Mutant spike protein extending the tissue tropism of infectious bronchitis virus (IBV)

09969777 ยท 2018-05-15

Assignee

Inventors

Cpc classification

International classification

Abstract

The present invention provides an infectious bronchitis virus (IBV) spike protein (S protein) which is based on an S protein from an IBV strain with restricted tissue tropism, but which comprises the sequence XBBXBX in the part of the S2 protein corresponding to residues 686 to 691 of the sequence given as SEQ ID No. 2, where B is a basic residue and X is any amino acid; and which comprises at least one of the following amino acid substitutions with reference to the position numbering of SEQ ID NO:2: Leucine (L) to Phenylalanine (F) at position 578 Asparagine (N) to Serine (S) at position 617 Asparagine (N) to Serine (S) at position 826 Leucine (L) to Phenylalanine (F) at position 857 and Isoleucine (I) to Valine (V) at position 1000 such that an IBV virus comprising the S protein has extended tissue tropism. The present invention also provides a virus comprising such an S protein.

Claims

1. An infectious bronchitis virus (IBV) spike protein (S protein) which comprises an S1 domain of an IBV strain with restricted tissue tropism that is unable to grow on Vero cells and an S2 domain which has at least 98% sequence identity to the S2 domain of the S protein from an IBV strain with restricted tissue tropism that is unable to grow on Vero cells, but which comprises the sequence XBBXBX (SEQ ID NO: 3) in the part of the S2 domain corresponding to residues 686 to 691of the sequence of SEQ ID NO: 2, where B is a basic residue and X is any amino acid; and which comprises at least one of the following amino acid substitutions with reference to the position numbering of SEQ ID NO: 2: Leucine (L) to Phenylalanine (F) at position 578; Asparagine (N) to Serine (S) at position 617; Asparagine (N) to Serine (S) at position 826; Leucine (L) to Phenylalanine (F) at position; 857 and Isoleucine (I) to Valine (V) at position 1000; such that an IBV virus comprising the S protein is able to grow on Vero cells.

2. The IBV S protein according to claim 1, which comprises the sequence SRRKRS (SEQ ID NO: 4) or SRRRRS (SEQ ID NO: 5) in the part of the S2 domain corresponding to residues 686 and 691 of the sequence of SEQ ID NO: 2.

3. The IBV S protein according to claim 1, which comprises the sequence SRRKRSLIE (SEQ ID NO: 6) or SRRRRSVIE (SEQ ID NO: 7) in the part of the S2 domain corresponding to residues 686 and 694 of the sequence of SEQ ID NO: 2.

4. The IBV S protein according to claim 1, which comprises the amino acid substitution Asparagine (N) to Serine (S) at position 617 with reference to the position numbering of SEQ ID NO: 2.

5. The IBV S protein according to claim 1, which comprises the following amino acid substitutions with reference to the position numbering of SEQ ID NO: 2: Leucine (L) to Phenylalanine (F) position 578 and Asparagine (N) to Serine (S) position 617.

6. The IBV S protein according to claim 1, which comprises the following amino acid substitutions with reference to the position numbering of SEQ ID NO: 2: Asparagine (N) to Serine (S) position 826; Leucine (L) to Phenylalanine (F) position 857; and Isoleucine (I) to Valine (V) position 1000.

7. A nucleic acid comprising a nucleotide sequence encoding an infectious bronchitis virus (IBV) spike protein (S protein) which comprises an S1 domain of an IBV strain with restricted tissue tropism that is unable to grow on Vero cells and an S2 domain which has at least 98% sequence identity to the S2 domain of the S protein from an IBV strain with restricted tissue tropism that is unable to grow on Vero cells, but which comprises the sequence XBBXBX (SEQ ID NO: 3) in the part of the S2 domain corresponding to residues 686 to 691 of the sequence of SEQ ID NO: 2, where B is a basic residue and X is any amino acid; and which comprises at least one of the following amino acid substitutions with reference to the position numbering of SEQ ID NO: 2: Leucine (L) to Phenylalanine (F) at position 578; Asparagine (N) to Serine (S) at position 617; Asparagine (N) to Serine (S) at position 826; Leucine (L) to Phenylalanine (F) at position 857; and Isoleucine (I) to Valine (V) at position 1000; such that an IBV virus comprising the S protein is able to grow on said Vero cells.

8. A plasmid comprising the nucleic acid according to claim 7.

9. A viral particle comprising an IBV S protein according to claim 1, and/or a nucleic acid comprising a nucleotide sequence encoding said IBV S protein, wherein the viral particle is capable of growing on Vero cells.

10. The viral particle according to claim 9, whose infection of Vero cells is blocked by soluble heparin.

11. A cell that comprises the nucleic acid according to claim 7 and that is capable of producing a viral particle, wherein said viral particle comprises said IBV S protein and/or a nucleotide sequence encoding said IBV S protein.

