Mass spectrometric assays for peptides

09970943 ยท 2018-05-15

Assignee

Inventors

Cpc classification

International classification

Abstract

Methods for interpretation of mass spectrometric tests for clinical biomarkers in which the amounts of internal standards are set to equal clinical evaluation thresholds, and preparations for adding stable isotope labeled peptide species to sample digests while minimizing losses and alterations in peptide stoichiometry.

Claims

1. A method of standardizing a quantitative mass spectrometric assay for a peptide analyte in a sample, comprising: adding a known amount of a SIS version of said analyte to a known amount of said sample, to form a standardized sample, measuring by mass spectrometry the relative amounts of said peptide analyte and said SIS version of said analyte in said standardized sample, and comparing the amount of said peptide analyte to the amount of said SIS version of said analyte, wherein said known amount of said SIS version of said analyte corresponds to the analyte amount at a pre-determined test evaluation threshold, wherein said test evaluation threshold is a clinical decision threshold derived from a clinical study establishing test sensitivity and specificity at said threshold.

2. A method of standardizing a mass spectrometric assay for a protein or peptide analyte in a sample comprising: adding known amounts of a first SIS version of said analyte and a second SIS version of said analyte as internal standards to a known amount of said sample prior to mass spectrometric analysis; wherein said known amount of said first SIS version corresponds to the analyte amount at the lower end of the established clinical reference range for the analyte and said known amount of said second SIS version corresponds to the analyte amount at the upper end of the established clinical reference range for the analyte; and wherein said first and said second SIS versions differ from the analyte and from one another in mass and, said first and said second internal standards and said analyte have identical chemical structures, wherein said known amount of said SIS versions of said analyte correspond to the analyte amount at a pre-determined test evaluation threshold, and wherein said test evaluation threshold is a clinical decision threshold derived from a clinical study establishing test sensitivity and specificity at said threshold.

3. A method according to claim 1, further comprising assigning a test result that differs depending on whether the measured amount of analyte is greater than or less than the measured amount of said SIS version of said analyte; wherein said SIS version of said protein or peptide analyte differs from the analyte in mass and said SIS version and said analyte have identical chemical structures.

4. The method of claim 3, wherein said SIS version of said analyte is added to said sample before measurement in an amount equal to a pre determined test evaluation threshold.

5. A method according to claim 2, further comprising adding known amounts of first and second SIS versions of a second peptide or protein analyte to said sample; ii) measuring the amount of each of said peptide or protein analytes and each of said first and second SIS versions of each of said peptide or protein analytes by mass spectrometry; iii) for each of said peptide or protein analytes, comparing the measured amount of each analyte with the measured amount of each of said first and second SIS versions of that analyte in said sample; and iv) assigning a test result that differs for each of said peptide or protein analytes depending on whether the amount of the each analyte is greater than, less than, or in a range between the amount of the first and second SIS versions of that analyte added to the sample wherein, the first version of each of said analytes corresponds to a lower analyte limit for each of said analytes; wherein, the second versions of each of said analytes corresponds to an upper analyte limit for each of said analytes; and wherein said first and second versions of each of said peptide or protein analytes have identical chemical structure to the analyte for which they serves as standards but differ in mass from that analyte and each other.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) FIG. 1. Comparison of analyte and internal standard peptides by MALDI-MS. Internal standard 1 is present in an amount such that its signal level 3 indicates the clinical decision point tor the endogenous analyte 2.

(2) FIG. 2. Comparison of analyte and two internal standard peptides by MALDI-MS. One internal standard 1 is present at a concentration equal to the lower limit of the analyte reference interval 3, and the other 4 is present at the upper limit of the interval 5.

(3) FIG. 3. Comparisons of analyte and internal standard amounts by selected reaction monitoring LC-MS/MS.

(4) FIG. 4. Comparison of analyte and two internal standard peptides by selected reaction monitoring LC-MS/MS.

(5) FIG. 5. MALDI comparisons of analyte and SIS peptide levels.

(6) FIG. 6. Linkage to and release of extended SIS peptides from an activated carrier molecule. Extension sequence CGSGK SEQ ID No. 6, extended peptides CGSGKNFPSPVDAAFR and SEQ ID No. 8, CGSGKEIGELYPK SEQ ID No. 6, and released peptides NFPSPVDAAFR SEQ ID No. 7, and EIGELYLPK SEQ ID No. 5.

(7) FIG. 7. Linkage of a polySIS peptide to an activated carrier and release of SIS peptides by tryptic digestion. The sequence of the polySIS is described in detail as Seq ID No. 39 in U.S. patent application Ser. No. 11/147,397. Part A shows the extension sequences GSGC SEQ ID No. 9 that can be linked to a carrier (41) by an optional spacer (42) that has a carrier linkage site denoted M (43), along with the polySIS sequence (46) that may hear carboxyl terminal extension sequence (45) having a terminal cysteine (44):

(8) TABLE-US-00001 SEQIDNo.11: MSGSHHHHHHSSGIEGRGRLIKHMTMAKATEHLSTLSEKNWGLSVYADKP ETTKILGGHLDAKDTVQIHDITGHTVIGPDGHKQGFGNVATNTDGKEIGE LYLPKTGLQEVEVKDDLYVSDAFHKIYHSHIDAPKETAASLLQAGYKITQ VLHFTKFPEVDVLTKLGNQEPGGQTALKLSSPAVITDKQWAGLVEKIPPW EAPKLFLEPTQADIALLKSHAPEVITSSPLKIFYNQQNHYDGSTGKEHSS LAFWKVSVSQTSKESDTSYVSLKWELDLDIKSTVLTIPEIIIKLIENGYF HPVKASYPDITGEKDPPSDLLLLKALQDQLVLVAAKAEIEYLEKQPGGIR GSGC,

(9) Part B, shows the polySIS sequences including extension sequences (47) that are bound to the carrier.

(10) Part C shows a collection of the peptides (48) released following proteolytic treatment of the carrier leaving the extension sequence (where one is employed) attached to the carrier in this example.

(11) TABLE-US-00002 SEQIDNo.12 MSGSHHHHHHSSGIEGR,; SEQIDNo.13 GRLIK,; SEQIDNo.14 HMTMAK,; SEQIDNo.15: ATEIILSTLSEK, SEQIDNo.16 NWGLSVYADKPETTK,; SEQIDNo.17 ILGGIILDAK,; SEQIDNo.18 DTVQIHDITGK,; SEQIDNo.19 TVIGPDGHK,; SEQIDNo.20 QGFGNVATNTDGK,; SEQIDNo.21 EIGELYLPK,; SEQIDNo.22 TGLQEVEVK,; SEQIDNo.23 DDLYVSDAPFHK,; SEQIDNo.24 IYHSHIDAPK,; SEQIDNo.25 ETAASLLQAGYK,; SEQIDNo.26 ITQVLHFTK,; SEQIDNo.27 FPEVDVLTK,; SEQIDNo.28 LGNQEPGGQTALK,; SEQIDNo.29 LSSPAVITDK,; SEQIDNo.30 QWAGLVEK,; SEQIDNo.31 IPPWEAPK,; SEQIDNo.32 LFLEPTQADIALLK,; SEQIDNo,33 SHAPEVITSSPLK,; SEQIDNo.34 IFYNQQNHYDGSTGK,; SEQIDNo.35 EHSSLAFWK,; SEQIDNo.36 VSVSQTSK,; SEQIDNo.37 ESDTSYVSLK,; SEQIDNo.38 WELDLDIK,; SEQIDNo.39 STVLTIPEIIIK,; SEQIDNo.40 LIENGYFHPVK,; SEQIDNo.41 ASYPDITGEK,; SEQIDNo.42 DPPSDLLLLK,; SEQIDNo.43 ALQDQLVLVAAK; SEQIDNo.44 AEIEYLEK,; and SEQIDNo.45 QPGGIR,;

DETAILED DESCRIPTION

(12) The term amount, concentration or levelof an analyte or internal standard means the physical quantity of the substance referred to, either in terms of mass (or equivalently moles) or in terms of concentration (the amount of mass or moles per volume of a solution or liquid sample).

(13) The term analyte or ligand may be any of a variety of different molecules, or components, pieces, fragments or sections of different molecules that are to be measured or quantitated in a sample. An analyte may thus be a protein, a peptide derived from a protein by digestion or other fragmentation technique, a small molecule (such as a hormone, a metabolite, a drug, a drug metabolite) or nucleic acids (DNA, RNA, and fragments thereof produced by enzymatic, chemical or other fragmentation processes).

(14) The term antibody means a monoclonal or monospecific polyclonal immunoglobulin protein such as IgG or IgM. An antibody may be a whole antibody or antigen-binding antibody fragment derived from a species (e.g., rabbit or mouse) commonly employed to produce antibodies against a selected antigen, or may be derived from recombinant methods such as protein expression, and phage/virus display. See, e.g., U.S. Pat. Nos. 7,732,168; 7,575,896; and 7,431927, which describe preparation of rabbit monoclonal antibodies. Antibody fragments may be any antigen-binding fragment that can be prepared by conventional protein chemistry methods or may be engineered fragments such as scFv, diabodies, minibodies and the like. It will be understood that other classes of molecules such as DNA and RNA aptamers configured as specific and high affinity binding agents may, be used as alternatives to antibodies or antibody fragments in appropriate circumstances.

(15) The term bind or react means any physical attachment or close association, which may be permanent or temporary. Generally, reversible binding includes aspects of charge interactions, hydrogen bonding, hydrophobic forces, van der Waals forces etc., that facilitate physical attachment between the molecule of interest and the analyte being measuring. The binding interaction may be brief as in the situation where binding causes a chemical reaction to occur. Reactions resulting from contact between the binding agent and the analyte are also within the definition of binding for the purposes of the present technology, provided they can be later reversed to release a monitor fragment.

(16) The term binding agent means a molecule or substance having an affinity for one or more analytes, and includes antibodies (for example polyclonal, monoclonal, single chain, and modifications thereof), aptamers (made of DNA, RNA, modified nucleotides, peptides, and other compounds), etc. Specific binding agents are those with particular affinity for a specific analyte molecule.

