABC and OmcA from Shewanella sp.
40. The engineered photosynthetic cell or organism of claim 31, made by a process comprising: providing a cyanobacterium; transforming the cyanobacterium with an expression vector comprising: an expression cassette comprising a nucleic acid molecule encoding an outer membrane cytochrome (Omc) from Geobacter, a promoter operatively linked to the nucleic acid encoding the Omc, and a nucleic acid encoding a selective marker operatively linked to the nucleic acid encoding the Omc; and a targeting sequence directing insertion of the expression cassette into the cyanobacteria genome; and selecting for transformed cyanobacterium expressing the Omc.
41. An anode for a photo-bioelectrochemical cell (PBEC) or a photosynthetic microbial fuel cell (PMFC) comprising: an anode material; one or more engineered photosynthetic cells or organisms comprising an exogenous nucleic acid molecule encoding a non-native redox enzyme capable of extracellular electron transport, wherein the redox enzyme is expressed in the engineered photosynthetic organism or cell, and wherein the engineered photosynthetic cell or organism has increased extracellular electron transport compared to a corresponding wild-type cell or organism; and a matrix of nanostructured material in electrochemical communication with the engineered photosynthetic organism or cell such that the matrix of nanostructured material couples the photosynthetic organism or cell to the anode, wherein the engineered photosynthetic organism or cell is capable of oxidizing water molecules and generating electrons using a light induced photo-electrochemical reaction and wherein at least a portion of electrons generated by the photosynthetic organism or cell are transferred to the anode material via direct electron transfer.
42. The anode of claim 41, wherein the matrix of nanostructured materials is selected from the group of nanostructured materials consisting of: carbon nanotubes, multi-walled carbon nanotubes, fullerenes, carbon nanoparticles, graphenes, two-dimensional carbon nanosheets, graphite platelets, other carbon nanostructured materials, metallic nanoparticles, semiconductor nanoparticles, quantum dots and combinations of these materials.
43. The anode of claim 41, wherein the engineered photosynthetic organism or cell is coupled to the nanostructured material by a linking agent.
44. The anode of claim 43, wherein the linking agent is selected from the group of linking agents consisting of: 1-pyrenebutanoic acid succinimidyl ester (PBSE), a protein homo-bifunctional cross-linking agent, a hetero-bifunctional cross-linking agent, and combinations thereof.
45. A photo-bioelectrochemical cell (PBEC) or a photosynthetic microbial fuel cell (PMFC) comprising: an anode comprising: an anode material; one or more engineered photosynthetic cells or organisms comprising an exogenous nucleic acid molecule encoding a non-native redox enzyme capable of extracellular electron transport, wherein the redox enzyme is expressed in the engineered photosynthetic organism or cell, and wherein the engineered photosynthetic cell or organism has increased extracellular electron transport compared to a corresponding wild-type cell or organism; and a matrix of nanostructured material in electrochemical communication with the engineered photosynthetic organism or cell such that the matrix of nanostructured material couples the photosynthetic organism or cell to the anode, wherein the engineered photosynthetic organism or cell is capable of oxidizing water molecules and generating electrons using a light induced photo-electrochemical reaction and wherein at least a portion of electrons generated by the photosynthetic organism or cell are transferred to the anode material via direct electron transfer; and a cathode composite, wherein, for a PBEC, the cathode composite comprises a cathode and at least one enzyme or metallic catalyst capable of reducing O.sub.2 and, wherein for an PMFC, the cathode composite comprises a cathode capable of reducing H+ to produce H.sub.2.
46. The PBEC of claim 45, wherein the at least one enzyme capable of reducing O.sub.2 is selected from the group consisting of: laccase, bilirubin oxidase, ascorbate oxidase, tyrosinase, catechol oxidase, and combinations thereof.
47. The PBEC or PMFC of claim 45, further comprising a redox mediator.
48. The PBEC or PMFC of claim 45, wherein the anode and cathode conducting materials are selected from the group of materials consisting of: carbon, metal, semiconductor, and combinations thereof, wherein the conducting materials are in bulk form, nanostructure form, or a combination thereof.
49. The PBEC or PMFC of claim 20, wherein the cathode composite further comprises a matrix of nanostructured material coupling the at least one enzyme or metallic catalyst capable of reducing the reductant to the cathode.
50. A method of generating an electrical current or generating H.sub.2 fuel, the method comprising: providing a photo-bioelectrochemical cell (PBEC) or photosynthetic microbial fuel cell (PMFC) comprising: an anode comprising: an anode material; one or more engineered photosynthetic cells or organisms comprising an exogenous nucleic acid molecule encoding a non-native redox enzyme capable of extracellular electron transport, wherein the redox enzyme is expressed in the engineered photosynthetic organism or cell, and wherein the engineered photosynthetic cell or organism has increased extracellular electron transport compared to a corresponding wild-type cell or organism; and a matrix of nanostructured material in electrochemical communication with the engineered photosynthetic organism or cell such that the matrix of nanostructured material couples the photosynthetic organism or cell to the anode, wherein the engineered photosynthetic organism or cell is capable of oxidizing water molecules and generating electrons using a light induced photo-electrochemical reaction and wherein at least a portion of electrons generated by the photosynthetic organism or cell are transferred to the anode material via direct electron transfer, and a cathode composite comprising a cathode and at least one enzyme or metallic catalyst capable of reducing O.sub.2 or capable of reducing H+ to produce H.sub.2; and exposing the PBEC/PMFC to light in the presence of water, wherein the engineered photosynthetic cell(s) or organism(s) uses light energy to oxidize a water molecule and generate electrons, which are transferred to the anode via the nanostructured material, and wherein electrons generated at the anode reduce O.sub.2 at the cathode, thereby inducing a potential difference between the anode and the cathode and generating an electrical current, or wherein electrons generated at the anode reduce H+ at the cathode, thereby generating H.sub.2.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0014] Further aspects of the present disclosure will be more readily appreciated upon review of the detailed description of its various embodiments, described below, when taken in conjunction with the accompanying drawings. The components in the drawings are not necessarily to scale, emphasis instead being placed upon clearly illustrating the principles of the present disclosure.
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
DETAILED DESCRIPTION
[0025] Before the present disclosure is described in greater detail, it is to be understood that this disclosure is not limited to particular embodiments described, and as such may, of course, vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting.
[0026] Where a range of values is provided, it is understood that each intervening value, to the tenth of the unit of the lower limit unless the context clearly dictates otherwise, between the upper and lower limit of that range and any other stated or intervening value in that stated range, is encompassed within the disclosure. The upper and lower limits of these smaller ranges may independently be included in the smaller ranges and are also encompassed within the disclosure, subject to any specifically excluded limit in the stated range. Where the stated range includes one or both of the limits, ranges excluding either or both of those included limits are also included in the disclosure.
[0027] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure belongs. Although any methods and materials similar or equivalent to those described herein can also be used in the practice or testing of the present disclosure, the preferred methods and materials are now described.
[0028] Of the publications and patents cited in this specification, those that are incorporated by reference are specifically and individually indicated to be incorporated by reference and are incorporated herein by reference to disclose and describe the methods and/or materials in connection with which the publications are cited. The citation of any publication is for its disclosure prior to the filing date and should not be construed as an admission that the present disclosure is not entitled to antedate such publication by virtue of prior disclosure. Further, the dates of publication provided could be different from the actual publication dates that may need to be independently confirmed.
[0029] As will be apparent to those of skill in the art upon reading this disclosure, each of the individual embodiments described and illustrated herein has discrete components and features which may be readily separated from or combined with the features of any of the other several embodiments without departing from the scope or spirit of the present disclosure. Any recited method can be carried out in the order of events recited or in any other order that is logically possible.
[0030] Embodiments of the present disclosure will employ, unless otherwise indicated, techniques of molecular biology, microbiology, organic chemistry, biochemistry, genetics, botany, nanotechnology, electrochemistry and the like, which are within the skill of the art. Such techniques are explained fully in the literature.
[0031] It must be noted that, as used in the specification and the appended claims, the singular forms a, an, and the include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to a support includes a plurality of supports. In this specification and in the claims that follow, reference will be made to a number of terms that shall be defined to have the following meanings unless a contrary intention is apparent.
[0032] As used herein, the following terms have the meanings ascribed to them unless specified otherwise. In this disclosure, comprises, comprising, containing and having and the like can have the meaning ascribed to them in U.S. Patent law and can mean includes, including, and the like; consisting essentially of or consists essentially or the like, when applied to methods and compositions encompassed by the present disclosure refers to compositions like those disclosed herein, but which may contain additional structural groups, composition components or method steps. Such additional structural groups, composition components or method steps, etc., however, do not materially affect the basic and novel characteristic(s) of the compositions or methods, compared to those of the corresponding compositions or methods disclosed herein. Consisting essentially of or consists essentially or the like, when applied to methods and compositions encompassed by the present disclosure have the meaning ascribed in U.S. Patent law and the term is open-ended, allowing for the presence of more than that which is recited so long as basic or novel characteristics of that which is recited is not changed by the presence of more than that which is recited, but excludes prior art embodiments.
[0033] Prior to describing the various embodiments, the following definitions are provided and should be used unless otherwise indicated.
Definitions
[0034] In describing and claiming the disclosed subject matter, the following terminology will be used in accordance with the definitions set forth below.