12. A Vero cell according to claim 11.

13. A vaccine comprising the viral particle according to claim 9.

14. A method for treating and/or preventing infectious bronchitis in a subject, the method comprising administering to the subject the vaccine according to claim 13.

15. A method for producing a vaccine which comprises the step of infecting Vero cells with a viral particle according to claim 9.

16. The nucleic acid according to claim 7, wherein the IBV S protein comprises the sequence SRRKRS (SEQ ID NO: 4) or SRRRRS (SEQ ID NO: 5) in the part of the S2 domain corresponding to residues 686 and 691 of the sequence of SEQ ID NO: 2.

17. The nucleic acid according to claim 7, wherein the IBV S protein comprises the sequence SRRKRSLIE (SEQ ID NO: 6) or SRRRRSVIE (SEQ ID NO: 7) in the part of the S2 domain corresponding to residues 686 and 694 of the sequence of SEQ ID NO: 2.

18. The nucleic acid according to claim 7, wherein the IBV S protein comprises the amino acid substitution Asparagine (N) to Serine (S) at position 617with reference to the position numbering of SEQ ID NO: 2.

Description

DESCRIPTION OF THE FIGURES

(1) FIG. 1 Growth kinetics of the six variant rIBVs on Vero cells all the rIBVs investigated had been passaged 7 times on Vero cells.

(2) FIG. 2 Growth kinetics of the six variant rIBVs on Vero cells without previous passage on Vero cells.

(3) FIG. 3 Alignment of amino acid sequences of complete S proteins for IBV Beaudette (SEQ ID NO: 1), M41 (SEQ ID NO: 2), H120 (SEQ ID NO: 9), and QX (SEQ ID NO: 10). The S1/S2 junction is at position 537. The amino acid positions in the S2 subunit are 2 higher than shown in SEQ ID No. 1 (578 becomes 580) due to the QX S1 sequence being two amino acids longer than the other S1 sequences.

(4) FIG. 4 Alignment of amino acid sequences of the S2 subunits, for IBV Beaudette (SEQ ID NO: 11), M41 (SEQ ID NO: 12), H120 (SEQ ID NO: 13), and QX (SEQ ID NO: 14). The amino acid modifications tested in the six rIBVs described in the Examples are marked with an arrow.

DETAILED DESCRIPTION

(5) IBV

(6) Avian infectious bronchitis (IB) is an acute and highly contagious respiratory disease of chickens which causes significant economic losses. The disease is characterized by respiratory signs including gasping, coughing, sneezing, tracheal rales, and nasal discharge. In young chickens, severe respiratory distress may occur. In layers, respiratory distress, nephritis, decrease in egg production, and loss of internal egg quality and egg shell quality are common.

(7) In broilers, coughing and rattling are common clinical signs, rapidly spreading in all the birds of the premises. Morbidity is 100% in non-vaccinated flocks. Mortality varies depending on age, virus strain, and secondary infections but may be up to 60% in non-vaccinated flocks.

(8) The first IBV serotype to be identified was Massachusetts, but in the United States several serotypes, including Arkansas and Delaware, are currently circulating, in addition to the originally identified Massachusetts type.

(9) The IBV strain Beaudette was derived following at least 150 passages in chick embryos. IBV Beaudette is no longer pathogenic for adult birds but rapidly kills embryos.

(10) H120 is a commercial live IBV Massachusetts serotype vaccine strain, attenuated by approximately 120 passages in embryonated chicken eggs. H52 is another Massachusetts strain, and represents an earlier and slightly more pathogenic passage virus (passage 52) during the development of H120. Vaccines based on H120 and H52 are commonly used.

(11) IB QX is a virulent field isolate of IBV. It is sometimes known as Chinese QX as it was originally isolated following outbreaks of disease in the Qingdao region in China. Since that time the virus has crept towards Europe. From 2004, severe egg production issues have been identified with a very similar virus in parts of Western Europe, predominantly in the Netherlands, but also reported from Germany, France, Belgium, Denmark and in the UK.

(12) The virus isolated from the Dutch cases was identified by the Dutch Research Institute at Deventer as a new strain that they called D388. The Chinese connection came from further tests which showed that the virus was 99% similar to the Chinese QX viruses. An attenuated live QX-like infectious bronchitis virus strain has now been developed.

(13) S Protein

(14) The IBV S protein comprises a large, heavily glycosylated ectodomain that can be cleaved during biosynthesis into two subunits (S1 and S2) by a furin-like enzyme in the Golgi apparatus. S1 comprises the receptor binding domain and S2 comprises the fusion domain. The S protein of IBV is fully cleaved at the S1/S2 boundary, to especially in chicken embryo systems.