(17) The terms clinical evaluation threshold, clinical decision point and test evaluation threshold (which are used here interchangeably) mean a value of analyte abundance or concentration in a biological (including clinical) sample that serves as a decision point for a test result (typically a clinical test result). For example, a threshold of 4.1 ng/ml has been used as a clinical decision point in the interpretation of prostate specific antigen test results in men: values above this level indicate increased risk of prostate cancer, and below this level no action in typically taken. Alternatively for some analytes a value lower than the clinical decision point can be the indication of higher risk. Clinical decision points are typically derived from large clinical studies and represent a statistical parameter set by clinical researchers to provide a given specificity and sensitivity in answering a particular clinical question. Similarly, methods of risk analysis can be used to determine test evaluation thresholds in non-clinical situations, such as the determination of permitted levels of certain protein or peptide contaminants in foods, beverages, drugs, cosmetics, environmental and other samples required to address regulatory requirements in various countries. For use in a specific test it will be understood that a test evaluation threshold can be set based on results obtained using the specific test or an equivalent methodology, in order that any analytical biases inherent in the test be reflected in the threshold. Thus, if an MS-based assay detects a peptide obtained by tryptic digestion of a target protein in a sample, and for some reason the tryptic yield of this peptide is reproducible but not 100%, for example an 85% yield of peptide per protein on a molar basis, then a test evaluation threshold for this peptide in the example would be set a value equivalent to 85% of the amount of the corresponding protein in the sample, i.e., equal to the level of peptide analyte observed in the MS at the test evaluation threshold.

(18) The terms clinical reference range and clinical reference interval mean the range of abundance or concentration values of an analyte that are deemed to be with the normal clinical range. Such ranges are frequently established by determination of analyte levels in a normal population, and the clinical reference range typically determined as the central 95% of the resulting histogram (with 2.5% of the population above and 2.5% below the resulting high and low values). As used here, these terms also refer to ranges whose bounds are defined by clinical features other than the distribution of results in normal individuals (e.g., the population reference range in diabetic patients), and clinical ranges based on a patient's prior test values for the same or other analytes, alone or in combination with population test data. A variety of statistical approaches can be used to calculate such ranges from analyte measurements, and this is advantageously can be done prior to their application in the design of an assay or the determination of an amount of internal standard to use in the assay. As in the case of a single test evaluation threshold, it will be understood that a clinical reference interval for use in a specific test can be set based on results obtained using the specific test or an equivalent methodology, in order that any analytical biases inherent in the test are reflected in the threshold.

(19) The terms clinical cutpoint panel and multi-threshold classifier mean a set of two or more different threshold levels used to assess the result of an assay by comparing a measure of analyte amount with such threshold levels to determine whether analyte amount is higher than the highest threshold, lower than the lowest threshold, or between two particular threshold levels, and include clinical interpretive scales with more than two references values (e.g., a three point scale whose 4 segments indicate no, low, moderate or high risk).

(20) The term carrier linkage site refers to a chemical grouping or moiety in a suitably prepared carrier molecule that is capable of reacting with a peptide linkage site in a modified or unmodified peptide molecule to yield a covalent or very tight non-covalent linkage between the peptide and the carrier. In one embodiment, the chemical linkage site is present within the extension to the SIS peptide.

(21) The term carrier molecule refers to a molecule having multiple sites at which peptides can be attached, said attachment being either covalent or non-covalent but tight (e.g., via avidin-biotin interaction). Examples of carriers include proteins (e.g., activated KLH or albumin bearing multiple maleimide groups [e.g., Thermofisher Imject Maleimide-Activated Mariculture KLH] capable of reacting with multiple cysteine-containing SIS peptides), and other polymeric molecules having desirable properties such as solubility and stability, including for example dextrans, linear polyacrylamides, agarose, dendrimers, etc. Carrier molecules are typically larger than tryptic peptides, generally having molecular weights in the range 3,000 to 20,000,000. In some embodiments (e.g., polymer carriers) the carrier molecules will have molecular weights in a range: from about 3,000 to about 10,000, or from about 10,000 to about 100,000, or from about 100,000 to about 1,000,000, or from about 1,000,000 to about 5,000,000, or from about 5,000,000 to about 20,000,000 Daltons.

(22) The term carrier particle means a physical particle having sites (e.g., single or multiple sites) at which peptides can be attached, said attachment being either covalent or non-covalent and of a kind such that the peptide may released from the particle at an appropriate point in the sample preparation workflow. Examples include agarose beads, magnetic beads, quantum dots, viruses, and particles of controlled-pore glass, chromatography media such as POROS or silica, and polystyrene. Carrier particles can be in the range of 10 nanometer to 1 millimeter in size. In some embodiments the carrier particles will have a size (e.g., average diameter) in a range: from about 10 to about 100, or from about 100 to about 10,000, or from about 10,000 to about 100,000, or from about 10,000 to about 1,000,000, or from about 100 to about 10,000, or from about 1,000 to about 100,000 nanometers.

(23) The term carrier surface means a surface to which peptides can be attached, said attachment being either covalent or non-covalent and of a kind such that the peptide is released from the particle at the appropriate point in the sample preparation workflow. Examples include the surfaces (often the inner liquid-contacting surfaces) of vessels such as sample wells, pipette tips, cuvettes, or capillary tubes used in a sample processing workflow.

(24) The term carrier means a carrier molecule, a carrier particle or a carrier surface.

(25) The term carrierSIS or conjugate or carrierSIS complex or SIS peptide delivery vehicle means a carrier to which SIS peptides or extended SIS peptides are hound or linked.

(26) The term carrierPolySIS or conjugate or carrierPolySIS complex or polySIS peptide delivery vehicle means a carrier to which polySIS peptides or extended polySIS peptides are bound or linked.

(27) The term denaturant includes a range of chaotropic and other chemical agents that act to disrupt or loosen the 3-D structure of proteins without breaking covalent bonds, thereby rendering them more susceptible to proteolytic treatment. Examples include urea, guanidine hydrochloride, ammonium thiocyanate, trifluoroethanol and deoxycholate, as well as solvents such as acetonitrile, methanol and the like.

(28) The term electrospray ionization (ESI) refers to a method for the transfer of analyte molecules in solution into the gas and ultimately vacuum phase through use of a combination of liquid delivery to a pointed exit and high local electric field.

(29) The term extended peptide means a peptide having a subsequence that is the same as a peptide analyte and one or more additional subsequences and chemical moieties that provide additional functionality (such as attachment to a carrier) but are separated from the analyte subsequence by action of the proteolytic activity used to create a sample digest.

(30) The term extended SIS means an extended peptide comprising a labeled peptide segment that is a SIS peptide.

(31) The term immobilized enzyme means any form of enzyme that is fixed to the matrix of a support by covalent or non-covalent interaction such that the majority of the enzyme remains attached to the support of the membrane.

(32) The term magnet, permanent magnet, or electromagnet are used here to mean any physical system, whether electrically powered or static, capable of generating a magnetic field.

(33) The term magnetic field or magnetic field gradient are used here interchangeably, and refer to a physical region within which a spatially varying magnetic field exists.

(34) The terms magnetic particle and magnetic bead are used interchangeably and mean particulate substances capable of carrying binding agents (whether attached covalently or non-covalently, permanently or temporarily) and which can respond to the presence of a magnetic field gradient by movement. The term includes heads that are referred to as paramagnetic, superparamagnetic, and diamagnetic.

(35) The terms particle or bead mean any kind of particle in the size range between 10 nm and 1 cm, and includes magnetic particles and beads.

(36) The term MALDI means Matrix Assisted Laser Desorption Ionization and related techniques such as SELDI, and includes any technique that generates charged analyte ions from a solid analyte-containing material on a solid support under the influence of a laser or other means of imparting a short energy pulse.

(37) The term Mass spectrometer (or MS) means an instrument capable of separating molecules on the basis of their mass m, or m/z where z is molecular charge, and then detecting them. In one embodiment, mass spectrometers detect molecules quantitatively. An MS may use one, two, or more stages of mass selection. In the case of multistage selection, some means of fragmenting the molecules is typically used between stages, so that later stages resolve fragments of molecules selected in earlier stages. Use of multiple stages typically affords improved overall specificity compared to a single stage device. Often, quantitation of molecules is performed in a triple-quadrupole mass spectrometer, but it will be understood herein that a variety of different MS configurations may be used to analyze the molecules described, and specifically MALDI instruments including MALDI-TOF, MALDI-TOF/TOF, and MALDI-TQMS and electrospray instruments including ESI-TQMS and ESI-QTOF, in which TOF means time of flight, TQMS means triple quadrupole MS, and QTOF means quadrupole TOF.

(38) The term monitor fragment may mean any piece of an analyte up to and including the whole analyte that can be produced by a reproducible fragmentation process (or without a fragmentation if the monitor fragment is the whole analyte) and whose abundance or concentration can be used as a surrogate for the abundance or concentration of the analyte. The term monitor peptide or target peptide means a peptide chosen as a monitor fragment of a protein or peptide.

(39) The terms multiplex clinical thresholds or multiplex test thresholds mean a series of test values of analyte abundance or concentration in a biological (including clinical) sample that serve as decision points for a series of individual analyte measurements carried out as a single test procedure (i.e., in a multiplex format). In the simplest case, a specific test evaluation threshold is provided for each analyte in the panel, and the result of the multiplex test is determined by an algorithm taking into account which analytes exceed and which do not exceed their respective thresholds.

(40) The term Natural or Nat means the form of such a peptide that is derived from a natural biological sample by proteolytic digestion, and thus, contains approximately natural abundances of elemental isotopes. Nat peptides typically do not contain appreciable amounts of a stable isotope label such as is intentionally incorporated in SIS internal standards.

(41) The term personal reference level and personal reference range refer to the use of analyte levels established previously for an individual patient in the interpretation of test results.

(42) The term peptide-carrier conjugate means a carrier with peptide(s) linked to it through bond(s) between carrier linkage site(s) and peptide linkage site(s).

(43) The term peptide linkage site refers to a chemical grouping or moiety in a modified or unmodified peptide molecule that is capable of reacting with a carrier linkage site in a suitably prepared carrier molecule to yield a covalent or very tight non-covalent linkage between the peptide and the carrier. In one embodiment, the chemical linkage site is present within the extension to the SIS peptide.

(44) The term polySIS means a protein or peptide comprising subsequences identical to monitor peptides representing two or more different proteins in sequence contexts such that the monitor peptides are released by proteolytic digestion.

(45) The term proteolytic enzyme cleavage site refers to a site within an extended SIS peptide sequence at which the chosen proteolytic treatment (typically an enzyme such as trypsin) cleaves the extended SIS sequence, releasing peptides fragments (typically two) of which one is the SIS peptide sequence (identical to the analyte, or Nat, sequence for which the SIS serves as an internal standard).

(46) The term proteolytic treatment or enzyme may refer any of a large number of different enzymes, including trypsin, chymotrypsin, lys-C, v8 and the like, as well as chemicals, such as cyanogen bromide. In this context, a proteolytic treatment acts to cleave peptide bonds in a protein or peptide in a sequence-specific manner, generating a collection of shorter peptides (a digest).

(47) The term sample means any complex biologically-generated sample derived from humans, other animals, plants or microorganisms, or any combinations of these sources. Complex digest means a proteolytic digest of any of these samples resulting front use of a proteolytic treatment.