[0035] As used herein, the term photosynthetic organism includes an organism, whether single or multi-cellular, capable of carrying out the photosynthetic process of harnessing light energy to induce photochemical oxidation of water molecules to generate electrons. As used herein, the term photosynthetic cell includes a single cell, whether a whole single-cellular organism or a single cell of a multicellular organism (e.g., isolated from such organism), capable of carrying out the photosynthetic process. Thus, in some instances, a photosynthetic cell is also a photosynthetic organism (e.g., a cyanobacterium).
[0036] As used herein, the term photosynthetic compound includes any compound involved in the photosynthetic process, e.g., the process of harnessing light energy to induce a photochemical reaction to oxidize water molecules and generate electrons. Photosynthetic compounds include photosynthetic proteins and protein complexes, such as, but not limited to, PSI, PSII, cyt b.sub.6f, plastocyanin, phycocyanin, and phycoerythrin as well as other non-protein, photosynthetic molecules, such as, but not limited to, plastoquinone and carotenoids. The photosynthetic compounds of the present disclosure may be isolated from the host organism and organelles in which they originate, or they may be located in a thylakoid membrane or thylakoid organelle or photosynthetic bacterial organism.
[0037] As used herein, the term photosynthetic reaction center (PSRC) refers to one or more photosynthetic compounds as defined above. A PSRC may include a single photosynthetic compound (e.g., PSII) or it may contain a group of photosynthetic compounds, whether isolated or working in a cluster or entity (e.g., in a thylakoid membrane, photosynthetic cell, and/or photosynthetic organism). A PSRC, as used in the present disclosure, has the ability to harness light energy to induce a photochemical reaction to oxidize water molecules and generate electrons.
[0038] As used herein, the term extracellular electron transport or extracellular electron transfer (EET) refers to the transfer of electrons outside of the cellular membrane of a photosynthetic cell/organism to an external (e.g., extracellular) electron acceptor. Organisms capable of such extracellular electron transport are called exoelectrogens.
[0039] As used in the present disclosure, two materials are in electrochemical communication when electrons generated by a chemical reaction of one material (e.g., photosynthetic reaction centers) can be transferred to and/or accepted by the other material (e.g., nanostructured material and/or electrode).
[0040] Direct electron transfer, as used in the present application, indicates that an electron can be transferred to an electrode (e.g., anode) from a photosynthetic cell/organism that catalyzed the reaction that produced the electron, as opposed to having to be transferred to the electrode by a separate shuttle molecule (e.g., a redox mediator or redox shuttle). In embodiments of the present application, direct electron transfer includes the transfer of electrons generated from a photosynthetic compound/reaction center in the cell/organism to the electrode through a nanostructured material or matrix of nanostructured materials, such as where the nanostructured material couples the photosynthetic organism/cell to the electrode. The presence of direct electron transfer in an electrochemical cell of the present disclosure does not preclude the existence of some electron transfer occurring through a mediator, it just indicates that direct electron transfer is occurring in the cell.
[0041] As used herein, the term anode or anode composite refers to a construct that provides the anode function in a photosynthetic electrochemical cell of the present disclosure. In embodiments, the anode/anode composite includes an anode/anode material as well as any other materials or components coupled to the anode that provide for the oxidizing capability of the anode (e.g., nanostructured matrix material, photosynthetic organism/cell, and the like, as well as compounds or liking agents used to couple the anode to the other components of the anode composite). Similarly, the term cathode or cathode composite refers to a construct that includes the cathode/cathode material as well as other materials that provide for the reducing activity of the cathode (e.g., the cathode and a compound capable of reducing O.sub.2 or producing H.sub.2, as well as any compounds or agents used to couple the cathode to the other components of the cathode composite, such as nanostructured materials and/or any linking agents).
[0042] The term matrix of nanostructured materials, as used in the present disclosure, includes a network or multi-dimensional structure of nanoparticles capable of coupling photosynthetic cells/organisms to an electrode.
[0043] Redox mediator or redox shuttle refers to a compound capable of assisting in the transfer of electrons between a redox enzyme (e.g., a photosynthetic compound of the present disclosure that oxidizes water and generates electrons) and an electrode.
[0044] The terms nucleic acid and polynucleotide are terms that generally refer to a string of at least two base-sugar-phosphate combinations. As used herein, the terms include deoxyribonucleic acid (DNA) and ribonucleic acid (RNA) and generally refer to any polyribonucleotide or polydeoxyribonucleotide, which may be unmodified RNA or DNA or modified RNA or DNA. RNA may be in the form of a tRNA (transfer RNA), snRNA (small nuclear RNA), rRNA (ribosomal RNA), mRNA (messenger RNA), anti-sense RNA, RNAi (RNA interference construct), siRNA (short interfering RNA), or ribozymes. Thus, for instance, polynucleotides as used herein refers to, among others, single- and double-stranded DNA, DNA that is a mixture of single- and double-stranded regions, single- and double-stranded RNA, and RNA that is mixture of single- and double-stranded regions, hybrid molecules comprising DNA and RNA that may be single-stranded or, more typically, double-stranded or a mixture of single- and double-stranded regions. The terms nucleic acid sequence and oligonucleotide also encompasses a nucleic acid and polynucleotide as defined above.
[0045] In addition, polynucleotide as used herein refers to triple-stranded regions comprising RNA or DNA or both RNA and DNA. The strands in such regions may be from the same molecule or from different molecules. The regions may include all of one or more of the molecules, but more typically involve only a region of some of the molecules. One of the molecules of a triple-helical region often is an oligonucleotide.
[0046] It will be appreciated that a great variety of modifications have been made to DNA and RNA that serve many useful purposes known to those of skill in the art. The term polynucleotide as it is employed herein embraces such chemically, enzymatically or metabolically modified forms of polynucleotides, as well as the chemical forms of DNA and RNA characteristic of viruses and cells, including simple and complex cells, inter alia. For instance, the term polynucleotide includes DNAs or RNAs as described above that contain one or more modified bases. Thus, DNAs or RNAs comprising unusual bases, such as inosine, or modified bases, such as tritylated bases, to name just two examples, are polynucleotides as the term is used herein.
[0047] The term also includes PNAs (peptide nucleic acids), phosphorothioates, and other variants of the phosphate backbone of native nucleic acids. Natural nucleic acids have a phosphate backbone, artificial nucleic acids may contain other types of backbones, but contain the same bases. Thus, DNAs or RNAs with backbones modified for stability or for other reasons are nucleic acids or polynucleotides as that term is intended herein.
[0048] A gene typically refers to a hereditary unit corresponding to a sequence of DNA that occupies a specific location on a chromosome and that contains the genetic instruction for a characteristic(s) or trait(s) in an organism.
[0049] As used herein, the term transfection refers to the introduction of an exogenous and/or recombinant nucleic acid sequence into the interior of a membrane enclosed space of a living cell, including introduction of the nucleic acid sequence into the cytosol of a cell as well as the interior space of a mitochondria, nucleus, or chloroplast. The nucleic acid may be in the form of naked DNA or RNA, it may be associated with various proteins or regulatory elements (e.g., a promoter and/or signal element), or the nucleic acid may be incorporated into a vector or a chromosome.
[0050] As used herein, transformation or transformed refers to the introduction of a nucleic acid (e.g., DNA or RNA) into cells in such a way as to allow expression of the coding portions of the introduced nucleic acid.
[0051] As used herein a transformed cell is a cell transfected with a nucleic acid sequence.
[0052] As used herein, a transgene refers to an artificial nucleic acid which is used to transform a cell of an organism, such as a bacterium or a plant.
[0053] As used herein, transgenic refers to a cell, tissue, or organism that contains a transgene.
[0054] As used herein, the term exogenous DNA or exogenous nucleic acid sequence or exogenous polynucleotide refers to a nucleic acid sequence that was introduced into a cell, organism, or organelle via transfection. Exogenous nucleic acids originate from an external source, for instance, the exogenous nucleic acid may be from another cell or organism and/or it may be synthetic and/or recombinant. While an exogenous nucleic acid sometimes originates from a different organism or species, it may also originate from the same species (e.g., an extra copy or recombinant form of a nucleic acid that is introduced into a cell or organism in addition to or as a replacement for the naturally occurring nucleic acid). Typically, the introduced exogenous sequence is a recombinant sequence.
[0055] As used herein, isolated indicates removed or separated from the native environment. Therefore, isolated DNA can contain both coding (exon) and noncoding regions (introns) of a nucleotide sequence corresponding to a particular gene. An isolated peptide or protein indicates the protein is separated from its natural environment. Isolated nucleotide sequences and/or proteins are not necessarily purified. For instance, an isolated nucleotide or peptide may be included in a crude cellular extract or they may be subjected to additional purification and separation steps.
[0056] With respect to nucleotides, isolated nucleic acid refers to a nucleic acid with a structure (a) not identical to that of any naturally occurring nucleic acid or (b) not identical to that of any fragment of a naturally occurring genomic nucleic acid spanning more than three separate genes, and includes DNA, RNA, or derivatives or variants thereof. The term covers, for example but not limited to, (a) a DNA which has the sequence of part of a naturally occurring genomic molecule but is not flanked by at least one of the coding sequences that flank that part of the molecule in the genome of the species in which it naturally occurs; (b) a nucleic acid incorporated into a vector or into the genomic nucleic acid of a prokaryote or eukaryote in a manner such that the resulting molecule is not identical to any vector or naturally occurring genomic DNA; (c) a separate molecule such as a cDNA, a genomic fragment, a fragment produced by polymerase chain reaction (PCR), ligase chain reaction (LCR) or chemical synthesis, or a restriction fragment; (d) a recombinant nucleotide sequence that is part of a hybrid gene, e.g., a gene encoding a fusion protein, and (e) a recombinant nucleotide sequence that is part of a hybrid sequence that is not naturally occurring. Isolated nucleic acid molecules of the present disclosure can include, for example, natural allelic variants as well as nucleic acid molecules modified by nucleotide deletions, insertions, inversions, or substitutions.