(15) The S2 domain contains five domains or functional regions: two domains, HR1 and HR2 form helical structures resulting in the stalk structure of the protein; a transmembrane domain responsible for anchoring the protein to the virion membrane; a cysteine-rich cytoplasmic domain responsible for interacting with other virus structural proteins and a fifth domain, the fusion peptide, responsible for virus-cell fusion or cell-to-cell fusion.

(16) The amino acid sequences for IBV strains Beaudette and M41 are as follows:

(17) SEQ ID No. 1: IBV Beaudette S protein. The full Beaudette-specific motif is shown in bold (amino acids 686-694).

(18) TABLE-US-00001 1mlvtplllvtllcalcsavlydsssyvyyyqsafrppsgwhlqggayavvnissefnnag 61sssgctvgiihggrvvnassiamtapssgmawsssqfctahcnfsdttvfvthcykhggc 121pltgmlqqnlirvsamkngqlfynitvsvakyptfrsfqcvnnitsvylngdlvytsnet 181idvtsagvyfkaggpitykvmrevkalayfvngtaqdvilcdgsprgllacqyntgnfsd 241gfypftnsslvkqkfivyrensvnttctlhnfifhnetganpnpsgvgniqtyqtktaqs 301gyynfnfsflssfvykesnfmygsyhpsckfrletinnglwfnslsysiaygplqggckq 361svfkgratccyaysyggpslckgvysgeldhnfecgllvyvtksggsriqtateppvitq 421nnynnitlntcvdyniygrtgqgfitnvtdsaysynyladaglaildtsgsidifvvqge 481yglnyykvnpcedvnqqfvvsggklvgiltsrnetgsqllenqfyikitngtrrfrrsit 541envancpyvsygkfcikpdgsiativpkgleqfvaplfnvtenvlipnsfnitvtdeyiq 601trmdkvqinclqyvcgssldcrklfqqygpvcdnilsvvnsvggkedmellnfysstkpa 661gfntpvisnvstgefnisllltnpssrrkrsliedllftsvesvglptndayknctagpl 721gffkdlacareyngllvlppiitaemqalytsslvasmafggitaagaipfatqlqarin 781hlgitqslllknqekiaasfnkaighmqegfrstslalqgiqdvvskqsailtetmasln 841knfgaissviqeiyqqfdaiganaqvdrlitgrlsslsvlasakqaeyirvsqqrelatq 901kinecvksqsirysfcgngrhvltipqnapngivfihfsytpdsfvnvtaivgfcvkpan 961asqyaivpangrgifiqvngsyyitardmympraitagdvvtltscqanyvsvnktvitt 1021fvdnddfdfndelskwwndtkhelpdfdkfnytvpildidseidriggviqglndslidl 1081eklsilktyikwpwyvwlaiafatiifililgwvffmtgccgcccgcfgimplmskcgkk 1141ssyyttfdndvvteqyrpkksv

(19) SEQ ID No 2: IBV M41 S protein. The amino acids positions 686-691 and 578, 617, 826, 857 and 1000 are shown in bold.

(20) TABLE-US-00002 1mlvtplllvtllcvlcsaalydsssyvyyyqsafrppngwhlhggayavvnissesnnag 61sspgcivgtihggrvvnassiamtapssgmawsssqfctahcnfsdttvfvthcykydgc 121pitgmlqknflrvsamkngqlfynitvsvakyptfksfqcvnnitsvylngdlvytsnet 181tdvtsagvyfkaggpitykvmrkvkalayfvngtaqdvilcdgsprgllacqyntgnfsd 241gfypfinsslvkqkfivyrensvnttftlhnftfhnetganpnpsgvgniltyqtqtaqs 301gyynfnfsflssfvykesnfmygsyhpscnfrletinnglwfnslsysiaygplqggckq 361svfsgratccyaysyggpslckgvysgeldlnfecgllvyvtksggsriqtateppvitr 421hnynnitlntcvdyniygrtgqgfitnvtdsaysynyladaglaildtsgsidifvvqge 481ygltyykvnpcedvnqqfvvsggklvgiltsrnetgsqllenqfyikitngtrrfrrsit 541envancpyvsygkfcikpdgsiativpkqleqfvapllnvtenvlipnsfnitvtdeyiq 601trmdkvqinclqyvcgnsldcrdlfqqygpvcdnilsvvnsigqkedmellnfysstkpa 661gfntpflsnvstgefnislllttpssprrrsfiedllftsvesvglptddayknctagpl 721gflkdlacareyngllvlppiitaemqtlytsslvasmafggitaagaipfatqlqarin 781hlgitqslllknqekiaasfnkaigrmqegfrstslalggiqdvvnkqsailtetmasln 841knfgaissviqeiyqqldaiganagvdrlitgrlsslsvlasakqaehirvsggrelatq 901kinecvksqsirysfcgngrhvltipqnapngivfihfsytpdsfvnvtaivgfcvkpan 961asqyaivpangrgifiqvngsyyitardmympraitagdivtltscqanyvsvnktvitt 1021fvdnddfdfndelskwwndtknelpdfdkfnytvpildidseidriqgviqglndslidl 1081eklsilktyikwpwyvwlaiafatiifililgwvffmtgccgcccgcfgimplmskcgkk 1141ssyyttfdndvvtegnrpkksv