(48) The terms SIS, stable isotope standard and stable isotope labeled version of a peptide or protein analyte mean a peptide or protein, such as a peptide or protein having a unique sequence that is identical or substantially identical to that of a selected peptide or protein analyte, and including a label of some kind (e.g., a stable isotope) that allows its use as an internal standard for mass spectrometric quantitation of the natural (unlabeled, typically biologically generated) version of the analyte (see U.S. Pat. No. 7,632,686 High Sensitivity Quantitation of Peptides by Mass Spectrometry). In one embodiment, a SIS peptide or protein comprises a peptide sequence that has a structure that is chemically identical to that of the molecule for which it will serve as a standard, except that it has isotopic labels at one or more positions that alter its mass. Hence a SIS is 1) recognized as equivalent to the analyte in a pre-analytical workflow, and is not appreciably differentially enriched or depleted compared to the analyte prior to mass spectrometric analysis, and 2) differs from it in a manner that can be distinguished by a mass spectrometer, either through direct measurement of molecular mass or through mass measurement of fragments (e.g., through MS/MS analysis), or by another equivalent means. Stable isotope standards include peptides having non-material modifications of this sequence, such as a single amino acid substitution (as may occur in natural genetic polymorphisms), substitutions (including covalent conjugations of cysteine or other specific residues), or chemical modifications (including glycosylation, phosphorylation, and other well-known post-translational modifications) that do not materially affect enrichment or depletion compared to the analyte prior to mass spectrometric analysis. In one embodiment, SIS are those in which the level of substitution of each stable isotope (e.g., .sup.13C, .sup.15N, .sup.18O or .sup.2H at the specific sites within the peptide structure where the isotope(s) is/are incorporated (i.e., those sites that depart significantly from the natural unenriched isotope distribution) is/are >95%, >96%, >97%, or >98%.

(49) The term SISCAPA means the method described in U.S. Pat. No. 7,632,686, entitled High Sensitivity Quantitation of Peptides by Mass Spectrometty and in Mass Spectrometric Quantitation of Peptides and Proteins Using Stable Isotope Standards and Capture by Anti-Peptide Antibodies (SISCAPA). Anderson, Anderson, N. G., Haines, Hardie, D. B., Olafson. R. W., and Pearson, T. W, Journal of Proteome Research 3: 235-44 (2004).

(50) The term small molecule or metabolite means a multi-atom molecule other than proteins, peptides and DNA; the term can include but is not limited to amino acids, steroid and other small hormones, metabolic intermediate compounds, drugs, drug metabolites, toxicants and their metabolites, and fragments of larger biomolecules.

(51) The term stable isotope means an isotope of an element naturally occurring or capable of substitution in proteins or peptides that is stable (does not decay by radioactive mechanisms) over a period of a day or more. The primary examples of interest in this context are .sup.13C, .sup.15N, .sup.2H, and .sup.18O, of which the most commonly used are .sup.13C and .sup.15N.

(52) The term standardized sample means a protein or peptide sample to which stable isotope labeled version(s) of one or more peptide or protein analytes have been added at levels corresponding to test evaluation thresholds to serve as internal standards.

(53) The following embodiments of the present technology make use of a series of concepts described in this specification. These concepts provide background as to specific embodiments of the methods and compositions described herein.

(54) 1 The SISCAPA Method

(55) SISCAPA assays combine affinity enrichment of specific peptides with quantitative measurement of those peptides by mass spectrometry. In order to detect and quantitatively measure protein analytes, the SISCAPA technology makes use of anti-peptide antibodies (or any other binding entity that can reversibly bind a specific peptide sequence of about 5-20 residues) to capture specific peptides from a mixture of peptides, such as that arising, for example, from the specific cleavage of a protein mixture (like human serum or a tissue lysate) by a proteolytic enzyme such as trypsin or a chemical reagent such as cyanogen bromide. By capturing a specific peptide through binding to an antibody (the antibody being typically coupled to a solid support either before or after peptide binding), followed by washing of the antibody:peptide complex to remove unbound peptides, and finally elution of the bound peptide into a small volume (typically achieved by an acid solution such as 5% acetic acid), the SISCAPA technology makes it possible to enrich specific peptides that may be present at low concentrations in the whole digest, and therefore undetectable in simple mass spectrometry (MS) or liquid chromatography-MS (LC/MS) systems against the background of more abundant peptides present in the mixture. It also provides a sample that is less complex, and therefore exhibits lesser matrix effects and fewer analytical interferences, than observed in the starting digest. This in turn permits mass spectrometry analysis without further separation steps, although additional separation processes could be used if desired. The sample can be concentrated prior to analysis if necessary, but this concentration does not provide any further analyte peptide separation. This enrichment step is intended to capture peptides of high, medium or low abundance and present them for MS analysis: it therefore discards information as to the relative abundance of a peptide in the starting mixture in order to boost detection sensitivity. This abundance information, which is of great value in the field of proteomics, can be recovered, however, through the use of isotope dilution methods: the SISCAPA technology makes use of such methods (e.g., by using stable isotope labeled versions of target peptides) in combination with specific peptide enrichment, to provide a method for quantitative analysis of peptides, including low-abundance peptides.

(56) The approach to standardization in SISCAPA is to create a version of the peptide to be measured which incorporates one or more stable isotopes of mass different from the predominant natural isotope, thus forming a labeled peptide variant that is chemically identical (or nearly-identical) to the natural peptide present in the mixture, but which is nevertheless distinguishable by a mass spectrometer because of its altered peptide mass due to the isotopic label(s). In one embodiment, the method for creating the labeled peptide is chemical synthesis, wherein a peptide with chemical structure identical to the natural analyte can be made while incorporating amino acid precursors that contain heavy isotopes of hydrogen, carbon, oxygen or nitrogen (e.g., .sup.2H, .sup.13C, .sup.18O or is .sup.15N) to introduce the isotopic label. In theory one could also use radioactive (i.e., unstable) isotopes (such as .sup.3H), but this is less attractive for safety reasons. The isotopic peptide variant (a Stable Isotope-labeled Standard, or SIS) is used as an internal standard and is added to the sample peptide mixture at a known concentration before enrichment by antibody capture. The antibody captures and enriches both the natural and the labeled peptide together (having no differential affinity for either) according to their relative abundances in the sample. Since the labeled peptide is added at a known concentration, the ratio between the amounts of the natural and labeled forms detected by the final MS analysis allows the concentration of the natural peptide in the sample mixture to be calculated. Thus, the SISCAPA technology makes it possible to measure the quantity of a peptide of low abundance in a complex mixture, and since the peptide is typically produced by quantitative (complete) cleavage of sample proteins, the abundance of the parent protein in the mixture of proteins can be deduced. The SISCAPA technology can be multiplexed to cover multiple peptides measured in parallel, and can be automated through computer control to afford a general system for protein measurement. Creating a new protein-specific assay thus, requires only that a peptide-specific antibody and a labeled peptide analog be created. A feature of the SISCAPA technology is directed at establishing quantitative assays for specific proteins selected a priori, rather than at the problem of comparing all of the unknown components of two or more samples to one another. It is this focus on specific assays that makes it attractive to generate specific antibodies to each monitor peptide (in principle one antibody binding one peptide for each assay). Prior to the development of SISCAPA it was believed that anti-peptide antibodies were neither sufficiently specific nor had sufficient affinity to allow isolation of a single peptide from a complex digest. Previously described methods have not focused on anti-peptide antibodies, but used instead general affinity concepts that would bind and enrich all of a class of peptides by recognizing a ligand, label or feature common to the class: e.g., immobilized metal affinity chromatography (IMAC) to select phosphopeptides as a group, anti-phosphotyrosine antibodies to select phosphotyrosine-containing peptides as a group, or lectins to select glycopeptides as a group. The SISCAPA technology provides a means to enrich each peptide sequence specifically with a different antibody (or other equivalently selective binding reagent).

(57) An alterative to using SIS peptides is to use multiple copies of SIS peptides arranged as a linear polypeptide strand known as polySIS peptides. PolySIS peptides have been described, for example, in U.S. patent application Ser. No. 11/147,397 and may be prepared chemically, in vitro or in vivo using the same techniques used for SIS peptides. PolySIS peptides may also be prepared in extended SIS form and coupled to a carrier in the same fashion that SIS peptides or extended SIS peptides are attached. In one embodiment polySIS polypeptides comprise a repeat of a single peptide that may be used as a monitor peptide. In another embodiment, polySIS polypeptides (which may also be termed polySIS proteins) have an amino acid sequence containing several (at least two, three, four, five or more) amino acid subsequences found in nature and wherein at least two different subsequences act as monitor sequences. In such an embodiment, the subsequences of the polySIS polypeptide are part of at least one (or alternatively two, three, four, five or more) natural proteins that is/are target protein(s) whose levels will be assessed. The subsequences of polySIS peptides contain at their ends cleavage sites that can be cleaved by the same site-specific proteolytic treatment to release said subsequences from the native proteins in the test sample. Thus, polySIS peptides may be used as an internal standard in the same fashion as SIS peptides and also as a single internal standard for multiple protein analytes, wherein the ratio of the monitor peptide sequences will be fixed by the number of times the subsequence appears in the polySIS peptide.

(58) A further objective of SISCAPA is to deliver a series of different monitor peptides (selected by a corresponding series of specific antibodies and potentially derived by digestion of different sample proteins) to a mass spectrometer at very nearly the same abundance (e.g., within a factor of 500, 250, 200, 100, 50, 20, or 10 fold molar abundance) and free of other extraneous peptides. By equalizing the abundance of a series of peptides through antibody capture of a selectable fraction of each peptide, the method can ensure that all the captured peptides are present within the mass spectrometer's dynamic range and that this dynamic range can be optimally employed in spanning the true dynamic range of the peptide analytes. If the MS system has a dynamic range of 1000 (a range of 100 to 10,000 is typical depending on the type of MS), the method attempts to ensure that the peptides of interest are presented to the MS at a level in the middle of that range, thus, allowing an optimal capacity to detect increases or decreases in relative abundance of the natural and isotopically labeled forms. If the peptides were presented to the MS at different abundances (e.g., those peptides at relative concentrations of 1, 0.001 and 1,000), then the MS will have great difficulty in detecting equivalent quantitative differences between natural and isotopically labeled forms of these three peptides. By flattening the abundance distribution of the peptides the quantitative resolution is substantially enhanced.

(59) The basic SISCAPA embodiment combines 1) methods for creation and affinity purification of antibodies that tightly but reversibly bind short peptide sequences; 2) methods for digestion of complex protein mixtures to yield short peptides; 3) methods for synthesis of defined peptides containing isotopic labels; 4) methods for efficient capture and release of peptides; and 5) methods for MS measurement of ratios of labeled and unlabeled (sample-derived) peptides to yield a quantitative measurement.