[0057] It is advantageous for some purposes that a nucleotide sequence or peptide is in purified form. The term purified in reference to nucleic acid and/or peptide sequence represents that the sequence has increased purity relative to the natural environment.
[0058] The term polypeptides and protein include proteins and fragments thereof. Polypeptides are disclosed herein as amino acid residue sequences. Those sequences are written left to right in the direction from the amino to the carboxy terminus. In accordance with standard nomenclature, amino acid residue sequences are denominated by either a three letter or a single letter code as indicated as follows: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic Acid (Asp, D), Cysteine (Cys, C), Glutamine (Gln, Q), Glutamic Acid (Glu, E), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), and Valine (Val, V).
[0059] Variant refers to a polypeptide that differs from a reference polypeptide, but retains essential properties. A typical variant of a polypeptide differs in amino acid sequence from another, reference polypeptide. Generally, differences are limited so that the sequences of the reference polypeptide and the variant are closely similar overall and, in many regions, identical. A variant and reference polypeptide may differ in amino acid sequence by one or more modifications (e.g., substitutions, additions, and/or deletions). A substituted or inserted amino acid residue may or may not be one encoded by the genetic code. A variant of a polypeptide may be naturally occurring such as an allelic variant, or it may be a variant that is not known to occur naturally.
[0060] Modifications and changes can be made in the structure of the polypeptides of in disclosure and still obtain a molecule having similar characteristics as the polypeptide (e.g., a conservative amino acid substitution). For example, certain amino acids can be substituted for other amino acids in a sequence without appreciable loss of activity. Because it is the interactive capacity and nature of a polypeptide that defines that polypeptide's biological functional activity, certain amino acid sequence substitutions can be made in a polypeptide sequence and nevertheless obtain a polypeptide with like properties.
[0061] In making such changes, the hydropathic index of amino acids can be considered. The importance of the hydropathic amino acid index in conferring interactive biologic function on a polypeptide is generally understood in the art. It is known that certain amino acids can be substituted for other amino acids having a similar hydropathic index or score and still result in a polypeptide with similar biological activity. Each amino acid has been assigned a hydropathic index on the basis of its hydrophobicity and charge characteristics. Those indices are: isoleucine (+4.5); valine (+4.2); leucine (+3.8); phenylalanine (+2.8); cysteine/cysteine (+2.5); methionine (+1.9); alanine (+1.8); glycine (0.4); threonine (0.7); serine (0.8); tryptophan (0.9); tyrosine (1.3); proline (1.6); histidine (3.2); glutamate (3.5); glutamine (3.5); aspartate (3.5); asparagine (3.5); lysine (3.9); and arginine (4.5).
[0062] It is believed that the relative hydropathic character of the amino acid determines the secondary structure of the resultant polypeptide, which in turn defines the interaction of the polypeptide with other molecules, such as enzymes, substrates, receptors, antibodies, antigens, and the like. It is known in the art that an amino acid can be substituted by another amino acid having a similar hydropathic index and still obtain a functionally equivalent polypeptide. In such changes, the substitution of amino acids whose hydropathic indices are within 2 is preferred, those within 1 are particularly preferred, and those within 0.5 are even more particularly preferred.
[0063] Substitution of like amino acids can also be made on the basis of hydrophilicity, particularly, where the biological functional equivalent polypeptide or peptide thereby created is intended for use in immunological embodiments. The following hydrophilicity values have been assigned to amino acid residues: arginine (+3.0); lysine (+3.0); aspartate (+3.01); glutamate (+3.01); serine (+0.3); asparagine (+0.2); glutamine (+0.2); glycine (0); proline (0.51); threonine (0.4); alanine (0.5); histidine (0.5); cysteine (1.0); methionine (1.3); valine (1.5); leucine (1.8); isoleucine (1.8); tyrosine (2.3); phenylalanine (2.5); tryptophan (3.4). It is understood that an amino acid can be substituted for another having a similar hydrophilicity value and still obtain a biologically equivalent, and in particular, an immunologically equivalent polypeptide. In such changes, the substitution of amino acids whose hydrophilicity values are within 2 is preferred, those within 1 are particularly preferred, and those within 0.5 are even more particularly preferred.
[0064] As outlined above, amino acid substitutions are generally based on the relative similarity of the amino acid side-chain substituents, for example, their hydrophobicity, hydrophilicity, charge, size, and the like. Exemplary substitutions that take various of the foregoing characteristics into consideration are well known to those of skill in the art and include (original residue: exemplary substitution): (Ala: Gly, Ser), (Arg: Lys), (Asn: Gln, His), (Asp: Glu, Cys, Ser), (Gln: Asn), (Glu: Asp), (Gly: Ala), (His: Asn, Gln), (Ile: Leu, Val), (Leu: Ile, Val), (Lys: Arg), (Met: Leu, Tyr), (Ser: Thr), (Thr: Ser), (Tip: Tyr), (Tyr: Trp, Phe), and (Val: Ile, Leu). Embodiments of this disclosure thus contemplate functional or biological equivalents of a polypeptide as set forth above. In particular, embodiments of the polypeptides can include variants having about 50%, 60%, 70%, 80%, 90%, and 95% sequence identity to the polypeptide of interest.
[0065] As used herein functional variant refers to a variant of a protein or polypeptide (e.g., a variant of a CCD enzyme) that can perform the same functions or activities as the original protein or polypeptide, although not necessarily at the same level (e.g., the variant may have enhanced, reduced or changed functionality, so long as it retains the basic function).
[0066] Identity, as known in the art, is a relationship between two or more polypeptide sequences, as determined by comparing the sequences. In the art, identity also refers to the degree of sequence relatedness between polypeptide as determined by the match between strings of such sequences. Identity and similarity can be readily calculated by known methods, including, but not limited to, those described in (Computational Molecular Biology, Lesk, A. M., Ed., Oxford University Press, New York, 1988; Biocomputing: Informatics and Genome Projects, Smith, D. W., Ed., Academic Press, New York, 1993; Computer Analysis of Sequence Data, Part I, Griffin, A. M., and Griffin, H. G., Eds., Humana Press, New Jersey, 1994; Sequence Analysis in Molecular Biology, von Heinje, G., Academic Press, 1987; and Sequence Analysis Primer, Gribskov, M. and Devereux, J., Eds., M Stockton Press, New York, 1991; and Carillo, H., and Lipman, D., SIAM J Applied Math., 48: 1073 (1988).
[0067] Preferred methods to determine identity are designed to give the largest match between the sequences tested. Methods to determine identity and similarity are codified in publicly available computer programs. The percent identity between two sequences can be determined by using analysis software (e.g., Sequence Analysis Software Package of the Genetics Computer Group, Madison Ws.) that incorporates the Needelman and Wunsch, (J. Mol. Biol., 48: 443-453, 1970) algorithm (e.g., NBLAST, and XBLAST). The default parameters are used to determine the identity for the polypeptides of the present disclosure.
[0068] By way of example, a polypeptide sequence may be identical to the reference sequence, that is be 100% identical, or it may include up to a certain integer number of amino acid alterations as compared to the reference sequence such that the % identity is less than 100%. Such alterations are selected from: at least one amino acid deletion, substitution, including conservative and non-conservative substitution, or insertion, and wherein said alterations may occur at the amino- or carboxy-terminal positions of the reference polypeptide sequence or anywhere between those terminal positions, interspersed either individually among the amino acids in the reference sequence or in one or more contiguous groups within the reference sequence. The number of amino acid alterations for a given % identity is determined by multiplying the total number of amino acids in the reference polypeptide by the numerical percent of the respective percent identity (divided by 100) and then subtracting that product from said total number of amino acids in the reference polypeptide.
[0069] The term expression as used herein describes the process undergone by a structural gene to produce a polypeptide. It is a combination of transcription and translation. Expression generally refers to the expression of a nucleic acid to produce a polypeptide, but it is also generally acceptable to refer to expression of a polypeptide, indicating that the polypeptide is being produced via expression of the corresponding nucleic acid.
[0070] As used herein, the term over-expression and up-regulation refers to the expression of a nucleic acid encoding a polypeptide (e.g., a gene) in a transformed plant cell at higher levels (therefore producing an increased amount of the polypeptide encoded by the gene) than the wild type plant cell (e.g., a substantially equivalent cell that is not transfected with the gene) under substantially similar conditions. Thus, to over-express or increase expression of an CCD nucleic acid refers to increasing or inducing the production of the CCD polypeptide encoded by the nucleic acid, which may be done by a variety of approaches, such as increasing the number of genes encoding for the polypeptide, increasing the transcription of the gene (such as by placing the gene under the control of a constitutive promoter), or increasing the translation of the gene, or a combination of these and/or other approaches. Conversely, under-expression and down-regulation refers to expression of a polynucleotide (e.g., a gene) at lower levels (producing a decreased amount of the polypeptide encoded by the polynucleotide) than in a wild type plant cell. As with over-expression, under-expression can occur at different points in the expression pathway, such as by decreasing the number of gene copies encoding for the polypeptide, inhibiting (e.g., decreasing or preventing) transcription and/or translation of the gene (e.g., by the use of antisense nucleotides, suppressors, knockouts, antagonists, etc.), or a combination of such approaches.