(21) FIG. 3 shows an alignment between IBV strains Beaudette, M41, H120 and QX S proteins.

(22) FIG. 4 shows an alignment between IBV strains Beaudette, M41, H120 and QX S2 subunits.

(23) Tissue Tropism

(24) Coronaviruses show strong species and tissue tropism. Likewise, clinical isolates of IBV show distinct tropism both in vivo and in cell culture.

(25) The M41 strain has been adapted for growth on primary chick kidney (CK) cells and is restricted to infection of primary chicken cells, and so needs to be grown on embryonated eggs or CK cells.

(26) The Beaudette strain, on the other hand, is known to be able to infect a range of cells in culture, including Vero and baby hamster kidney (BHK-21) cells.

(27) An IBV strain with restricted tissue tropism is able to infect a smaller number of cell types than a coronavirus with extended tissue tropism.

(28) An IBV strain with restricted tissue tropism, may, for example, be restricted to infection of primary cells, whereas an IBV strain with extended tissue tropism may (in addition to being able to infect primary cells) be able to infect one or more cell lines.

(29) An IBV strain with extended tissue tropism may, for example, have the capacity to infect Vero cells.

(30) The Vero cell lineage was isolated in 1962 from kidney epithelial cells extracted from an African green monkey (Cercopithecus aethiops). Vero cells are used for many experimental and clinical purposes, including acting as host cells for growing virus.

(31) The Vero cell lineage is continuous in that it can be replicated through many cycles of division and not become senescent.

(32) The Vero cell lineage has been licensed for use in the manufacture of vaccines and is currently used for the production of polio and rabies vaccines.

(33) An IBV strain with restricted tissue tropism may be immunogenic and capable of inducing a protective or therapeutic immune response in vivo. Examples of strains with restricted tissue tropism include the strains currently used for vaccine production. For IBV, this includes strains such as: H52, H120, Ma5, 4/91, D41, D274, W93 and QX. The strain with restricted tissue tropism may be or be derived from an isolate from the field such as BJ1, BJ2, or BJ3 (Li and Yang (2001) Avian Pathol 30:535-541).

(34) An example of an IBV strain with extended tissue tropism is IBV Beaudette.

(35) Cell tropism may be established experimentally by simply challenging a given cell type with infection by a virus. The cytopathic effect (cpe) and the degree of formation of syncytia may then be analysed after a certain number of passages. Change in morphology of the infected cells may be analysed using microscopy.

(36) Variant S Protein

(37) The present invention relates to an infectious bronchitis virus (IBV) spike protein (S protein) which is based on an S protein from an IBV strain with restricted tissue tropism, but which comprises a Beaudette specific motif together with one or more Beaudette-specific amino acid substitutions, such that an IBV virus comprising the S protein has extended tissue tropism.

(38) The term based on indicates that at least the S1 domain is derived or derivable from the strain with restricted tissue tropism. The majority of S2 domain may also be derived or derivable from the strain with restricted tissue tropism. For example, the transmembrane and/or cytoplasmic domains may be derived or derivable from the strain with restricted tissue tropism. The S2 domain may correspond to the sequence of the S2 domain from the strain with restricted tissue tropism, subject to the following changes:

(39) (1) insertion of a Beaudette-specific motif in in the part of the S2 protein corresponding to residues 686 to 691 of the sequence given as SEQ ID No. 2;

(40) (2) amino acid substitution in one or more of the following positions, with reference to SEQ ID No. 2: 578, 617, 826, 857, 1000.

(41) The S2 domain may comprise some additional amino acid mutations, such as substitutions, insertions or deletions, as long as they do not significantly affect the capacity of the S2 subunit to extend the tissue tropism of the resultant virus. The additional amino acid mutations may, for example, arise as a result of passage on a cell line such as Vero cells. The S2 domain may, for example comprise an additional mutation at amino acid position 865 (glutamine (Q) to histidine (H)).

(42) Considering the entire S2 sequence without amino acid positions 686-694, 578, 617, 826, 857 and 1000, substantially all of the remainder of the sequence may correspond to that of the wild-type S2 sequence from the strain with restricted tissue tropism.