(60) In the simplest SISCAPA embodiment, the following steps are carried out for each protein to be measured in plasma (or another sample containing protein(s)) in order to generate a specific quantitative assay system. The starting point is protein identification, which typically is based on the sequence of known proteins identified by accession number in a sequence database such as SwissProt or Genbank. The steps include one or more of:

(61) Selecting a Monitor Peptide (Step a)

(62) Using the known sequence of the protein, one or more peptide segments within the protein are selected as monitor peptides. A good monitor peptide satisfies a set of criteria designed to select peptides that can be chemically synthesized with high yield, that can be detected quantitatively in an appropriate mass spectrometer, that are reproducibly cleaved from the parent protein during digestion, and that elicit antibodies when used as antigens, although any peptide resulting from cleavage with the desired enzyme is a possible choice. One useful set of criteria is the following:

(63) i: The peptide has a sequence that results from cleavage of the protein with a desired proteolytic enzyme (e.g., trypsin). All the candidate tryptic peptides can be easily computed from the protein sequence by application of generally available software.

(64) ii: The peptide should be hydrophilic overall, and soluble in conventional solvents used in enzymatic digestion and affinity chromatography. Hydrophilic peptides can be selected based on computed scores obtained for each peptide from generally available software programs. In general the hydrophilic peptides are those that contain more polar amino acids (his, lys, arg, glu, asp) and fewer hydrophobic amino acids (trp, phe, val, leu, ile).

(65) iii: The peptide should contain a) no cys, because a c-terminal cys may be added for convenience in conjugation of the immunogen (the presence of two cys in a peptide can lead to undesirable dimerization and cross-linking) and because the alkylation of peptide cysteines can be irreproducible; and b) no met, because of the possibility of oxidation of this amino acid.

(66) iv: The peptide should ionize well by either electrospray (ESI) or matrix-assisted laser desorption (MALDI) ionization. This characteristic can be estimated by software programs or determined experimentally by MS analysis of a digest of the protein in question to see which peptides are detected at highest relative abundance.

(67) v: The peptide should be immunogenic in the species in which the antibody will be raised. Immunogenicity is generally better for peptides that are hydrophilic (compatible with (ii) above); that include a bend predicted by secondary structure prediction software; that include no glycosylation sites; and that are 10-20 amino acids in length.

(68) vi: The peptide should not include within it the sites of any common sequence polymorphisms (i.e., genetic variants) in the target protein (as this could affect the estimation of the respective protein's abundance if the variant peptide does not appear at the expected mass).

(69) vii: the peptide should not share appreciable homology with any other protein of the target organism (as determined for example by the BLAST sequence comparison program). This characteristic should tend to reduce any interference in the antibody capture step from peptides originating in proteins other than the target.

(70) viii: the peptide should be produced at reproducible (ideally high, close to 100%) stoichiometric yield by tryptic (or other) digestion of the starting sample.

(71) ix: the peptide and its fragments measured by mass spectrometry (e.g., by selected or multiple reaction monitoring using a triple quadrupole MS) should produce comparable results at multiple analysis sites and on different mass spectrometers (i.e. yielding good site to site reproducibility).

(72) All possible peptides derived from the target protein can be evaluated according to these criteria, either through computation or experimental analysis of digests of isolated target proteins or biological samples including the target protein, and one or more peptides selected that best balance the requirements of the method. A database of all the peptides (e.g., tryptic peptides) and their derived properties for a finite set of analytes such as the known proteins in plasma can be created and used as a basis for selection of monitor peptides. Beginning with the known amino acid sequences of protein analytes, efficient algorithms can construct all the possible tryptic peptides that will be created by trypsin digestion of the protein. These tryptic peptide sequences can be stored as records in a database, and similar records generated for other possible cleavage enzymes and reagents. Additional algorithms can be employed to compute various physical and biological properties of each peptide, including length, mass, net charge at neutral pH, propensity to adopt secondary structure, hydrophilicity, etc. These derived data can be tabulated for each peptide, and additional aggregate calculations performed to develop prioritizing scores associated with likelihood of success as a monitor peptide. These priority scores can be sorted to select candidate monitor peptides for each protein.

(73) Creating Isotope-Labeled Monitor Peptides (Step b)

(74) An isotopically labeled version of the selected peptide (a SIS) is then made in which the chemical structure is maintained, but one or more atoms are substituted with an isotope such that an MS can distinguish the labeled peptide from the normal peptide (containing the natural abundance of each element's isotopes). For example, nitrogen-15 or carbon-13 could be introduced instead of the natural nitrogen-14 or carbon-12 at one or more positions in the synthesized peptide. The synthesized peptide will be heavier by a number of atomic mass units equal to the number of substituted nitrogens or carbons. The peptide is carefully made so that the number of added mass units is known and well-determined (i.e., all of the material produced as one standard has the same mass insofar as possibleachieved by using highly enriched isotopic variants of the amino acids, for example). In one embodiment, nitrogen-15 or carbon-13 labeled amino acid precursors substituted at >98% are used at one or more positions in the peptide synthesis process to introduce between 4 and 10 additional mass units compared to the natural peptide. Such nitrogen-15 labeled amino acid precursors (or their carbon-13 labeled equivalents) are commercially available as FMOC derivatives suitable for use directly in conventional commercial peptide synthesis machines. The resulting labeled monitor peptides can be purified using conventional LC methods (typically to >90% purity) and characterized by MS to ensure the correct sequence and mass.

(75) Creating Anti-Peptide Antibodies (Step c)

(76) To immunize an animal for production of anti-peptide antibodies, the same peptide (labeled or not, if the latter is, as expected, more economical) is coupled to a carrier protein (e.g., keyhole limpet hemocyanine (KLH); not homologous to a human protein) and used to immunize an animal (such as a rabbit, chicken, goat or sheep) by one of the known protocols that efficiently generate anti-peptide antibodies. For convenience, the peptide used for immunization and antibody purification may contain additional c-terminal residues added to the monitor peptide sequence (here abbreviated MONITOR), e.g.: nterm-MONITOR-lys-gly-ser-gly-cys-cterm (SEQ If) No. 10). The resulting extended monitor peptide can be conveniently coupled to carrier (e.g., KLH) that has been previously reacted with a heterohifunctional reagent such that multiple SH-reactive groups are attached to the carrier. In classical immunization with the peptide (now as a hapten on the carrier protein), a polyclonal antiserum will be produced containing antibodies directed to the peptide, to the carrier, and to other non-specific epitopes. Alternatively, there are many methods known in the art for coupling a peptide, with or without any extensions or modifications, to a carrier for antibody production, and any of these may be used. Likewise there are known methods for producing anti-peptide antibodies by means other than immunizing an animal with the peptide on a carrier. Any of the alternatives can be used provided that a suitable specific reversible binding agent for the monitor peptide is produced.

(77) Specific anti-peptide antibodies (e.g., rabbit antibodies such as rabbit monoclonal antibodies) are then prepared from this antiserum by affinity purification on a column containing tightly-bound peptide. Such a column can be easily prepared by reacting an aliquot of the extended monitor peptide with a thiol-reactive solid support. Crude antiserum can be applied to this column, which is then washed and finally exposed to 10% acetic acid (or other elution buffer of low pH, high pH, or high chaotrope concentration) to specifically elute antipeptide antibodies. These antibodies are neutralized or separated from the elution buffer (to prevent denaturation), and the column is recycled to physiological conditions for application of more antiserum if needed. Antibodies also may be produced by hybridoma techniques well know in the art.

(78) The peptide-specific antibody is finally captured or immobilized on a column, bead or other surface for use as a peptide-specific affinity capture reagent. In one embodiment, the anti-peptide antibody is immobilized on commercially available protein A-derivatized POROS chromatography media (Applied Biosystems) and covalently fixed on this support by covalent crosslinking with dimethyl pi melimidate according to the manufacturer's instructions. The resulting solid phase media can hind the monitor peptide specifically from a peptide mixture (e.g., a tryptic digest of serum or plasma) and, following a wash step, release the monitor peptide under mild elution conditions (e.g., 10% acetic acid). Restoring the column to neutral pH then regenerates the column for use again on another sample, a process that is well known in the art to be repeatable hundreds of times. In another embodiment, the anti-peptide antibodies are captured on magnetic beads (either before exposure to the digest or afterwards), which simplifies separation of antibody from the digest after peptide binding, washing, and peptide analyte recovery. High affinity (typical dissociation constants of 10.sup.9 to 10.sup.11), high specificity antibodies are preferred, and processes of antibody generation and selection are designed to optimize these characteristics.

(79) Digestion or Sample to Peptides (Step d)

(80) A protein sample such as plasma, containing the selected protein to be measured, is digested essentially to completion with an appropriate protease (e.g., trypsin) to yield peptides (including the monitor peptide selected in step 1). For a monitor peptide whose sequence appears once in the target protein sequence, this digestion generates the same number of monitor peptide molecules as there were target protein molecules in the stating sample (provided each monitor peptide sequence occurs once per protein). The digestion is carried out by first denaturing the protein sample (e.g., with urea, trilluoroethanol or guanidine HCl), reducing the disulfide bonds in the proteins (e.g., with dithiothreitol or mercaptoethanol), alkylating the cysteines (e.g., by addition of iodoacetamide), quenching excess iodoacetamide by addition of more dithiothreitol or mercaptoethanol, and finally (after removal or dilution of the denaturant) addition of the selected proteolytic enzyme (e.g. trypsin), followed by incubation to allow digestion. Following incubation, the action of trypsin is terminated, either by addition of an enzyme inhibitor (e.g., DFP, PMSF or aprotinin) or by denaturation (through heat or addition of denaturants, or both) or removal (if the trypsin is on a solid support) of the trypsin. The destruction of the trypsin activity is important in order to avoid damage to antibodies later by residual proteolytic activity in the sample.

(81) Adding Isotopically-Labeled Monitor Peptide Internal Standards (Step e)

(82) A measured aliquot of isotopically-labeled synthetic monitor peptide (SIS) is added to a measured aliquot of the digested sample peptide mixture in a known amount, typically close to or greater than (if the standard serve for example, as carrier for a low abundance peptide) the expected abundance of the same natural peptide in the sample aliquot. Following this addition the monitor peptide will be present in the sample in two forms (natural and isotopically-labeled). The concentration of the isotopically-labeled version is accurately known based on the amount added and the known aliquot volumes. The labeled peptide may be added separately from the antibody, although it can be added in combination with the antibody for stability and simplicity.