[0071] The term plasmid as used herein refers to a non-chromosomal double-stranded DNA sequence including an intact replicon such that the plasmid is replicated in a host cell.
[0072] As used herein, the term vector or expression vector is used in reference to a vehicle used to introduce an exogenous nucleic acid sequence into a cell. A vector may include a DNA molecule, linear or circular, which includes a segment encoding a polypeptide of interest operably linked to additional segments that provide for its transcription and translation upon introduction into a host cell or host cell organelles. Such additional segments may include promoter and terminator sequences, and may also include one or more origins of replication, one or more selectable markers, an enhancer, a polyadenylation signal, etc. Expression vectors are generally derived from yeast DNA, bacterial genomic or plasmid DNA, or viral DNA, or may contain elements of more than one of these.
[0073] As used herein, the term expression system includes a biologic system (e.g., a cell based system) used to express a polynucleotide to produce a protein. Such systems generally employ a plasmid or vector including the polynucleotide of interest, where the plasmid and/or expression vector is constructed with various elements (e.g., promoters, selectable markers, etc.) to enable expression of the protein product from the polynucleotide. Expression systems use the host system/host cell transcription and translation mechanisms to express the product protein. Common expression systems include, but are not limited to, bacterial expression systems (e.g., E. coli), yeast expression systems, viral expression systems, animal expression systems, and plant expression systems.
[0074] As used herein, the term promoter or promoter region includes all sequences capable of driving transcription of a coding sequence. In particular, the term promoter as used herein refers to a DNA sequence generally described as the 5 regulator region of a gene, located proximal to the start codon. The transcription of an adjacent coding sequence(s) is initiated at the promoter region. The term promoter also includes fragments of a promoter that are functional in initiating transcription of the gene.
[0075] The term operably linked indicates that the regulatory sequences for expression of the coding sequences of a nucleic acid are placed in the nucleic acid molecule in the appropriate positions relative to the coding sequence so as to effect expression of the coding sequence. This same definition is sometimes applied to the arrangement of coding sequences and transcription control elements (e.g. promoters, enhancers, and termination elements), and/or selectable markers in an expression vector.
[0076] As used herein, the term selectable marker refers to a gene whose expression allows one to identify cells that have been transformed or transfected with a vector containing the marker gene. For instance, a recombinant nucleic acid may include a selectable marker operably linked to a gene of interest and a promoter, such that expression of the selectable marker indicates the successful transformation of the cell with the gene of interest.
[0077] The terms native, wild type, or unmodified in reference to an organism (e.g., plant or cell), polypeptide, protein or enzyme, are used herein to provide a reference point for a variant/mutant of an organism, polypeptide, protein, or enzyme prior to its mutation and/or modification (whether the mutation and/or modification occurred naturally or by human design). Typically, the unmodified, native, or wild type organism, polypeptide, protein, or enzyme has an amino acid sequence that corresponds substantially or completely to the amino acid sequence of the polypeptide, protein, or enzyme as it generally occurs naturally.
[0078] An enzyme, as used herein, is a polypeptide that acts as a catalyst, which facilitates and generally speeds the rate at which chemical reactions proceed but does not alter the direction or nature of the reaction.
[0079] A mutation is a heritable change in genetic material, usually relative to a reference wild-type DNA sequence. Mutations can occur as a result of a single base change, multiple base changes, or the addition or deletion of more than one nucleotide to a DNA sequence, or rearrangement of larger sections of genes or chromosomes. Mutations can occur naturally or by human intervention and/or design. An engineered mutation refers to a mutation created by human design (e.g., the mutation did not spontaneously occur by natural causes and/or was the result of intentional human manipulation). A genetically modified or engineered cell/organism is a cell/organism whose genetic material has been altered by one or more engineered mutations (e.g., human induced mutations).
[0080] As used herein, the term enhance, increase, and/or augment generally refers to the act of improving a function or behavior relative to the unmodified, natural, expected or average. For example, a mutated (e.g., engineered) cell that has increased activity over that of the corresponding native/wild type cell, can have an improved activity (e.g. a faster rate of reaction, or occurrence of a measurable activity in the same amount of time) as compared to the activity of the corresponding wild type protein. Thus, as used herein, the term increased external electron transport refers to the transport of electrons from the internal space of the photosynthetic cell/organism outside the cell membrane in an engineered cell at higher levels (therefore providing an increased amount of electrons at the anode, and a corresponding higher signal) than a corresponding wild type cell/organism (e.g., a substantially equivalent photosynthetic cell/organism that is not engineered according to the present disclosure (e.g., not mutated/transfected with a gene for an exogenous external electron transport protein) under substantially similar conditions.
[0081] Having defined some of the terms herein, the various embodiments of the disclosure will be described.
DESCRIPTION
[0082] Embodiments of the present disclosure include engineered photosynthetic cells or organisms, photosynthetic electrochemical systems capable of generating an electric current using light induced photo-electrochemical reactions catalyzed by engineered photosynthetic cells/organisms, and photosynthetic electrochemical fuel cells capable of generating a fuel using light induced photo-electrochemical reactions catalyzed by engineered photosynthetic cells/organism. The present disclosure also provides methods of using the photosynthetic cells/organisms, photosynthetic electrochemical systems and photosynthetic electrochemical fuel cells of the present disclosure.
[0083] As mentioned above, previous attempts to make photo bio-electrochemical cells (PBECs) and/or photosynthetic microbial fuel cells (PMFCs) with photosynthetic organisms, such as cyanobacteria, demonstrated limitations in current densities, which were lower than that of currently available solar and biofuel cells. In order to make them competitive against biofuel cell and photovoltaic technologies, the current densities of PBECs, such as cyanobacteria based PBECs, had to be improved. The methods, cells and systems of the present disclosure achieve increased current densities through the use of genetic engineering to confer photosynthetic cells/organisms with improved external electron transfer (EET).
[0084] The EET capacity of exoelectrogens is a function of their dissimilatory metal reducing properties in an anaerobic environment. Exoelectrogens such as Geobacter and Shewanella exhibit their dissimilatory metal reducing capability with the help of numerous c-type cytochromes that are present on their outer membrane called outer membrane cytochromes (Omc), which execute electron transfer across the cell membrane. Recently, detailed pathways by which these bacteria perform EET through their Omc were elucidated on both a biochemical and genetic basis. Geobacter sp. expresses an array of Omc when they are grown in medium containing insoluble terminal electron acceptors such as Fe(III) oxide and Mn(IV) oxide. Particularly, outer membrane cytochrome S (OmcS) plays a predominant role in EET in Geobacter sulfurreducens. The pili of G. sulfurreducens were found to be aligned with numerous OmcS that help transfer the electrons extracellularly. Cyanobacteria (CB), however, do not contain any of these Omc, and, therefore, are not on par with exoelectrogens for EET, despite their tremendous photosynthetic energy conversion ability with high internal quantum efficiency of 100%. The methods and systems of the present disclosure combine the desired properties of both organisms in engineered organisms/cells with unique properties for photo-bio-electrochemical energy conversion.
[0085] Thus embodiments of the present disclosure provide an engineered photosynthetic cell or organism including an exogenous nucleic acid molecule encoding a non-native (e.g., not naturally occurring in the recipient photosynthetic cell) redox enzyme capable of extracellular electron transport so that when the redox enzyme is expressed in the transformed cell or organism the engineered photosynthetic cell or organism has increased extracellular electron transport compared to a corresponding wild-type cell or organism (e.g., a cell/organism that does not contain the exogenous nucleic acid encoding the non-native redox enzyme). This increased extracellular electron transport provides a greater flow of electrons to the electrode for generation of a higher electrical current. This translates to a greater/higher electrical current in a PBEC and/or a greater/more efficient fuel production in a PMFC.
[0086] In embodiments, the engineered photosynthetic cell/organism includes a promoter operatively linked to the exogenous nucleic acid molecule encoding the non-native redox enzyme, such that the redox enzyme is expressed in the cell or organism into which it is transformed. In embodiments, the promoter is selected from an inducible promoter, constitutive promoters, and the like. Inducible promoters were used in the Examples below to regulate expression under laboratory conditions; however, constitutive promoters, such as, but not limited to P.sub.psbA (Nair, U., et al. (2001). Functional elements of the strong psbAl promoter of Synechococcus elongatus PCC 7942. Journal of Bacteriology 183(5): 1740-1747, which is incorporated herein by reference), P.sub.sc (GeneArt Synechococcus Engineering Kits by Invitrogen life technologies USER GUIDE Publication number MAN0005339, which is incorporated herein by reference), Plastocyanin promoter (Jeamton, W., et al. (2011). Phycocyanin promoter of Spirulina platensis controlling heterologous expression in cyanobacteria. Journal of Applied Phycology 23(1): 83-88, which is incorporated herein by reference) can also be used for constitutive expression of heterologous genes in S. elongates, or other transformed photosynthetic cell/organism.
[0087] In embodiments, the engineered photosynthetic cell/organism also includes a selective marker and/or targeting sequence operatively linked to the nucleic acid molecule encoding the redox enzyme. Selective markers are known in the art and facilitate identification of successfully transformed cells/organism, because the selective marker is operably linked to the exogenous nucleic acid molecule, such that expression of the selective marker (e.g., by a detectable signal) indicates that the organism/cell also contains and can express the exogenous nucleic acid molecule encoding the non-native redox enzyme. In organisms, targeting sequences can help direct the location and/or expression of the exogenous nucleic acid in a desired cell type or location.