(43) The term substantially all means that the S2 protein has at least 90, 95 or 98% of the wild-type sequence as a whole but ignoring amino acid positions 686-694, 578, 617, 826, 857 and 1000.

(44) The term wild type is used to mean a polypeptide having a primary amino acid sequence which is identical with the native protein (i.e., the viral protein).

(45) Identity comparisons can be conducted by eye, or more usually, with the aid of readily available sequence comparison programs. These commercially available computer programs can calculate % identity between two or more sequences. A suitable computer program for carrying out such an alignment is the GCG Wisconsin Bestfit package (University of Wisconsin, U.S.A.; Devereux et al., 1984, Nucleic Acids Research 12:387). Examples of other software that can perform sequence comparisons include, but are not limited to, the BLAST package (see Ausubel et al., 1999 ibidChapter 18), FASTA (Atschul et al., 1990, J. Mol. Biol., 403-410) and the GENEWORKS suite of comparison tools. Both BLAST and FASTA are available for offline and online searching (see Ausubel et al., 1999 ibid, pages 7-58 to 7-60). However, for some applications, it is preferred to use the GCG Bestfit program. A new tool, called BLAST 2 Sequences is also available for comparing protein and nucleotide sequence (see FEMS Microbiol Lett 1999 174(2): 247-50; FEMS Microbiol Lett 1999 177(1): 187-8 and tati ana@ncbi.nlm.nih.gov).

(46) The sequence may have one or more deletions, insertions or substitutions of amino acid residues which produce a silent change and result in a functionally equivalent molecule. Deliberate amino acid substitutions may be made on the basis of similarity in polarity, charge, solubility, hydrophobicity, hydrophilicity, and/or the amphipathic nature of the residues as long as the activity is retained. For example, negatively charged amino acids include aspartic acid and glutamic acid; positively charged amino acids include lysine and arginine; and amino acids with uncharged polar head groups having similar hydrophilicity values include leucine, isoleucine, valine, glycine, alanine, asparagine, glutamine, serine, threonine, phenylalanine, and tyrosine.

(47) Conservative substitutions may be made, for example according to the Table below. Amino acids in the same block in the second column and preferably in the same line in the third column may be substituted for each other:

(48) TABLE-US-00003 ALIPHATIC Non-polar G A P I L V Polar - uncharged C S T M N Q Polar - charged D E K R AROMATIC H F W Y

(49) An alignment between S proteins of different strains is straightforward because coronaviruses share a common domain structure and, between strains, should have a relatively high level of sequence identity. Alignment software may be used such as the BLAST? package described above.

(50) Amino Acid Positioning

(51) The S protein of the present invention comprises the sequence XBBXBX (SEQ ID NO: 3) in the part of the S2 protein corresponding to residues 686 to 691 of the sequence given as SEQ ID NO: 2 , where B is a basic residue and X is any amino acid; and comprises at least one of the following amino acid substitutions with reference to the position numbering of SEQ ID NO:2:

(52) Leucine (L) to Phenylalanine (F) at position 578

(53) Asparagine (N) to Serine (S) at position 617

(54) Asparagine (N) to Serine (S) at position 826

(55) Leucine (L) to Phenylalanine (F) at position 857 and

(56) Isoleucine (I) to Valine (V) at position 1000.

(57) Sequence ID NO: 2 is the sequence of IBV strain M41 S protein. It may be that the S protein from other IBV strains has slightly different amino acid numbering. For example, the S1 sequence of the QX strain is two amino acids longer than the S1 sequences of strains such as M1, Beaudette and H120. This means that for an S protein according to the invention based on QX, the XBBXBX (SEQ ID NO: 3) motif would appear in the section of sequence at position 688-693. The above mentioned mutations would be at positions 580, 619, 828, 859 and 1002.

(58) The phrase with reference to the position numbering of SEQ ID No. 2 indicates that the amino acid position is equivalent to the one shown for the M41 S protein sequence shown in SEQ ID No 1. It will be appreciated that the actual number of the amino acid from the N-terminus of the protein may vary between IBV S proteins of different strains, as it does for QX as explained above. However, it is should be clear from an alignment of the IBV S protein with the M41 sequence of SEQ ID No. 1 which is the equivalent amino acid position.

(59) An alignment of S proteins from various IBV strains is shown in FIG. 3.

(60) The position of the motif and mutations can also be given in the context of the S2 subunit.