(83) Enrichment of the Monitor Peptide by Antibody Capture and Elution (Step f)

(84) The peptide mixture (sample digest with added isotopically-labeled monitor peptides) is exposed to the peptide-specific affinity capture reagent, which preferentially binds the monitor peptide but does not distinguish between labeled and unlabeled forms (since isotopic substitutions are not expected to affect antibody binding affinity). Following one or more wash steps (e.g., phosphate-buffered saline, water) the hound peptides are then eluted (e.g., with 5% acetic acid, or with a mixture of water, formic acid and acetonitrile), for MS analysis. The affinity support can, if desired, be recycled in preparation for another sample. In some of the high-throughput assay applications envisioned, it will be advantageous to recycle the immobilized antibodies hundreds, if not thousands, of times when flow-through columns are used. Current evidence indicates that rabbit polyclonal antibodies can be recycled at least 200 times when antigens are eluted with 5% or 10% acetic acid and total exposure to acid is kept short (e.g., less than 1 minute before regeneration with neutral pH buffer). In a capillary column format, where the immobilized antibody bed can be submicroliter in size, the duration of acid exposure could be further decreased, possibly extending the life of the immobilized antibody adsorbent even further. Magnetic bead embodiments can also be conveniently automated in a variety of ways to achieve high throughput, and avoid the potential for carryover inherent in re-usable antibody columns.

(85) The enrichment step is an important element of the method because it allows enrichment and concentration of low abundance peptides, derived from low abundance proteins in the sample. Ideally, this enrichment process delivers only the monitor peptide to the MS, and makes its detection a matter of absolute MS sensitivity, rather than a matter of detecting the monitor peptide against a background of many other, potentially much higher abundance peptides present in the whole sample digest. This approach effectively extends the detection sensitivity and dynamic range of the MS detector in the presence of other high abundance proteins and peptides in the sample and its digest.

(86) Analysis of the Captured Monitor Peptides by MS (Step g).

(87) The monitor peptide (including natural and isotopically-labeled versions) enriched in the preceding step is delivered into the inlet of a mass spectrometer (e.g., by MALDI or by electrospray ionization (ESI)). The mass spectrometer can be a TOP (time-of-flight), a Q-TOF, a TOF/TOF, a triple quadrupole, an ion trap, an orbitrap, an ion-cyclotron resonance machine, or any other instrument of suitable mass resolution (>1,000) and sensitivity, and can employ one, two, or more levels of mass selection interspersed with analyte fragmentation processes (e.g., collision-induced fragmentation).

(88) The MS measures the ion current or ion count (number of ions) for both versions of the monitor peptide (natural and labeled), typically as a function of time or within an accumulated spectrum (in the case of TOF-MS). The ion current may be integrated over time (ideally for as long as the monitor peptide appears in the mass spectrum) for each mass species, and the integrated amounts of natural and isotope-labeled forms are computed as measures of peptide amount. Alternatively the maximum peak heights of the natural and labeled peptides can be used as measures of peptide amount.

(89) Computation of Abundance of Each Monitor Peptide in the Sample (Step h)

(90) A ratio is computed between the amounts of the labeled and unlabeled (natural) monitor peptides. Since the amount of labeled peptide added is known, the amount of the natural monitor peptide derived from the sample digest can then be calculated by multiplying the known concentration of labeled monitor peptide by this measured ratio. By assuming that the amount of the monitor peptide in the digest is the same as (or closely related to) the amount of the parent protein from which it is derived, a measure of the protein amount in the sample can be obtained.

(91) The foregoing description outlines the SISCAPA method, which while one embodiment of the application of the present technology, is not the only application envisioned.

(92) 2 Determination of Clinical Cutoff and Clinical Reference Interval.

(93) For quantitative tests in which deviation from normal in one direction is significant (e.g., a level of a cancer marker like PSA or CA125 above a cutoff value) but where deviation in the other direction (usually lower than normal) is not considered significant, only one threshold the test cutoff is needed. For tests in which a deviation from a normal range in either direction can be significant, test values are typically interpreted against the upper and the lower bounds of the established reference range. Physicians frequently use this method of interpretation to identify significant test results that are likely to bear on a patient's diagnosis or treatment. Cutoffs and reference range boundaries are typically established by making analyte measurements in a large group of patients, developing the histogram of these values and selecting points for which only a small fraction (usually 2.5%) of the normal population give results outside the points. Cutoffs or reference intervals can be established as part of FDA approval processes, and may be superseded by reference range studies within a clinical institution to better reflect the normal population of patients in that institution, or even by personal reference values used in interpreting individual patient test results over time.

(94) 3 Internal Standard Peptides and Proteins, and Isotopic Labeling Schemes.

(95) SIS peptides can be synthesized containing a variety of combinations of labeled amino acids. Thus, different versions of the same SIS peptide can be made that, while chemically identical to the analyte peptide, are nevertheless distinguishable from the analyte and from each other by mass. Such different peptides can be used together in an assay to provide two or more internal standards spiked into the sample or its digest at different levels.

(96) 4 Providing Internal Standards at Clinical Cutoff and Reference Levels.

(97) The level(s) of one or more internal standards can be selected to equal or approximate clinically important analyte concentrations. Using standards present at clinical decision levels has major advantages in an analytical procedure. First, it is it possible to confirm the result of the test by inspection of raw MS data: in almost all cases it is clear whether the analyte peptide produces a signal that is greater than or less than that of the analogous internal standard. This is true whether peak height or a peak area is compared. Secondly, the precision of comparing the amount of an analyte to an internal standard is typically highest when the two are present at near equal amounts in a standardized sample: this minimizes the effect of any non-linearity in the response of the MS detector (which may become significant when analyte and standard are present in different amounts), and eliminates any uncertainty as to the true position of the decision value in relation to the internal standard. Thirdly, when analyte and standard are present at near-equal amounts, the signal-to-noise and statistical precision of the two measurements are likely to be very similar, thereby simplifying the quality control of an assay. Thus, if the assay yields a measurement for an internal standard that is large enough to ensure adequate precision (e.g., in comparison with prior quality studies relating magnitude of such measurements with replicate precision) then a single measurement of analyte in a sample yielding a similar amount is likely to have similarly adequate precision. Finally, hard-wiring a decision threshold into an assay kit, for example by depositing an amount of SIS in or on a single-use component of an assay kit such that the provided amount of SIS dissolves in an accurately measured amount of sample, provides a major advance in the reliability of the overall assay result.

(98) 5 Comparison of Analyte Levels to Internal Standards: MALDI and ESI.

(99) The present technology provides an improved method for assessing analyte concentration in the sample against the appropriate clinical criteria (either a cutoff or a reference range). The principal is illustrated for the case of MALDI-TOF mass spectrometry in FIG. 1A, where the peak height for the major isotopic form of internal standard 1 establishes the cutoff level 3 equal to the assay cutoff: the concentration of the standard is set deliberately to equal this clinically determined cutoff. The measured height of analyte peak 2 is compared to cutoff 3 and easily judged to be less than the cutoff, thus providing the result of the binary test. In FIG. 1B, the alternative situation is shown, in which the analyte peak 2 is taller than the cutoff 3 set by the internal standard 2, indicating that the analyte concentration exceeds the clinical threshold. It is equally possible, though less intuitive and direct, to use alternative measures such as peak area in place of peak height. The advantage of peak height in this context is that the result can be read directly from the primary MS outputa plot of signal intensity versus either mass (or m/z) in TOF-MS, or versus time in liquid chromatography mass spectrometry methods (LC-MS). The mass accuracy of modern TOF mass analyzers is sufficient (1-20 ppm) to provide strong evidence of the identity of the expected analyte and SIS peptides. FIG. 2 illustrates the comparison of the analyte (peak 2) with SIS internal standard 1, which establishes the low end 3 of the reference interval, and with a different SIS internal standard 4, which establishes the upper end 5 of the reference interval. It is immediately evident that the analyte concentration lies within the reference interval. FIG. 3 shows the equivalent situations measured by selected reaction monitoring LC-MS/MS, carried out using a triple quadrupole MS. In this case sample peptides are separated over time by reversed-phase liquid chromatography, but, being chemically identical, the analyte and SIS internal standards elute simultaneously. In FIG. 3A, analyte peak 8 has both less height and lower peak area than internal standard peak 7 indicating a test result of less than the cutoff 3; in FIG. 3B, the alternative situation (analyte amount greater than the cutoff) is shown. FIG. 4 shows the LC-MS cases in which analyte peak 8 is below the reference interval lower bound 3 (FIG. 4A); between reference interval boundaries 3 and 5 (FIG. 4B); or above the reference interval upper bound 5 (FIG. 4C). As in the case for MALDI peaks, the result of the test is immediately evident through comparison of the analyte peak with internal standards set at the clinical cutoff or reference interval upper and lower bounds. When desirable, as for example in the context of personalized medicine, the cutoff or reference interval can be set based on a patient's past analytical history (the past values of tests for the same analyte). This approach takes into account the differences between individuals by using the individual as his or her own control. It is more difficult technically to provide individually personalized internal standard concentrations in routine assays, but this can be done using a database of personal test values and accurate technology for spiking variable levels of standards in each sample analyzed. Thus, in one embodiment the amount of internal standard utilized will be an amount based upon past measurements of an individual patient (subject).

(100) When peak heights and peak areas are obtained within a spectrum of sufficient resolution so as to effectively resolve isotopic peaks, such as when conducting comparisons of peak heights and peak areas obtained within a spectrum (e.g., using MALDI-TOF mass spectrometry), one or more specific isotopic composition peaks from the natural and labeled forms can be selected for comparison. With such resolved isotopic peaks it is facile to compare peak heights directly in a raw or smoothed spectrum, and this provides a preferred means of determining the relationship between an analyte and a corresponding SIS present at a test evaluation threshold so as to deliver a test result. Peak areas can be similarly compared after computation by summing measurements within the peak (e.g., by numerical integration) or by fitting an empirical or modeled peak shape to the spectral data to obtain the peak area.

(101) When peaks occur in a time domain (e.g., MRM peaks observed during the course of a chromatographic separation of peptides), such as when conducting comparisons of peak heights and peak areas using LC-MS/MS, additional instrument factors may come into play. In a triple quadrupole mass spectrometer, resolution is typically not sufficient to deliver baseline separation between isotopic forms, and the mass-domain envelope determining what is detected may not be a rectangular step function, but another peak distribution, the width of which can be altered by instrument settings (e.g., the resolution setting common on triple quadrupoles). Because of these features, the height or area obtained for a specific isotopic peak may vary slightly depending on the relative abundances of adjacent isotopic forms of a peptide, varying amounts of which may be enclosed within the detected envelope along with the target isotopic form. These relative abundances often differ between labeled and unlabeled peptides, in large part because of the use of heavy label isotopes with less than perfect levels of enrichment (.sup.13C and .sup.15N are often available at 98% isotopic substitution, but not 100%), resulting in different relative abundances of peaks adjacent to the labeled vs unlabeled peaks to be measured. Since different specific instrument designs and tuning parameters may therefore alter slightly the observed ratios between analyte and SIS peaks, it may be necessary to apply a correction factor to the measured ratio to obtain an accurate comparison between the two. Such a factor can be determined accurately and precisely from calibration experiments using synthetic peptides. When the present invention makes use of peak height and/or area comparisons, the use of such correction factors is optionally incorporated in the data processing method used.