[0088] As discussed above, due to their photosynthetic efficiency, in embodiments the photosynthetic cell or organism that is engineered is a cyanobacterium. In embodiments the cyanobacterium can be, but is not limited to, species of cyanobacterium from the genera Synechococcus and Synechocystis. In embodiments, the cyanobacterium can be Synechococcus elongatus PCC7942 or Synechocystis sp. PCC6803. In other embodiments, the cyanobacterium can be Synechococcus sp. strain PCC7002 (Stevens, S. E. and R. D. Porter (1980). Transformation in Agmenellum quadruplicatum. Proceedings of the National Academy of Sciences of the United States of America-Biological Sciences 77(10): 6052-6056, which is hereby incorporated by reference herein), or other species/strain amenable to gene transformation.
[0089] In embodiments, the redox enzyme capable of extracellular electron transport that is transformed into the engineered photosynthetic cell/organism can be an electro active terminal reductase from an exoelectrogenic organism. Exoelectrogenic organisms include organisms such as those discussed above, that are capable of transferring electrons generated in the cell/organism to extracellular electron acceptors (such as an anode/anode composite, anode material, or other material coupled to an anode). Examples of suitable exoelectrogenic organisms as a source of the electro active terminal reductase include, but are not limited to, exoelectrogenic microorganism selected from the genus Geobacter or Shewanella. In embodiments, the electro active terminal reductase can be an outer membrane cytochrome (Omc). In embodiments, the redox enzyme is outer membrane cytochrome S (OmcS) from Geobacter sulfurreducens. In embodiments, the OmcS enzyme is encoded by a nucleic acid sequence having SEQ ID NO: 3 or a nucleic acid sequence having at least 75% sequence identity with SEQ ID NO: 3 (including intervening ranges, such as 80% sequence identity, 90% sequence identity, 95% sequence identity, and so forth) and encoding a derivative of OmcS having the capability of extracellular electron transport. In embodiments, the OmcS enzyme includes the peptide sequence of SEQ ID NO: 4 or a peptide sequence having at least 75% sequence identity with SEQ ID NO: 3 (including intervening ranges, such as 80% sequence identity, 90% sequence identity, 95% sequence identity, and so forth) and retaining the capacity for extracellular electron transport.
[0090] In other embodiments, the redox enzyme is an outer membrane cytochrome from G. sulfurreducens such as OmcB (Leang, C., et al. (2003). OmcB, a c-type polyheme cytochrome, involved in Fe(III) reduction in Geobacter sulfurreducens. Journal of Bacteriology 185(7): 2096-2103, which is hereby incorporated by reference herein), OmcZ (Inoue, K., et al. (2010). Purification and Characterization of OmcZ, an Outer-Surface, Octaheme c-Type Cytochrome Essential for Optimal Current Production by Geobacter sulfurreducens. Applied and Environmental Microbiology 76(12): 3999-4007, which is hereby incorporated by reference herein) and OmcE (Mehta, T., et al. (2005). Outer membrane c-type cytochromes required for Fe(III) and Mn(IV) oxide reduction in Geobacter sulfurreducens. Applied and Environmental Microbiology 71(12): 8634-8641, which is hereby incorporated by reference herein), which are also involved in extracellular electron transfer.
[0091] In some embodiments, additional exogenous nucleic acid molecule(s) encoding one or more intermediate cytochromes capable of electron transfer to the outer membrane cytochrome (Omc) may also be included. In embodiments, the one or more intermediate cytochromes can be, but are not limited to, outer membrane cytochrome B (OmcB), MacA, and PpcA from Geobacter sulfurreducens, which can transfer electrons downstream to OmcS. In embodiments, additional cytochromes can be included in the engineered cell/organism. In embodiments, one or more cytochromes used to engineer the photosynthetic cell/organism include MtrABC and OmcA from Shewanella sp. In embodiments, one or more of the above cytochromes can be used to engineer the photosynthetic cell/organism.
[0092] In embodiments, the engineered photosynthetic cells/organisms of the present disclosure having one or more exogenous nucleic acid molecule(s) encoding one or more non-native redox enzymes and, optionally, one or more intermediate cytochromes have enhanced capacity for extracellular electron transfer due to the expression of the exogenous, non-native redox enzyme (e.g., a membrane cytochrome). An embodiment of an engineered photosynthetic cells and the greater capacity for extracellular electron transfer is illustrated in greater detail in Example 2, below.
[0093] In order to produce the engineered photosynthetic cells/organisms of the present disclosure, in embodiments, the photosynthetic cell/organism is transformed with an expression vector including the nucleic acid molecule encoding the non-native redox enzyme. In embodiments, the vector includes an expression cassette including the nucleic acid molecule encoding the non-native redox enzyme as well as the operably linked promoter and optional selective marker. In embodiments, a targeting sequence is operatively linked to the expression cassette to direct the insertion of the expression cassette (and, hence, the nucleic acid encoding the redox enzyme) into the recipient cell/organism.
[0094] In embodiments, the recipient cell/organism is a cyanobacterium, as described above. In embodiments, the redox enzyme is an Omc, such as, but not limited to, an Omc from a Geobacter species. In embodiments, the cyanobacterium is transformed with the expression vector including the nucleic acid molecule encoding an OmcS (e.g., an Omc from a Geobacter species), a promoter operatively linked to the nucleic acid encoding the OmcS, a nucleic acid encoding a selective marker operatively linked to the nucleic acid encoding the OmcS, and a targeting sequence directing insertion of the expression cassette into the cyanobacteria genome.
[0095] After transforming the recipient cells, successfully transformed cells/organisms are selected using methods known in the art, including, but not limited to selection via a selective marker (e.g., growth on a selective media, fluorescence, and the like) co-transformed with the target redox gene. For instance, if the selective marker is an antibiotic resistance gene, cells can be grown on selective media (e.g., media including the antibiotic) and positive cultures can be selected. In embodiments, further screening can be done to confirm that the exogenous nucleic acid has been successfully incorporated into the recipient cell/organism.
[0096] Embodiments of the present disclosure also include anodes for a photo-bioelectrochemical cell (PBEC) or a photosynthetic microbial fuel cell (PMFC) including the engineered photosynthetic organisms/cells of the present disclosure. In embodiments, the anodes of the present disclosure include an anode material, one or more engineered photosynthetic cells or organisms according to the present disclosure as described above having an exogenous nucleic acid molecule encoding a non-native redox enzyme capable of extracellular electron transport, and a nanostructured material in electrochemical communication with the engineered photosynthetic organism or cell. In embodiments, the engineered photosynthetic organism or cell can oxidize water molecules and generate electrons using a light induced photo-electrochemical reaction wherein at least a portion of electrons generated by the photosynthetic organism or cell are transferred to the anode material via direct electron transfer. Due to the presence of the exogenous redox enzyme, the engineered cells on the anode transfer more electrons out of the cell to the anode than a corresponding non-engineered (wild type) cell/organism.
[0097] In embodiments, the nanostructured material comprises a matrix of nanostructured material that couples the photosynthetic organism or cell to the anode. In embodiments, the matrix of nanostructured materials can be, but is not limited to, carbon nanostructured materials, metallic nanoparticles, semiconductor nanoparticles, quantum dots and combinations of these materials. In embodiments, examples of suitable carbon nanostructured materials include, but are not limited to, carbon nanotubes, multi-walled carbon nanotubes, fullerenes, carbon nanoparticles, graphenes, two-dimensional carbon nanosheets, graphite platelets, and combinations of these materials. In some embodiments the matrix of nanostructured material is multi-walled carbon nanotubes.
[0098] In embodiments, the anode material can be a firm or flexible substrate for supporting the matrix of nanostructure material. In embodiments, the anode material includes conducting materials to conduct the electrons generated by the engineered photosynthetic cell/organism and transferred to the electrode material from the cell/organisms and/or via the nanostructured material. In embodiments, conducting materials for the anode can include, but are not necessarily limited to, carbon, metal, semiconductor, and combinations thereof, wherein the conducting materials are in bulk form, nanostructure form, or a combination thereof. In other embodiments, the anode material/substrate can be a non-conducting material, but something capable of supporting a conducting material, such as a matrix of nanostructured material. For instance, in embodiments, the anode is a carbon paper anode including paper printed with multi-walled carbon nanotubes (CNT). In embodiments, the anode is another substrate modified with CNT or other nanostructure matrix material. In embodiments, the anode can be a carbon brush, such as a Mill-Rose carbon brush, which provides more surface area than carbon paper anodes and are employed in microbial fuel cells. As used herein, the combination of anode material/substrate, matrix of nanostructured material, and engineered photosynthetic organism may be (as a whole) referred to as the anode or as an anode composite.
[0099] In embodiments the engineered photosynthetic organism or cell self-adheres to the nanostructured material or grows/forms a biofilm on the nanostructured material. In some embodiments, the engineered photosynthetic organism or cell is coupled to the nanostructured material by a linking agent. The linking agent can be anything capable of physically and/or chemically linking the organism/cell to the nanostructured material such that electrodes generated by the engineered photosynthetic organism/cell can be transferred to the nanostructured material. In some embodiments including a linking agent, the linking agent can be, but is not limited to, 1-pyrenebutanoic acid succinimidyl ester (PBSE), a protein homo-bifunctional cross-linking agent, a hetero-bifunctional cross-linking agent, and combinations thereof.
[0100] The anodes of the present disclosure described above can be included in a bio-chemical cell, such as a 3 electrode cell, for various purposes. In embodiments, the anode can be included in a PBEC or a PMFC to generate an electric current or an alternative fuel, respectively.