(61) An alignment of the S2 subunits from various IBV strains is shown in FIG. 4. The corresponding amino acid positions for the S2 subunit is shown in the following Table:

(62) TABLE-US-00004 M41 S protein M41 S2 subunit position position XBBXBX (SEQ 686-691 154-159 ID NO: 3 ) motif L.fwdarw.F 578 46 N.fwdarw.S 617 85 N.fwdarw.S 826 294 L.fwdarw.F 857 325 I.fwdarw.V 1000 468

(63) Thus the S protein of the present invention comprises the sequence XBBXBX (SEQ ID NO: 3) in the part of the S2 protein corresponding to residues 154 to 159 of the sequence shown in FIG. 4, where B is a basic residue and X is any amino acid; and comprises at least one of the following amino acid substitutions with reference to the position numbering of the sequences shown in FIG. 4:

(64) Leucine (L) to Phenylalanine (F) at position 46

(65) Asparagine (N) to Serine (S) at position 85

(66) Asparagine (N) to Serine (S) at position 294

(67) Leucine (L) to Phenylalanine (F) at position 325 and

(68) Isoleucine (I) to Valine (V) at position 468.

(69) Nucleotide Sequence

(70) The present invention also provides a nucleotide sequence capable of encoding the S protein of the present invention.

(71) The nucleotide sequence may be natural, synthetic or recombinant. It may be double or single stranded, it may be DNA or RNA or combinations thereof. It may, for example, be cDNA, a PCR product, genomic sequence or mRNA.

(72) The nucleotide sequence may be codon optimised for production in the host/host cell of choice.

(73) It may be isolated, or as part of a plasmid, virus or host cell.

(74) Plasmid

(75) A plasmid is an extra-chromosomal DNA molecule separate from the chromosomal DNA which is capable of replicating independently of the chromosomal DNA. They are usually circular and double-stranded.

(76) Plasmids, or vectors (as they are sometimes known), may be used to express a protein in a host cell. For example a bacterial host cell may be transfected with a plasmid capable of encoding a particular protein, in order to express that protein. The term also includes yeast artificial chromosomes and bacterial artificial chromosomes which are capable of accommodating longer portions of DNA.

(77) The plasmid of the present invention comprises a nucleotide sequence capable of encoding the S gene. It may also comprise one or more additional coronavirus nucleotide sequence(s), or nucleotide sequence(s) capable of encoding one or more other coronavirus proteins such as the replicase gene and/or gene 3.

(78) The plasmid may also comprise a resistance marker, such as the guanine xanthine phosphoribosyltransferase gene (gpt) from Escherichia coli, which confers resistance to mycophenolic acid (MPA) in the presence of xanthine and hypoxanthine and is controlled by the vaccinia virus P.sub.7.5 early/late promoter.

(79) Viral Particle

(80) The present invention also relates to a viral particle with an S gene of the present invention. The viral particle may, for example, be a recombinant vaccinia virus (rVV) or a coronavirus.

(81) The viral particle may be recombinant.

(82) The viral particle may be made using a reverse genetics system, such as a vaccinia-virus based reverse genetics system.

(83) Suitable reverse genetics systems are known in the art (Casais et al (2001) J. Virol 75:12359-12369; Casais et al (2003) J. Virol. 77:9084-9089; Britton et al (2005) J. Virological Methods 123:203-211; Armesto et al (2008) Methods in Molecular Biology 454:255-273).

(84) Cell

(85) The viral particle may be used to infect a cell.

(86) Since the viral particle comprising the S gene of the present invention has extended tissue tropism, the cell may be derivable from or a part of a cell line.

(87) The cell may, for example, be a baby hamster kidney cell (e.g. BHK-21) or a Vero cell.

(88) The cell may be used to produce the viral particle.

(89) Thus the present invention also provides a method for producing a viral particle which comprises the following steps: (i) infection of a cell with a viral particle according to the sixth aspect of the invention; (ii) allowing the virus to replicate in the cell; and (iii) harvesting the progeny virus.

(90) The cell may be from or part of a cell line, such as a Vero cell. Viral particles may be harvested, for example from the supernatant by methods known in the art, and optionally purified.

(91) The present invention also provides a cell capable of producing a recombinant viral particle according to the fourth aspect of the invention using a reverse genetics system. For example, the cell may comprise a recombining virus genome comprising a nucleotide sequence capable of encoding the S gene of the present invention.

(92) The cell may be able to produce recombinant recombining virus (e.g. vaccinia virus) containing the S gene. The cell may be a Vero cell.

(93) Alternatively the cell may be capable of producing recombinant coronavirus by a reverse genetics system. The cell may express or be induced to express T7 polymerase in order to rescue the recombinant viral particle. The cell may be a CK cell.

(94) Vaccine

(95) The viral particle may be used to produce a vaccine.

(96) The vaccine may by a live attenuated form of the viral particle.

(97) The present invention also relates to a method for producing such a vaccine which comprises the step of infecting cells, for example Vero cells, with a viral particle comprising a chimaeric protein according to the first aspect of the invention.