(102) 6 Precision and Accuracy of MS Measurements.

(103) Given the fact that MS measurements are not infinitely precise, occasions will arise in which a test analyte occurs at a level very close to the SIS internal standard level. In the event that the analyte level occurs within a defined interval around the SIS level, for example a statistically defined interval such as +/3, 2, 1, or standard deviations determined from the SIS measurement, then it may be advantageous to report a grey area or indeterminate result. An advantage of the present approach is that such a grey area interval can be extremely narrow, and hence occur in an extremely small subset of samples.

(104) 7 Multiplex Tests Measuring Multiple Analytes.

(105) Multiplex tests measuring multiple analytes can be evaluated by comparison with multiplex SIS peptides present at pre-determined test evaluation thresholds. In the simplest case, the amount (e.g., peak height) of each analyte is compared to the amount of the corresponding SIS (present at an analyte-specific decision level) to obtain a binary (High or Low) result. These binary results are then evaluated against a matrix of possibilities (in principle all possible result patterns), each of which is associated uniquely with an overall test result, and the result corresponding to the matching pattern is delivered as the result.

(106) 8 Packaging Peptides on a Carrier to Avoid Loss.

(107) Providing SIS peptides in assays at concentrations accurately representing clinical decision, or other, values or ranges requires accurate and precise control of peptide delivery, and consequent minimization of peptide loss or deterioration prior to use. Synthetic peptides of the size and composition of typical tryptic (or other cleavage agent-produced) peptides exhibit a wide range of physical properties, particularly as regards solubility, and conversely, stickiness to polymer, glass, and other surfaces found in storage containers, laboratory ware, pipettes, LC tubing and the like. Peptides with sticky character, often associated with high hydrophobicity, frequently exhibit poor recovery from storage containers or during handling processes. Recovery is typically worst for peptides at low abundance (when the ratio between surface adsorptive sites and peptide is high), and it is well known that recovery of femtomole amounts of peptides from typical polypropylene storage tubes can be very poor. In one embodiment, the technology described herein formulates peptides in such a way that such losses are minimized, thus providing improved recovery of peptides for use, e.g., as internal standards in mass spectrometric assays such as the SISCAPA method. One approach described here to improve recovery is to link peptides to a larger carrier molecule or particle having good storage and recovery properties, e.g., a large hydrophilic, soluble protein or else a visible particulate bead (e.g., a magnetic bead). In suitably designed carriers, the bulk properties of the carrier override the problematical properties of the peptide(s), giving the combined object the desired high recovery from storage.

(108) 9 Linkage Between a Peptide and a Carrier.

(109) A variety of linkage interactions are possible for coupling peptides to a carrier, including covalent reactions between sulthydryls (e.g., cysteine) and maleimides, Solulink chemistry (reaction of 6-hydrazino-nicotinamide (HyNic) with carbonyl moieties), etc., or non-covalent but tight interactions such as those between biotin and avidin (or streptavidin), and between a hexa-histidine tag and immobilized nickel. In one embodiment, the peptide linkage site consists of a cysteine sulfhydryl, the C residue comprising a part of the extension sequence of an extended SIS peptide, and the carrier linkage site consists of a maleimide group covalently attached to a protein carrier such as KLH. Alternatively, a peptide may be provided bound non-covalently to a surface that contacts the sample or digest at some point in the analytical workflow, such that the peptide is released by dissolution upon such contact. In other embodiments, the polySIS peptides are immobilized on a carrier using any of the above-described linking interactions.

(110) 10 Recovery of Peptides from a Carrier by Proteolytic Cleavage.

(111) For many of the applications for synthetic peptides described here, particularly use as internal standards in analytical mass spectrometry, the SIS peptide material must ultimately be delivered as a molecule of the correct length (i.e., the same length and structure as the analyte for which it serves as an internal standard) free in solution at a known concentration. Thus, it is desirable for all (or at least some known fraction) of the peptide(s) packaged on a carrier to be released and made available as an internal standard for direct MS quantitation of the corresponding sample-derived target peptide or else for treatment by some selection, fractionation or specific capture method that enriches the analyte peptide and the SIS together, preserving their ratio to provide analyte concentration upon MS analysis. Proteolytic cleavage of a sample into peptides is a common feature of sample preparation for analysis of protein samples by MS, including those involving a specific enrichment step (e.g., the SISCAPA method). It is possible and efficient therefore to use the same proteolytic process to liberate peptides from a carrier, and in the simplest case to accomplish this at the same time as sample digestion by adding the peptide-carrier conjugate to the sample before digestion, thereafter digesting both sample and conjugate together. In particular when the peptide linkage site connecting the peptide to the carrier is present in the extension portion of the extended peptide (i.e., the portion not within the SIS peptide) then proteolytic cleavage of the bond between the SIS and the extension will release intact SIS from the carrier (with the peptide linkage site and the extension remaining on the carrier). In the case where the proteolytic cleavage is carried out by the enzyme trypsin, then the junction between SIS sequence and the extension is a tryptic cleavage site (i.e., a K or R residue followed by any amino acid except P). If the extension portion of the peptide is n-terminal to the SIS sequence, then the extension will consist of an arbitrary sequence of amino acids ending in K or R, and the tryptic cleavage will occur after this K or R, releasing the c-terminal SIS sequence. If the extension is c-terminal to the SIS sequence, then, since the SIS (having the same sequence as a tryptic peptide) will end in K or R the SIS sequence will be cleaved by trypsin from the c-terminal extension sequence, provided that the extension sequence does not begin with a proline. Extension sequences can contain additional amino acid residues to space the cleavage site away from the carrier, reducing steric hindrance to the action of the cleavage enzyme. Extension sequences can be generic (such as USG or GSGSG sequences (SEQ ID Nos. 1 and 2, respectively) or they can comprise flanking sequence from the target protein sequence (i.e., an n-terminal extension could consist of a stretch of amino acid sequence immediately n-terminal to the analyte peptide sequence). The latter approach provides a cleavage site sequence environment most closely approximating that in the sample protein target, and therefore may help to normalize SIS release to parallel release of analyte peptide during sample digestion.

(112) 11 Surrogate Quantitation of SIS Peptides by Measuring the Amount of Carrier.

(113) An easily quantitated or identified physical or chemical property of the carrier can allow facile detection and measurement of its amount. Suitable properties include optical absorbance (e.g., for naturally colored protein molecules such as the heme-binding domain of cytochrome b5), fluorescence (e.g., found in the green fluorescent protein and its derivatives), content of biotin groups (which can be assayed competitively or directly using well-known biotin binding proteins such as avidin or streptavidin), magnetic properties (e.g., measurable in magnetic beads or the protein ferritin), weight (e.g., dry mass), or even countability (e.g., for 2-50 micron diameter bead materials which can be counted directly in a flow cytometer). In some cases two properties can be used together to establish an improved quantitation method, such as when particles carrying a fluorescent chromophore are measured in a flow cytometer that is capable of both quantitating fluorescence of each particle and counting the particles. Using these or similar properties, the amount of carrier can be directly determined at any time, from manufacture until use in an assay. Provided that a quantitative determination is made of the amount (e.g., moles) of peptide bound by a measurable amount of the carrier, then the amount of peptide being added as carrier conjugate can be determined indirectly by quantitation of the carrier at any subsequent time. This approach makes it possible to know and specify the amount of added carrier and attached SIS peptide at the time of addition to the sample (before or after digestion), and can be used both to verify addition of the desired amount of SIS internal standard, and to control addition to ensure the correct amount is added (e.g., when the added carrierSIS material passes a quantitative sensor that provides feedback to a valve such that the valve opens to allow a predetermined measured quantity of the carrierSIS to pass by, after which the valve shuts.)

(114) 12 Use of a Magnetically Manipulatable Carrier.

(115) A carrier consisting of magnetic beads is particularly favorable due to the ease with which it can be transported into reactions with minimal added fluid volume (thus avoiding dilution), and the ease with which the carrier can be removed from a sample following the release of peptide (e.g., by proteolytic cleavage). Such beads are available in a range of sizes from 200 microns to 20 microns to 1 micron to less than 100 nm diameter, and with a variety of surface coatings. Extended SIS peptides having an n-terminal CGSG-extension (SEQ ID No. 3) can be coupled to heads that have been previously coated with a protein activated with 4-(N-Maleimidomethyl)cyclohexane-1-carboxylic acid 3-sulfo-N-hydroxysuccinimide ester (a heterobifunctional crosslinking reagent that reacts with protein primary amino groups to provide sulfhydryl-reactive maleimide groups on the protein surface). Immobilization of the protein on a magnetic bead surface facilitates carrying out this stepwise treatment, in which beads can easily be moved from reagent to reagent, as well as final washing of the bead-SIS peptide conjugate to remove any weakly or non-specifically bound peptide. Numerous alternative methods of linking peptides to heads of various forms are known to those skilled in the art.

(116) 13 Packaging Collections of Peptides at Defined Stoichiometry on Carriers.

(117) Two or more different peptides, comprising two or more different SIS peptide sequences, can be linked to the same carrier preparation in a known stoichiometric relationship (e.g., one peptide present at 3.5-fold greater molar amount than a second peptide) yielding a stable mixture whose molar ratio is protected against perturbation by preferential loss of one component.

(118) 14 Providing Concentration Curves Via SIS on Carriers.

(119) Two or more different SIS versions of a single analyte peptide sequence, each differing from the analyte and each other only in mass, can also be linked to a carrier in established molar ratios. Such a construct provides a series of distinguishable peptide internal standards at different known amounts, thus establishing the basis of an internal calibration curve when measured quantitatively by mass spectrometry.

(120) 15 Providing Mixtures of Carriers.

(121) Two or more carriers prepared according to these concepts can be mixed in defined ratios to prepare more complex internal standards.