[0101] In embodiments, the present disclosure provides a photo-bioelectrochemical cell (PBEC) including an anode/anode composite of the present disclosure as described above (including the engineered photosynthetic cell/organism of the present disclosure) and a cathode composite including a cathode and at least one enzyme or metallic catalyst capable of reducing a reductant.
[0102] Although the engineered photosynthetic cells/organisms of the present disclosure are capable of direct electron transfer of photosynthetically generated electrons to the anode/nanostructured matrix material, in embodiments, a redox mediator can also be included in and electrochemical cell, PBECs or PMFCs of the present disclosure. In embodiments, the mediator can be, but is not limited to, ferricyanide, a quinone-based compound, an osmium complex based compound, a redox chemical compound, and combinations thereof.
[0103] As discussed above for the anode, in embodiments, the cathode includes conducting materials. In embodiments, such conducting materials can include, but are not necessarily limited to, carbon, metal, semiconductor, and combinations thereof, wherein the conducting materials are in bulk form, nanostructure form, or a combination thereof. In embodiments, the cathode composite can also include matrix of nanostructured material coupling at least one enzyme or metallic catalyst capable of reducing the reductant to the cathode. In embodiments, the cathode material can be a rigid or flexible substrate for supporting the matrix of nanostructured material, and may be a conducting or non-conducting material. In embodiments, the matrix of nanostructured material for the cathode is as described above for the anode.
[0104] Embodiments of the present disclosure include photo-bioelectrochemical cells (PBECs) having an anode of the present disclosure including engineered photosynthetic cells/organisms as described above, and a cathode capable of reducing a reductant. In embodiments, the reductant is O.sub.2. In embodiments, the cathode includes at least one enzyme or metallic catalyst capable of reducing O.sub.2. Embodiments of metallic catalysts capable of reducing include, but are not limited to, platinum. In embodiments of a PBEC of the present disclosure, at least one enzyme capable of reducing O.sub.2 can be, but is not limited to, laccase, bilirubin oxidase, ascorbate oxidase, tyrosinase, catechol oxidase, and combinations thereof.
[0105] The present disclosure also includes methods of generating an electrical current using the engineered photosynthetic cells/organisms of the present disclosure, the anodes of the present disclosure, and the PBECs of the present disclosure. Embodiments of methods of the present disclosure for generating an electrical current include providing a PBEC of the present disclosure including an anode as described above and a cathode composite including a cathode and at least one enzyme or metallic catalyst capable of reducing O.sub.2 and exposing the PBEC to light in the presence of water. Upon exposure to light and water, the engineered photosynthetic cell(s)/organism(s) uses light energy to oxidize a water molecule and generate electrons, which are transferred out of the cell (at least some of them transferred via the non-native redox enzyme, such as, but not limited to an outer membrane cytochrome) and to the anode via the nanostructured material. These electrons generated at the anode reduce O.sub.2 at the cathode, thereby inducing a potential difference between the anode and the cathode and generating an electrical current.
[0106] The present disclosure also includes photosynthetic microbial fuel cells (PMFCs) having an anode of the present disclosure including an engineered photosynthetic cells/organisms as described above, and a cathode composite including a cathode capable of reducing H.sup.+ to produce H.sub.2. Also included in the present disclosure are methods of generating H.sub.2 fuel. In embodiments, methods of generating H.sub.2 include providing a PMFC of the present disclosure including an anode as described above and a cathode composite including a cathode and at least one enzyme or metallic catalyst capable of reducing H.sup.+ to produce H.sub.2. An example of an enzyme capable of reducing H.sup.+ to produce H.sub.2 includes, but is not limited to hydrogenase enzymes. Upon exposing the PMFC to light in the presence of water, the engineered photosynthetic cell(s) or organism(s) uses light energy to oxidize a water molecule and generate electrons, at least some of which are transferred out of the cell (e.g., via the non-native redox enzyme or natural routes) to the anode via the nanostructured material. The electrons generated at the anode reduce H.sup.+ at the cathode, thereby generating H.sub.2.
[0107] The examples below describe embodiments of the present disclosure including genetically engineered heterologous omcS in Synechococcus elongatus PCC7942 to enhance the cyanobacterial extracellular electron transfer to alternate electron acceptors. The examples represent embodiments using genetically engineering highly efficient photosynthetic organisms, such as, but not limited to, cyanobacteria, for enhancing EET as described above.
[0108] Additional details regarding the methods and compositions of the present disclosure are provided in the Examples below. The specific examples below are to be construed as merely illustrative, and not limitative of the remainder of the disclosure in any way whatsoever. Without further elaboration, it is believed that one skilled in the art can, based on the description herein, utilize the present disclosure to its fullest extent. Publications are incorporated by reference only where indicated by notation in the text, such references are incorporated by reference in their entirety.
[0109] It should be emphasized that the embodiments of the present disclosure, particularly, any preferred embodiments, are merely possible examples of the implementations, merely set forth for a clear understanding of the principles of the disclosure. Many variations and modifications may be made to the above-described embodiment(s) of the disclosure without departing substantially from the spirit and principles of the disclosure. All such modifications and variations are intended to be included herein within the scope of this disclosure, and protected by the following claims.
[0110] The following examples are put forth so as to provide those of ordinary skill in the art with a complete disclosure and description of how to perform the methods and use the compositions and compounds disclosed herein. Efforts have been made to ensure accuracy with respect to numbers (e.g., amounts, temperature, etc.), but some errors and deviations should be accounted for. Unless indicated otherwise, parts are parts by weight, temperature is in C., and pressure is at or near atmospheric. Standard temperature and pressure are defined as 20 C. and 1 atmosphere.
[0111] It should be noted that ratios, concentrations, amounts, and other numerical data may be expressed herein in a range format. It is to be understood that such a range format is used for convenience and brevity, and thus, should be interpreted in a flexible manner to include not only the numerical values explicitly recited as the limits of the range, but also to include all the individual numerical values or sub-ranges encompassed within that range as if each numerical value and sub-range is explicitly recited. To illustrate, a concentration range of about 0.1% to about 5% should be interpreted to include not only the explicitly recited concentration of about 0.1 wt % to about 5 wt %, but also include individual concentrations (e.g., 1%, 2%, 3%, and 4%) and the sub-ranges (e.g., 0.5%, 1.1%, 2.2%, 3.3%, and 4.4%) within the indicated range. In an embodiment, the term about can include traditional rounding according to significant figures of the numerical value. In addition, the phrase about x to y includes about x to about y.
EXAMPLES
[0112] Now having described the embodiments of the present disclosure, in general, the following Examples describe some additional embodiments of the present disclosure. While embodiments of present disclosure are described in connection with the following examples and the corresponding text and figures, there is no intent to limit embodiments of the present disclosure to this description. On the contrary, the intent is to cover all alternatives, modifications, and equivalents included within the spirit and scope of embodiments of the present disclosure.
Example 1
[0113] This Example describes an endeavor to provide highly efficient light to electricity conversion in an embodiment of a photosynthetic biological Grtzel cell of the present disclosure (
[0114] Experimental Procedure
[0115] Two different commercially available, wild-type CB strains, Nostoc sp. ATCC27893 and Anabaena variabilis ATCC29413 were obtained.
[0116] Anodes modified with a matrix of nanostructured material (provided by carbon nanotubes (CNTs)) were prepared as briefly described as follows. SpectraCarb 2050-L carbon paper (CP) was used as the base electrode. The CP was treated with a boiling mixture of 1 M nitric acid and 0.5 M sulfuric acid (1:4 ratio) for an hour and washed with double distilled water. The CNT solution (1 mg/mL) was prepared in dimethyl formamide and suspended to form a uniform slurry by sonicating it for 15 minutes in an ultrasonic homogenizer. 5 mL of CNT was drop-cast on the CP, dried in an oven to make a CNT modified CP.
[0117] Each CB species were immobilized separately on the CNT modified anodes to serve as photo-catalysts as described in detail in N. Sekar, Y. Umasankar and R. P. Ramasamy, Physical Chemistry Chemical Physics, 2014, 16, 7862-7871, which is hereby incorporated by reference herein. Briefly, the fresh cyanobacterial culture was washed using phosphate buffer (100 mM, pH 7) and re-suspended in the same buffer. 5 L of the culture was loaded onto CNT modified CP and allowed to air dry at room temperature. The CNT modified CP was used as the anode for the electrochemical experiments.
[0118] A laccase-CNT modified cathode was used for O.sub.2 reduction in PBEC. The 5 mg/ml laccase enzyme solution was prepared by dissolving laccase (laccase from Trametes versicolor in powder form purchased from Sigma Aldrich) in phosphate buffer and immobilized onto CNT modified glassy carbon electrode using the tethering agent 1-pyrenebutanoic acid, succinimidyl ester (PBSE). By using site specific electron transfer inhibitors (indicated with numbered stars (1-4) in
[0119] Results and Discussion Through this work, it was demonstrated that power generation occurred even during dark, similar to that of microbial fuel cells. This is believed to be because the plastoquinone (PQ) pool is shared by both the cytoplasmic (respiration) and thylakoid (photosynthesis) membranes as shown in
[0120] It was also shown that direct electron transfer (DET) was not as facile as the mediated electron transfer (MET) using benzoquinone (BQ) (block arrows in
[0121] The CB cell-based photosynthetic microbial fuel cell (PBEC) of this example generated power density of about 35 and 100 mW/m.sup.2 for direct and mediated operation (
Example 2
[0122] Although photosynthetic microorganisms such as cyanobacteria exhibit light dependent electrogenic characteristics in photo bio-electrochemical cells (PBECs) and/or photosynthetic microbial fuel cells (PMFCs) that generate substantial photocurrents, as discussed above, the generated current densities are lower than their photovoltaic counterparts. Example 1 above demonstrated that a cyanobacterium Nostoc sp. employed in PBEC could generate up to 35 mW m.sup.2 even in a non-engineered PBEC.