(98) Vaccination Method

(99) The viral particle of the present invention may be used to treat and/or prevent a disease.

(100) To treat means to administer the vaccine to a subject having an existing disease in order to lessen, reduce or improve at least one symptom associated with the disease and/or to slow down, reduce or block the progression of the disease.

(101) To prevent means to administer the vaccine to a subject who has not yet contracted the disease and/or who is not showing any symptoms of the disease to prevent or impair the cause of the disease (e.g. infection) or to reduce or prevent development of at least one symptom associated with the disease.

(102) The disease may be caused by infections bronchitis virus.

(103) The disease may be infectious bronchitis (IB).

(104) The vaccine may be administered to hatched chicks or chickens, for example by eye drop or intranasal administration. Although accurate, these methods can be expensive e.g. for large broiler flocks. Alternatives include spray inoculation of administration to drinking water but it can be difficult to ensure uniform vaccine application using such methods.

(105) The vaccine may be provided in a form suitable for its administration, such as an eye-dropper for intra-ocular use.

(106) The vaccine may be administered by the in ovo inoculation, for example by injection of embryonated eggs. In ovo vaccination has the advantage that is provides an early stage resistance to the disease. It also facilitates the administration of a uniform dose per subject, unlike spray inoculation and administration via drinking water.

(107) The vaccine may be administered to any suitable compartment of the egg, including allantoic fluid, yolk sac, amnion, air cell or embryo. It may be administered below the shell (aircell) membrane and chorioallantoic membrane.

(108) Usually the vaccine is injected into embryonated eggs during late stages of embryonic development, generally during the final quarter of the incubation period, such as 3-4 days prior to hatch. In chickens, the vaccine may be administered between day 15-19 of the 21-day incubation period, for example at day 17 or 18.

(109) The process can be automated using a robotic injection process, such as those described in WO 2004/078203.

(110) The vaccine may be administered together with one or more other vaccines, for example, vaccines for other diseases, such as Newcastle disease virus (NDV). The present invention also provides a vaccine composition comprising a vaccine according to the invention together with one or more other vaccine(s). The present invention also provides a kit comprising a vaccine according to the invention together with one or more other vaccine(s) for separate, sequential or simultaneous administration.

(111) The vaccine or vaccine composition of the invention may be used to treat an avian subject. For example, the subject may be a chick or chicken.

(112) Typically, a physician or veterinarian will determine the actual dosage which will be most suitable for an individual subject or group of subjects and it will vary with the age, weight and response of the particular subject(s).

(113) The composition may optionally comprise a pharmaceutically acceptable carrier, diluent, excipient or adjuvant. The choice of pharmaceutical carrier, excipient or diluent can be selected with regard to the intended route of administration and standard pharmaceutical practice. The pharmaceutical compositions may comprise as (or in addition to) the carrier, excipient or diluent, any suitable binder(s), lubricant(s), suspending agent(s), coating agent(s), solubilising agent(s), and other carrier agents that may aid or increase the delivery or immunogenicity of the virus.

(114) The invention will now be further described by way of Examples, which are meant to serve to assist one of ordinary skill in the art in carrying out the invention and are not intended in any way to limit the scope of the invention.

EXAMPLES

Example 1

Generation of Recombinant IBVs Comprising Beaudette-derived Amino Acids

(115) The present inventors have previously shown that the Beaudette-specific motif was able to confer the ability to grow on Vero cells but not to the same extent as the complete Beaudette S2 subunit. In the present inventors' previous work, they replaced the equivalent Beaudette-specific motif sequence in the M41 S2 subunit in BeauR-M41(S) with the Beaudette-specific motif. The resultant rIBV, BeauR-M41-S-BeauR-Hep, was able to grow on Vero cells, however, kinetic studies showed that it did not grow to the same extent as the rIBV expressing an S protein comprising S1 from M41 and a complete S2 from Beaudette.

(116) In the present study, the present inventors investigated whether other Beaudette-specific amino acids may be involved in the acquisition of the ability to grow on Vero cells.

(117) To this end, a series of rIBVs were generated based on BeauR-M41-S-BeauR-Hep in which other Beaudette-derived amino acids were introduced. This was achieved by generating BeauR-M41-S-BeauR-Hep based cDNAs that had the Beaudette-specific amino acids, .sub.578F, .sub.617S, .sub.826S, .sub.857F and .sub.1000I, identified in the Beaudette S2, introduced into the S glycoprotein of rIBV BeauR-M41-S-BeauR-Hep to replace the corresponding M41 amino acids .sub.578L, .sub.617N, .sub.826N, .sub.857L and .sub.1000V.