Embodiments

(122) 1) In a first embodiment, an internal standard stable-isotope labeled peptide is added to the sample digest prior to antibody enrichment in a SISCAPA assay at a concentration equal to the established test evaluation threshold of the assay. After elution of the captured peptides from the SISCAPA capture agent, the peptides are analyzed by mass spectrometry. The result of the test is read by comparing the height (or area) of the predominant analyte peak with the height (or area) of the predominant internal standard peak, or more generally by comparing the height (or area) of one or more pre-specified analyte peaks with the height (or area) one or more pre-specified internal standard peaks. 2) In another embodiment, first and second internal standard stable-isotope labeled peptides (identical in chemical structure to each other and to the analyte, but differing in mass) are added to the sample digest prior to antibody enrichment in a SISCAPA assay at concentrations equal to i) the established clinical reference interval lower limit, and ii) the established clinical reference upper limit, respectively. After elution of the captured peptides from the SISCAPA capture agent, the peptides are analyzed by mass spectrometry (e.g., mass spectrometry). The result of the test is read directly by comparison of the height of the predominant analyte peak with the height of the predominant peaks of each internal standard to determine if the analyte is below, within, or above the reference interval (as illustrated in FIG. 2). 3) in another embodiment, the assay of the previous embodiment is carried out, but analyzed using selected reaction monitoring MS on a triple quadrupole instrument. The result of the test is read directly by comparison of the peak area of the predominant analyte peak with the peak areas of the predominant peaks of each internal standard to determine if the analyte is below, within, or above the reference interval (as illustrated in FIG. 4). 4) In another embodiment, first and second internal standard stable-isotope labeled peptides (identical in chemical structure to each other and to the analyte, but differing in mass) are added to the sample digest prior to antibody enrichment in a SISCAPA assay at concentrations (relative to the sample) equal to i) a calculated personal reference interval lower limit, and ii) a calculated personal reference upper limit, respectively. The personal reference interval is computed based on previous analyses of samples from the same individual, and thus represents a personalized reference interval. The addition of SIS peptides is carried out by a computer-controlled dispenser that determines patient identity from the identifying code of the present sample, uses it to search for previous result values or personal reference values in a database, recovers or computes the most current and appropriate updated personal reference values, and delivers into the sample amounts of the first and second internal standard peptides equivalent to the calculated lower and upper limits in relation to the amount of patient sample contained in the present analysis. After elution of the captured peptides from the SISCAPA capture agent, the peptides are analyzed by mass spectrometry to determine if the analyte level is below, within, or above the reference interval. In all of the above embodiments, quantitative analyte concentrations can be calculated, as in the original SISCAPA method, from the ratio of analyte peak height or area to SIS peak height or area, reported with the direct comparison test result, and can be stored in a database to enable subsequent use as a basis of comparison for future test results. 5) in another embodiment, a series of individual analytes is measured in a multiplex assay, and each analyte is compared against its respective SIS internal standard which has been added to the sample at its respective predetermined multiplex test threshold. Evaluation of the multiplex test result consists by determining a result for each individual analyte and then evaluating the panel of analyte results together by lookup in a predetermined outcome table as shown below. The table contains multiplex test results for each possible set of individual analyte results. A specific test result set, shown on the right, is compared with the table to look up the multiplex result, in this case positive.

(123) TABLE-US-00003 embedded image 6) In another embodiment, a known molar amount of an extended SIS peptide (corresponding to a selected analyte peptide of a target sample protein) is reacted with a molar excess of maleimide groups on activated KLH carrier protein to form a carrierSIS conjugate. A known amount of this conjugate (carrying a known molar amount of extended SIS peptide) is added to a known volume of protein sample such as human plasma, and the combined spiked sample digested with trypsin to yield tryptic peptides. The analyte peptide (produced by tryptic cleavage of the target protein) and the corresponding SIS peptide (produced by cleavage between the SIS sequence and the extension linking it to the carrier) are analyzed by quantitative mass spectrometry to provide a ratio of analyte:SIS. Multiplying this ratio by the known molar quantity of SIS added as part of the conjugate yields the molar amount of the analyte peptide, and thus provides a measure of the amount of the target protein in the sample. 7) In another embodiment, a green fluorescent protein (OFP) is used as carrier instead of KLII the process described in the embodiment above. The resulting carrierSIS preparation containing a known molar amount of each extended SIS peptide is characterized by fluorescence spectrophotometry to determine the amount of fluorescence emission per nanomole of SIS peptide. The amount of carrierSIS to be added is confirmed either before or after addition to the sample by fluorescence emission by G-FP. Because GPI is extremely resistant to tryptic cleavage, the amount of carrier can also be measured during or after digestion. 8) In another embodiment, multiple carrierSIS products are made in order to facilitate standardized measurement of proteins having widely different abundances in the sample. Thus, a first carrierSIS product includes SIS peptide sequences corresponding to tryptic peptides from proteins having expected concentrations around 1 mg/ml in human plasma (e.g., hemopexin and alpha-1-antichymotrypsin, while a second carrierSIS product is made containing monitor peptide sequences from low abundance (e.g., 10-1000 pg/ml) proteins such as IL-6 and TNF-alpha. Since the mass spectrometer detection systems used to measure the relative abundances of natural and SIS peptides have limited dynamic range (typically 100 to 10,000), it is desirable to add an amount of each SIS peptide close to the expected amount of the equivalent natural monitor peptide. Thus, the second carrierSIS described would optimally be added at a level approximately 1,000,000-fold less than the first carrierSIS above. In cases where the numbers of SIS peptides required in quantitative studies exceed the number that can conveniently be prepared as one carrierSIS protein, it is natural and efficient to group the desired SIS peptides into classes according to the expected concentration of the proteins from which they arise in the sample. If a set of monitor peptides were selected within a decade of concentration range (i.e., all members within a factor of 10 in expected concentration), then 6 carrierSIS products would be required to span a total dynamic range of 1,000,000 between the most and least abundant target protein. It is also possible to employ carrier polySIS peptide complexes where the polySIS peptides contain different SISpeptide subsequences in different relative proportions to facilitate standardized measurement of proteins at different abundances (e.g. the subsequences may be preset at a ratio selected from: 1:20, 1:10, 1:8, 1:6, 1:4, or 1:2). 9) In another embodiment, magnetic particles coated with maleimide-activated protein are used as carrier. In this case an excess of particles (in terms of moles of reactive maleimide) is reacted with a known molar amount of extended SIS peptide having an n-terminal Cys in the extension. A known fraction of the resulting preparation in liquid suspension is added to a protein-containing sample and digested with trypsin. After digestion, a magnet is used to remove the carrier particles. The SIS-spiked sample, without the carrier, is analyzed by mass spectrometry. 10) In another embodiment, unequal stoichiometries between two or more individual SIS peptides are achieved by coupling a mixture of extended SIS peptides, wherein each is present at a known molar concentration, with an excess of activated carrier. Thus, a carrierSIS product with 1 copy of a SIS sequence denoted A, 2 copies of a SIS sequence denoted B, 4 copies of a SIS sequence denoted C and 10 copies of a SIS sequence denoted D can provide peptide standards at concentrations that match the amounts of monitor peptides derived from proteins expected to be present at relative concentrations of 1:2:4:10 in the original sample. Alternatively, a carrier hearing a polySIS (carrierPolySIS) sequence in which the subsequences A, B, C and D were present in a ratio of 1:2:4:10 respectively could achieve essentially the same result and would require fewer binding sites on the carrier to incorporate the same molar amount of total SIS peptides that would be released into the sample. 11) In another embodiment, two or more monitor peptide sequences are selected from the digest products of a single target analyte protein, and extended SIS sequences for each of these are incorporated into the carrierSIS product. Thus, SIS sequences A, B and C from a given target protein may be incorporated into the carrierSIS at equal molar amounts, or alternatively different molar amounts (e.g., at the upper and lower concentrations of a normal range for an analyte protein). Measurement of multiple monitor peptides from a single protein target (in which the peptides are present at defined, usually 1:1:1, stoichiometry) and comparison to multiple SIS peptides added at accurately defined 1:1:1 stoichiometry in a carrierSIS mixture provides improved measurement precision and allows accurate detection of situations in which only part of a target protein is present. Alternatively, addition of a polySIS peptide or carrierPolySIS conjugate in which the subsequences A, B, and C are present in a ratio of 1:1:1 respectively could achieve the same increase in precision, and would require calibration of only one internal reference standard. 12) In another embodiment, an easily assayed substituent is incorporated into the carrierSIS and used for later quantitation of the carrierSIS conjugate. An example is the incorporation of biotin groups. The presence of the biotin group at 1 mole per mole of carrierSIS allows absolute quantitation of the carrierSIS through use of a standard assay for the biotin tag (e.g., a competition assay using immobilized streptavidin as capture agent and a biotinylated acid phosphatase as the competing ligand able to generate a colorimetric signal). In addition, the biotin tag can be used for purification of the bulk carrierSIS conjugate (where this is of molecular dimensions) by binding to a streptavidin column. The carrierSIS can be released from such a column by selective elution or by cleavage at a peptide sequence linking the SIS sequences to the biotinylated site using a specific protease (e.g., Factor Xa) with a specificity different from the protease used to liberate SIS (e.g., trypsin). 13) in another embodiment, entire domains of target proteins that are labeled with stable isotopes (e.g. during in vitro or in vivo expression or chemical synthesis) are coupled to the carrier instead of short individual extended SIS peptide sequences. In this approach, each domain contains at least one SIS peptide (e.g., tryptic SIS peptide(s)). In those embodiments where one or more domains contain several peptides suitable for measurement by mass spectrometry (e.g., tryptic SIS peptides), those domains offer multiple opportunities to quantitate the target. More importantly, by including entire domains likely to fold in a manner more similar to the fold of part of the intact whole target protein, the carrierSIS better replicates the environment within which the proteolysis will occur for the native target proteini.e., the cleavage of the peptides in the carrierSIS may better parallel the efficiency in the target. 14) In another embodiment, one or more SIS peptides are applied in known amounts to a surface of a single-use component provided in an assay kit, in a form that preserves peptide integrity during kit storage and allows release of the SIS when the surface contacts the sample. For example, three SIS peptides are deposited at the bottom of a well of a polypropylene 96-well plate in a small volume of an aqueous matrix containing dissolved trehalose and then dried in place, each in an amount equal to that required to establish a respective pre-determined test evaluation threshold in a specified volume (e.g., 100 microliters) of a protein-containing sample such as human plasma or a digest of plasma. Once the pre-specified volume of applied sample dissolves the dried SIS peptides, they are available to act as internal standards. A variety of peptide stabilizers are known in the art that are capable of incorporating or adsorbing SIS peptides in such a way that they readily dissolve in an applied liquid sample. Such surface applied SIS peptides can be placed in or on tubes, microtiter wells, pipette tips, pins, and other single-use components of an assay kit to provide accurate amounts of internal standard. Use of this approach has the advantage that the amount of SIS delivered per assay is controlled at the point of manufacture of the component and does not depend on the accuracy of SIS dispensing at the point of use. CarrierSIS conjugates, polySIS polypeptides, or carrierPolySIS conjugates can be similarly placed on surfaces in place of SIS peptides. Components that are exposed to the digestion process (e.g., to a proteolytic enzyme) are appropriate sites for covalent binding of carrierSIS to which SIS are linked by a proteolytically cleavable linker.

EXAMPLES

(124) In a first example, a tryptic peptide analyte (having sequence FSPDDSAGASALLR (SEQ ID No. 4) and protonated monoisotopic mass 1406.691) is selected to allow measurement of human thyroglobulin in plasma. Synthetic peptides having this sequence are generated by conventional solid phase peptide synthesis using i) precursors with natural isotopic composition (i.e. yielding an unlabeled peptide equivalent to the analyte) and ii) the same precursors except for use of labeled arginine (whose precursor is substituted with .sup.13C and .sup.15N at all positions), yielding a SIS peptide with a stable isotope labeled c-terminal arginine residue and hence a mass that is 10 atomic mass units (amu) greater than the unlabeled analyte.