[0123] The present example describes novel and successful genetic engineering of cyanobacteria to further enhance its extracellular electron transfer. The cyanobacterium Synechococcus elongatus PCC7942 was genetically engineered to express a non-native redox protein called outer membrane cytochrome S (OmcS) (N. Sekar, R. Jain, Y. Yan and R. P. Ramasamy, Biotechnology and Bioengineering, 2016, 113, 675-679, which is hereby incorporated by reference herein). OmcS is predominantly responsible for metal reducing abilities of exoelectrogens such as Geobacter sp. As described below, the engineered S. elongatus exhibited higher extracellular electron transfer ability resulting in 9 fold higher photocurrent generation on the anode of a PBEC than the corresponding wild-type cyanobacterium.
[0124] Experimental Procedure
[0125] The wild type Synechococcus elongatus PCC7942 was used as a model organism for the present example. Both the wild-type (Wild-CB) and the genetically engineered S. elongatus (Eng-CB) were grown in modified BG11 medium as described in N. Sekar, Y. Umasankar and R. P. Ramasamy, Physical Chemistry Chemical Physics, 2014, 16, 7862-7871, which is hereby incorporated by reference herein. The cyanobacterial cultures were inoculated in the autoclaved media and grown at 302 C. at 100 rpm under continuous illumination using fluorescent lamps (80 mol m.sup.2 s.sup.1). The coding sequence of omcS gene from G. sulfurreducens PCA strain (NC_002939.5) was codon optimized for expression in S. elongatus and synthesized by Genscript. Both the nucleotide sequence for the coding optimized omcS gene (SEQ ID NO: 3) and the encoded OmcS peptide sequence (SEQ ID NO: 4) are provided below.
[0126] The vector pNR1 was constructed by cloning the omcS gene into neutral site I (NSI) targeting pAM2991 vector (N. B. Ivleva, M. R. Bramlett, P. A. Lindahl and S. S. Golden, Embo Journal, 2005, 24, 1202-1210, which is hereby incorporated by reference herein) that harbors spectinomycin resistance gene (spec.sup.R) as an antibiotic selection marker as illustrated in
[0127] Ferricyanide reduction assay was carried out to evaluate the extracellular electron transfer of the cyanobacterium. Both the Wild-CB and the Eng-CB cultures were harvested at an OD.sub.750 of 0.6 by centrifuging the cells at 5000 rpm for 10 minutes at room temperature and re-suspended in fresh BG11 medium. Following induction with 1 mM IPTG, 1 mM potassium ferricyanide (in BG11 medium) was added, and the culture was split into two halves. One half was incubated in light, and the other was covered with aluminum foil and incubated in dark to assess the reduction of potassium ferricyanide in both light and dark conditions. Samples were collected every 4 hours for 48 hours. The chlorophyll content of the samples was measured from the absorbance at 680 nm. The sample was centrifuged at 10,000 rpm for 5 minutes at room temperature, and the absorbance of supernatant was measured at 420 nm to calculate the concentration of residual potassium ferricyanide. The rate of ferricyanide reduction for 12 hours was then normalized with the average chlorophyll content as described in Bradley et al. (Physical Chemistry Chemical Physics, 2013, 15, 13611-13618), which is hereby incorporated by reference herein.
[0128] Electrochemical experiments were conducted with Wild-CB and Eng-CB to investigate the photocurrent generation. Briefly, the cells were harvested by centrifugation and drop-casted onto carbon paper (CP) modified with multi-walled carbon nanotubes (CNT) as described in Sekar, et al. (2014), incorporated by reference above. The same amount of cells was drop-casted onto the electrode for comparing the performance of Wild-CB and Eng-CB. Half-cell electrochemical system with either CP/CNT/Wild-CB or CP/CNT/Eng-CB as working electrode, Ag/AgCl, sat. KCl as reference electrode and platinum wire as counter electrode was employed to measure open circuit potential (OCP) and current generated at an applied voltage using CHI potentiostat (401a models, CH Instruments Inc). All potentials reported here are with respect to Ag/AgCl electrode. 100 mM potassium phosphate buffer (pH 7) was used as electrolyte. A Dolan-Jenner Industries Fibre-Lite lamp (model 190) with a light intensity of 76 mW cm.sup.2 was used for illumination.
[0129] Results and Discussion
[0130] S. elongatus PCC7942 was the first cyanobacterium demonstrated to be reliably transformable by exogenously added DNA as described by Shestako, et al. (1970). Following transformation, omcS was integrated into the NSI site in genomic DNA of S. elongatus by homologous recombination as shown in
[0131] The growth characteristic of Eng-CB was similar to that of Wild-CB implying that the expression of heterologous omcS has no detrimental effect on the cyanobacterium (
[0132] Upon confirming the expression of active omcS, the ability of Eng-CB to reduce the exogenously added potassium ferricyanide was studied and compared with that of Wild-CB. Being highly water soluble, ferricyanide cannot cross the outer membrane of cyanobacteria and is highly appropriate to study direct electron transfer (DET). Thus, the rate of ferricyanide reduction of Wild-CB and Eng-CB was measured in both light and dark condition as shown in
[0133] The photocurrent generation by the genetically modified S. elongatus was investigated using amperometric i-t curve in a photo bio-electrochemical half-cell using the cyanobacterial anode as explained in the experimental procedure. The electrode harboring Eng-CB showed a lower open circuit potential (OCP) compared to that of Wild-CB, which is indicative of Eng-CB being a better anode (
[0134] The current generated by Eng-CB and Wild-CB was measured by applying over-potential of 0.1 V (vs. Ag/AgCl) for both (0.2 V for Eng-CB and 0.25 V for Wild-CB). Eng-CB was observed to generate 9 fold higher current compared to Wild-CB as shown in
[0135] In Geobacter sp., OmcS is a predominant terminal cytochrome that transfers electron from cytochrome bc complex in cytoplasmic membrane to the external milieu with the help of other intermediate periplasmic c-type cytochromes such as MacA and PpcA. Both the cytochrome bc complex of G. sulfurreducens and cytochromes b.sub.6f complex (Cyt b.sub.6f) of S. elongatus are functionally related and belong to the highly conserved Rieske/cytochromes b complexes. Further, certain c-type cytochromes such as cytochromes c.sub.6 (Cyt c.sub.6) are also found in periplasmic space of cyanobacteria that might have functionally complemented the activity of MacA and PpcA.
[0136] Thus, it is believed that electrons from Cyt b.sub.6f were transferred to OmcS through Cyt c.sub.6 (
[0137] Conclusions
[0138] S. elongatus was genetically engineered to express heterologous OmcS, and expression of the active OmcS was confirmed. Eng-CB was found to exhibit enhanced extracellular electron transfer as evident from both the higher rate of ferricyanide reduction (2 fold) and higher photocurrent generation (9 fold) compared to the wild-type cyanobacterium. The higher rate of ferricyanide reduction under both light and dark conditions by Eng-CB underlines the fact that OmcS interacted with both photosynthetic and respiratory electron transport chain of cyanobacteria.
Example 3
[0139] Cyclic voltammogram techniques, with a scan rate as low as 1 mV/s, has been used in microbial fuel cells to probe the electrochemistry of redox proteins on bacterial outer membrane that are in direct contact with the electrode (as described in Baron, D., et al. (2009). Electrochemical Measurement of Electron Transfer Kinetics by Shewanella oneidensis MR-1. Journal of Biological Chemistry 284(42): 28865-28873 and Carmona-Martinez, A. A., et al. (2013). Electron transfer and biofilm formation of Shewanella putrefaciens as function of anode potential. Bioelectrochemistry 93: 23-29, both of which are incorporated by reference herein). In the present example, a similar procedure was conducted to characterize the Eng-CB (made as described in Example 2, above).
[0140] Experimental Procedure
[0141] Eng-CB cells were made as described in Example 2, above. A three electrode system was set up, using Eng-CB immobilized on multi-walled carbon nanotubes (CNT) modified glassy carbon electrode, as a working electrode, Ag/AgCl (sat. KCl) as a reference electrode, and platinum wire as a counter electrode. CV was performed by sweeping the potential between 0.2 V (vs Ag/AgCl) and 0.8 V (vs Ag/AgCl) at a scan rate of 1 mV/s.