(125) A series of dilutions of synthetic analyte peptide are prepared, each containing the same concentration of the SIS version of this analyte, so that the ratio of analyte to SIS amounts varies across the dilution series. In this example, the amount of the SIS version illustrates the clinical decision point of an assay for the peptide. Thus, in the simplest embodiment described here, the result of the assay is given by comparing the amount of the analyte to the amount of the SIS and providing a binary assay result depending upon whether the analyte is present in greater or lesser amount than the added SIS here used as an internal standard at a clinical decision threshold. Two ul (microliters) of peptide samples were applied to MALDI matrix spots on a pre-spotted MALDI target (Eppendorf Pre-spotted AnchorChip targets sold by Balker Daltonics) in 5% acetic acid for 3 minutes, followed by 5 ul of ammonium phosphate in 0.1% trifluoroacetic acid, after which the liquid was withdrawn and the target dried in air. MALDI spectra were obtained with a Bruker Autoflex MALDI mass spectrometer in reflection mode, and processed using Bruker flexAnalysis software to yield centroid peak heights and areas.

(126) FIG. 5 shows the MALDI mass spectra of three samples in the dilution curve: A in which the unlabeled analyte peptide (at mass 1406.7) is present in an amount greater than the SIS at mass 1416.7, the difference in peak heights being amount 31; B in which the amounts are very nearly equal; and C in which the analyte peak is less than the SIS peak by amount 32. The ratios of the heights (intensities) of the major analyte to SIS peaks in A, B and C are 1.183, 0.991, and 0.856, with coefficients of variation of 2.1%, 1.1% and 1.8% across a series of replicate. MALDI spots (4, 3, and 4 spots respectively). Panel A thus represents a case in which the analyte is about 19% greater in intensity than the SIS, which given an average CV (coefficient of variation=standard deviation divided by the mean) in this range of 1.7%, is almost 12 standard deviations above the clinical decision level. Panel C represents a case in which the analyte is about 14% below the intensity of the SIS, which is more than 8 standard deviations below the clinical decision level. If centroid peak area is used instead of peak intensity, the respective ratios are 1.187, 1.003, 0.837. Clearly the detection scheme illustrated here can unequivocally determine that analyte is more or less than the clinical decision level by 15% with extreme statistical precision (i.e., more than 8 standard deviations).

(127) Panel B of FIG. 5 represents a case in which the analyte level is very close to the clinical decision level (assumed here to be the known level at which the SIS peptide is added to the sample). A set of 4 MALDI target spots prepared from each of 3 replicate dilution series (12 total replicates) of the composition shown in panel B were analyzed by MALDI and the results for the analyte and SIS peaks obtained. The average ratio over 12 replicates between analyte and SIS peak heights (intensities) was 0.9998 with a CV of 1.5%. The average ratio over 12 replicates between analyte and SIS peak areas (calculated by a centroid algorithm) was 0.9948 with a CV of 1.1%. Any ratio that is more than 4.5% above or below a measured ratio of 1.0 would therefore represent a significance of 3 or more standard deviations from the clinical decision level. This level of result precision in relation to a clinical decision level is better than most current clinical protein immunoassays, both in terms of absolute precision of measurement and because of the ability to use internal, rather than external, standardization (contributing to better test accuracy).

(128) In a second example, a series of peptide analytes at approximately equal molar abundances is used to prepare a series of dilutions in relation to fixed concentrations of the SIS versions of the same peptides, illustrating in one embodiment the method applied to a multiplexed test situation. Analyte peptides 1-5 are measured (as peak intensity) in relation to SIS peptides 1-5 added as internal standards at their respective multiplex test thresholds. Analytes 1 and 4 exceed their respective thresholds, while analytes 2, 3 and 5 are lower than their respective thresholds. The result of the test is determined by comparison with a pre-established matrix of outcomes: the result pattern High-Low-Low-High-Low is looked up in this table and found to generate a negative test result.

(129) In a third example, a carrierSIS protein is prepared by linking extended SIS peptides to an activated protein carrier (as shown in FIGS. 6A and B). Carrier protein 1, in this case keyhole limpet hemocyanine (KLH), is activated by modification with multiple groups covalently attached to the KLH, each of which comprises a linker segment 2 and a maleimide reactive group 2 (M). This modification is accomplished by reaction of purified KLH with 4-(N-maleimidomethyl)cyclohexane-1-carboxylic acid 3-sulfo-N-hydroxysuccinimide ester (a heterobifunctional crosslinking reagent that reacts with protein primary amino groups to provide sulfhydryl-reactive maleimide groups on the protein surface).

(130) SIS peptides are chemically synthesized with an n-terminal sequence extension containing a cysteine residue (whose sulfhydryl reacts with maleimide to yield a stable chemical bond), several spacer amino acids (here -GSG-, SEQ ID No. 1) and a final lysine (K) residue adjacent to the SIS n-terminus, creating a tryptic cleavage site. Peptide synthesis is typically carried out on a solid phase resin (Merrifield, Methods Enzymol 289:3-13, 1997), and can include steps to ligate together multiple synthetic peptides to produce larger peptides or proteins (Dawson, Muir, Clark-Lewis and Kent, Science 266:776-9, 1994, Dawson and Kent, Annu Rev Biochem 69:923-60, 2000). One embodiment makes use of stable isotope labeled K and R, since each tryptic SIS peptide contains only one such residue (either K or R) per peptide at the c-terminus, thus simplifying the calculation of mass shifts in the y-ion fragment series often used for selected reaction monitoring (SRM) quantitation in tandem mass spectrometry. Incorporation of labeled K or R is achieved through use of the corresponding labeled K or R synthons commercially available for solid phase peptide synthesis. Alternatively any amino acid containing stable isotope labels can be used.

(131) Thus, the SIS peptide EIGELYLPK* (SEQ ID No. 5, corresponding to a tryptic peptide of human alpha-1-antichymotrypsin and incorporating a c-terminal stable isotope-labeled lysine shown as K* and described as U-.sup.13C.sub.6, 98%;U-.sup.15N.sub.2,98%, thus, having a mass 8 amu greater than the unlabeled natural analyte peptide of the same sequence) is synthesized as the extended SIS peptide sequence CGSGKEIGELYLPK* (SEQ ID No. 6). This extended peptide reacts with activated KLH through reaction of the peptide's n-terminal cysteine sulfhydryl and a maleimide group on activated KLH. Action of trypsin on this extended SIS sequence bound to KLH cleaves between K and E residues, releasing the SIS sequence EIGELYLPK* (SEQ ID No. 5) without any extension and which is capable of functioning as a labeled internal standard for mass spectrometric measurement of EIGELYLPK (SEQ ID No. 5) (and thus indirectly of alpha-1-antichymotrypsin) in a sample digest. Similarly a second SIS peptide NFPSPVDAAFR* (SEQ ID No. 7, a tryptic peptide of human hemopexin) is synthesized as the extended SIS CGSGKNFPSPVDAAFR* (SEQ ID No. 8) and reacted with activated KLH, combining with other maleimide groups on the activated KLH molecule. Action of trypsin on the bound extended SIS releases the SIS sequence NLPSPVDAAFR*, (SEQ ID No. 7) capable of functioning as a labeled internal standard for mass spectrometric measurement of sample-derived NFPSPVDAAFR (SEQ ID No. 7) and thus of the parent protein hemopexin.

(132) To form the SIS peptide:carrier conjugate, a known amount of each SIS peptide (as established by quantitative amino acid analysis) is added to a 1.2 fold molar excess of activated KLH carrier (as determined by titration of available maleimide groups) and allowed to react for 6 hours (hr) at room temperature.

(133) A known amount of carrierSIS (i.e., a known volume of standardized solution) is then added to a measured volume of a sample in which the target proteins are to be quantitated (in this case a sample of human blood plasma). This combined sample, including spiked carrierSIS standard, is then proteolyticaliy digested by exposure to trypsin using any of a variety of well-known protocols. In one such protocol, plasma is denatured by addition of 9 volumes of 6 M guanidinium. HCl/50 mM Tris-HCl/10 mM dithiothreitol and incubation for 2 hr at 60 C.; addition of 1 volume of 200 mM iodoacetamide followed by incubation for 30 min at 25 C; addition of 1 volume of 200 mM dithiothreitol followed by incubation for 30 min at 25 C; dilution to <1 M guanidinium HCl by addition of 50 mM NaHCO.sub.3, addition of sequencing grade modified trypsin (e.g., from Promega, Madison, Wis.) at a 1:50 ratio (trypsin:plasma protein) and incubation overnight at 37 C. Digestion is allowed to proceed until substantially complete, liberating the monitor peptides from both target proteins and carrierSIS protein essentially to completion. Alternatively a mixture of SIS resulting from prior digestion of carrierSIS protein can be added to the sample before or after sample digestion. This sample digest now contains versions of analyte (monitor) peptides containing natural isotopes (from peptides derived from the original sample) and stable isotopes (in the SIS peptides derived from the carrierSIS protein). Each sample-derived analyte monitor peptide can then be quantitated by measuring its concentration relative to the stable isotope version (which has a known concentration calculable from the amount spiked into the sample or sample digest) in a mass spectrometer, the results of which (an analyte:SIS ratio) then allows calculation of the concentration of the associated target protein in the initial sample (as described in published U.S. Pat. No. 7,632,686, High Sensitivity Quantitiation Of Peptides By Mass Spectrometry, Anderson, Norman L.). In some embodiments, the relative concentrations of natural and stable isotope labeled monitor peptides can be measured by mass spectrometry as the relative ion currents recorded as peak intensity or area for the two peptides using electrospray-MS, or as peak intensity or area by MALDI-MS. The two versions of the peptide perform essentially identically in any chromatographic or affinity based separation or enrichment process (providing the elements N, C or O are used as stable isotope labels), and thus co-elute, facilitating direct comparison of ion currents. In this embodiment, one carrierSIS protein can replace an entire collection of separate SIS peptides described in earlier disclosures, and eliminates the requirement to separately store and handle the various SIS peptide reagents. Quantitative MS measurements can be made using a variety of ionization sources (e.g., electrospray ionization [ESI] and matrix-assisted laser desorption ionization [MAIDI]) and mass analyzers (e.g., time-of-flight [TOF], triple quadrupole [TQMS], Fourier transform ion cyclotron resonance [FTICR], and ion trap).

(134) The foregoing disclosure outlines a number of embodiments in terms of the SISCAPA method, and therefore represents one set of embodiments that may be employed in the application of the present technology. It will be appreciated that the methods and compositions disclosed herein are not limited to the SISCAPA method, but may be applied to other methods that employ internal peptide standards and the like.