[0142] Results and Discussion
[0143] The cyclic voltammograms of the Eng-CB vs. the Wild-CB are shown in
Example 4
[0144] This example describes another embodiment of a photo-bioelectrochemical cell incorporating an engineered photosynthetic CB of the present disclosure on the anode and a cathode modified with CNT and laccase. The photo-bioelectrochemical cell is a self-sustainable system using only water and light as fuel without the necessity for any external organic carbon source. CB on the anode do photosynthesis in the presence of light and transfer electrons from the P-ETC to the electrode. The oxygen generated as the by-product of photosynthesis is enzymatically reduced at the cathode to form water (
[0145] Experimental Procedure
[0146] The photo-bioelectrochemical full cell was developed using CP/CNT/WT-CB or CP/CNT/Eng-CB as anode and CP/CNT/laccase as the enzymatic cathode as shown in
[0147] Results and Discussion
[0148]
[0149] Peptide and Nucleic Acid sequences:
TABLE-US-00001 SEQIDNO:1OmcSforwardprimer GGGAAAGAATTCGAAGGAGTATACCTATACATGAAGAAAGGCATGAAAGT TAGTCTGA SEQIDNO:2OmcSreverseprimer GGGAAAGGATCCTTAATCTTTGGCGTGGCATTTGTTAC SEQIDNO:3:nucleotidesequenceforcodon optimizedOmcScodingsequence,1299bp ATGAAGAAAGGCATGAAAGTTAGTCTGAGCGTGGCGGCGGCAGCACTCCT GATGTCGGCACCGGCAGCGTTCGCATTCCATTCGGGCGGCGTGGCTGAAT GCGAGGGTTGTCACACCATGCATAACAGCCTCGGTGGTGCAGTCATGAAC AGCGCAACGGCACAGTTCACCACGGGTCCAATGCTGCTCCAGGGTGCAAC CCAAAGCTCGAGTTGCCTGAACTGTCACCAACATGCGGGCGATACGGGTC CCAGCTCGTACCACATCAGCACTGCTGAAGCAGACATGCCCGCTGGCACC GCACCGTTGCAGATGACGCCTGGCGGTGATTTTGGCTGGGTCAAAAAGAC CTATACGTGGAACGTTCGCGGCCTGAATACGAGCGAAGGCGAGCGCAAAG GTCACAACATTGTTGCGGGCGATTACAATTATGTGGCTGACACTACCCTC ACGACTGCACCAGGTGGCACCTACCCAGCAAACCAGTTGCATTGCAGTAG CTGTCACGATCCGCATGGCAAATATCGCCGCTTCGTCGACGGCTCGATCG CAACCACGGGTCTGCCGATTAAGAATAGCGGCTCGTACCAAAACAGCAAT GATCCTACGGCATGGGGTGCAGTTGGTGCTTACCGCATCCTCGGTGGCAC CGGCTATCAGCCTAAAAGTTTGAGCGGTTCGTATGCCTTTGCAAACCAAG TGCCGGCAGCAGTCGCACCTAGCACCTACAATCGCACGGAAGCGACTACC CAGACCCGCGTGGCTTATGGCCAGGGTATGAGTGAGTGGTGCGCGAATTG TCACACCGATATCCATAACAGCGCTTACCCAACGAATCTGCGCCACCCAG CCGGTAACGGTGCTAAGTTCGGTGCAACCATTGCCGGTCTGTACAATTCG TATAAAAAGAGTGGCGATCTCACTGGCACCCAGGCTAGCGCATACTTGTC GCTGGCACCGTTTGAAGAGGGCACTGCCGATTATACCGTTTTGAAAGGTC ATGCAAAGATTGATGACACGGCACTGACTGGTGCAGACGCAACGTCGAAC GTGAATTGCCTGAGTTGTCACCGCGCTCATGCAAGTGGCTTTGATAGCAT GACCCGCTTCAACCTCGCCTACGAATTTACGACTATCGCCGATGCGAGTG GCAACAGCATTTATGGTACGGACCCCAATACTTCGAGTCTGCAAGGCCGC AGCGTCAATGAGATGACTGCTGCATACTATGGCCGCACCGCAGACAAGTT CGCACCCTACCAACGCGCCCTGTGTAACAAATGCCACGCCAAAGATTAA SEQIDNO:4:peptidesequenceforOmcSencodedby SEQIDNO:3 MKKGMKVSLSVAAAALLMSAPAAFAFHSGGVAECEGCHTMHNSLGGAVMN SATAQFTTGPMLLQGATQSSSCLNCHQHAGDTGPSSYHISTAEADMPAGT APLQMTPGGDFGWVKKTYTWNVRGLNTSEGERKGHNIVAGDYNYVADTTL TTAPGGTYPANQLHCSSCHDPHGKYRRFVDGSIATTGLPIKNSGSYQNSN DPTAWGAVGAYRILGGTGYQPKSLSGSYAFANQVPAAVAPSTYNRTEATT QTRVAYGQGMSEWCANCHTDIHNSAYPTNLRHPAGNGAKFGATIAGLYNS YKKSGDLTGTQASAYLSLAPFEEGTADYTVLKGHAKIDDTALTGADATSN VNCLSCHRAHASGFDSMTRFNLAYEFTTIADASGNSIYGTDPNTSSLQGR SVNEMTAAYYGRTADKFAPYQRALCNKCHAKD
REFERENCES
[0150] J. M. Pisciotta, Y. Zou and I. V. Baskakov, Plos One, 2010, 5. [0151] N. Sekar, Y. Umasankar and R. P. Ramasamy, Physical Chemistry Chemical Physics, 2014, 16, 7862-7871. [0152] B. E. Logan, Nature Reviews Microbiology, 2009, 7, 375-381. [0153] Y. Yang, M. Xu, J. Guo and G. Sun, Process Biochemistry, 2012, 47, 1707-1714. [0154] D. R. Lovley, Current Opinion in Biotechnology, 2008, 19, 564-571. [0155] T. Mehta, M. V. Coppi, S. E. Childers and D. R. Lovley, Applied and Environmental Microbiology, 2005, 71, 8634-8641. [0156] X. Qian, T. Mester, L. Morgado, T. Arakawa, M. L. Sharma, K. Inoue, C. Joseph, C. A. Salgueiro, M. J. Maroney and D. R. Lovley, Biochimica Et Biophysica Acta-Bioenergetics, 2011, 1807, 404-412. [0157] C. Leang, X. Qian, T. Mester and D. R. Lovley, Applied and Environmental Microbiology, 2010, 76, 4080-4084. [0158] R. E. Blankenship, D. M. Tiede, J. Barber, G. W. Brudvig, G. Fleming, M. Ghirardi, M. R. Gunner, W. Junge, D. M. Kramer, A. Melis, T. A. Moore, C. C. Moser, D. G. Nocera, A. J. Nozik, D. R. Ort, W. W. Parson, R. C. Prince and R. T. Sayre, Science, 2011, 332, 805-809. [0159] N. B. Ivleva, M. R. Bramlett, P. A. Lindahl and S. S. Golden, Embo Journal, 2005, 24, 1202-1210. [0160] P. E. Thomas, D. Ryan and W. Levin, Analytical Biochemistry, 1976, 75, 168-176. [0161] R. W. Bradley, P. Bombelli, D. J. Lea-Smith and C. J. Howe, Physical Chemistry Chemical Physics, 2013, 15, 13611-13618. [0162] Shestako. Sv and N. T. Khyen, Molecular and General Genetics, 1970, 107, 372-&. T. Yagishita, T. Horigome and K. Tanaka, Journal of Chemical Technology and Biotechnology, 1993, 56, 393-399. [0163] S. Tsujimura, A. Wadano, K. Kano and T. Ikeda, Enzyme and Microbial Technology, 2001, 29, 225-231. [0164] J. E. Butler, F. Kaufmann, M. V. Coppi, C. Nunez and D. R. Lovley, Journal of Bacteriology, 2004, 186, 4042-4045. [0165] J. R. Lloyd, C. Leang, A. L. H. Myerson, M. V. Coppi, S. Cuifo, B. Methe, S. J. Sandler and D. R. Lovley, Biochemical Journal, 2003, 369, 153-161. [0166] J. L. Cape, M. K. Bowman and D. M. Kramer, Trends in Plant Science, 2006, 11, 46-55. [0167] C. Obinger, J. C. Knepper, U. Zimmermann and G. A. Peschek, Biochemical and Biophysical Research Communications, 1990, 169, 492-501. [0168] W. F. J. Vermaas, Photosynthesis and Respiration in Cyanobacteria, Macmillan Publishers Ltd, Nature Publishing Group, 2001. [0169] J. M. Pisciotta, Y. Zou and I. V. Baskakov, Applied Microbiology and Biotechnology, 2011, 91, 377-385. [0170] Baron, D., et al. (2009). Electrochemical Measurement of Electron Transfer Kinetics by Shewanella oneidensis MR-1. Journal of Biological Chemistry 284(42): 28865-28873. [0171] Carmona-Martinez, A. A., et al. (2013). Electron transfer and biofilm formation of Shewanella putrefaciens as function of anode potential. Bioelectrochemistry 93: 23-29. [0172] Inoue, K., et al. (2010). Purification and Characterization of OmcZ, an Outer-Surface, Octaheme c-Type Cytochrome Essential for Optimal Current Production by Geobacter sulfurreducens. Applied and Environmental Microbiology 76(12): 3999-4007. [0173] Jeamton, W., et al. (2011). Phycocyanin promoter of Spirulina platensis controlling heterologous expression in cyanobacteria. Journal of Applied Phycology 23(1): 83-88. [0174] Leang, C., et al. (2003). OmcB, a c-type polyheme cytochrome, involved in Fe(III) reduction in Geobacter sulfurreducens. Journal of Bacteriology 185(7): 2096-2103. [0175] Nair, U., et al. (2001). Functional elements of the strong psbAl promoter of Synechococcus elongatus PCC 7942. Journal of Bacteriology 183(5): 1740-1747. [0176] Stevens, S. E. and R. D. Porter (1980). TRANSFORMATION IN AGMENELLUM-QUADRUPLICATUM. Proceedings of the National Academy of Sciences of the United States of America-Biological Sciences 77(10): 6052-6056. [0177] GeneArt Synechococcus Engineering Kits by Invitrogen life technologies USER GUIDE Publication number MAN0005339 [0178] N. Sekar, R. Jain, Y. Yan and R. P. Ramasamy, Biotechnology Bioengineering, 2016, 113(3): 675-679.