(118) The changes (M41 to Beaudette) were:

(119) Leucine (L) to Phenylalanine (F) position 578

(120) Asparagine (N) to Serine (S) position 617

(121) Asparagine (N) to Serine (S) position 826

(122) Leucine (L) to Phenylalanine (F) position 857 and

(123) Isoleucine (I) to Valine (V) position 1000

(124) Two separate regions of the M41 S glycoprotein containing the desired amino acid changes were synthesised by Geneart and cloned into the transfer/recombination vector pGPTNEB 193. These were used to introduce the mutations into the BeauR-M41-S-BeauR-Hep full-length cDNA cloned into the vaccinia virus genome using a transient dominant selection (TDS) method for modifying the IBV genome. Recombinant vaccinia viruses were screened to identify isolates containing different combinations of the Beaudette-specific S2 amino acids. A further TDS was carried out to introduce all five Beaudette-specific amino acids into the BeauR-M41-S-BeauR-Hep full-length cDNA. Resultant recombinant vaccinia viruses were screened by sequence analysis to identify IBV cDNA sequences that contained all the Beaudette-specific amino acids.

(125) Infectious rIBVs with different combinations of the Beaudette-specific amino acids in the S2 subunit of the BeauR-M41-S-BeauR-Hep S glycoprotein were then rescued. In order to do this, the recombinant vaccinia viruses containing the BeauR-M41-S-BeauR-Hep cDNA with the modified S2 sequences were semi-purified and the DNA was extracted. Primary CK cells were transfected with the recombinant vaccinia virus DNA to recover the infectious rIBVs, which were subsequently serially passaged three times on CK cells.

(126) Six different rIBVs were rescued with different combinations of mutations as follows:

(127) MSBH-NS-N to S at position 617

(128) MSBH-LFNS-L to F at 578 and N to S at 617

(129) MSBH-IV-I to V at 1000

(130) MSBH-LFIV-L to F at 857 and I to V at 1000

(131) MSBH-NSLFIV-N to S at 826, L to F at 857 and I to V at 1000

(132) MSBH-LFNSNSLFIV-L to F at 578, N to S at 617, N to S at 826, L to F at 857 & I to V at 1000

(133) The growth kinetics of the six rIBVs described above were analysed on CK cells and it was found that variants grew with kinetics similar to the parent virus, rIBV BeauR-M41-S-BeauR-Hep (data not shown).

(134) The rIBVs were serially passaged seven times on Vero cells and the S genes were sequenced.

(135) Sequence analysis showed that, after passage on Vero cells, all six rIBVs had additional amino acid changes when compared to the P3 CKC parental virus, with one amino acid at amino acid position 865 (glutamine (Q) to histidine (H)) common to three viruses. This mutation also occurs in some other viruses, so is thought not to be directly responsible for enhancing growth in Vero cells but it may interact with the other substitutions which were engineered into the M41 S2. The Q to H mutations are thought to have arisen due to growth on Vero cells.

Example 2

Analysing the Growth Kinetics of the rIBVs of Vero Cells

(136) The growth characteristics of the variants on Vero cells were analysed using brightfield microscopy. Growth of the rIBV isolates were compared to rIBV BeauR-M41-S-BeauR-Hep (M41 with the Beaudette motif but no other Beaudette-derived mutations) to determine whether the five amino acids from Beaudette improve the growth kinetics. The results are shown in FIG. 1. All five Beaudette-specific S2 amino acids in the six combinations isolated in the six rIBVs improved the growth of BeauR-M41-S-BeauR-Hep on Vero cells.

(137) The variant rIBV, MSBH-LFNSNSLFIV, that had all five Beaudette-specific amino acids introduced was found to grow the best.

(138) These results show that other S2 Beaudette-specific amino acids in addition to the Beaudette-specific motif are involved in the ability of IBV Beaudette to grow on Vero cells. The introduction of these amino acids can be used to generate rIBVs with an S2 subunit from the parental virus but with relatively few amino acid changes.

(139) In this experiment the rIBVs investigated had been passed 7 times on Vero cells (FIG. 1).

(140) The growth kinetics was also investigated for the rIBVs in Vero cells without previous passage on Vero cells. The results are shown in FIG. 2.

(141) BeauR-M41(S), which comprises the M41 S gene without any Beaudette S2 specific amino acids, does not grow on Vero cells. The IBV strain Beaudette was found to grow the best in this experiment. However, as shown in FIG. 1 following passage on Vero cells some of the rIBVs grow better than Beau-R. The rIBV with the Beaudette-specific motif site only, BeauR-M41-S-BeauR-Hep, does grow Vero cells, but to a lesser extent than Beaudette, even after passage on Vero cells.

(142) However, the variant rIBVs with amino acid mutations showed improved growth after seven passages on Vero cells, most notably: MSBH-LFNS, MSBH-NSLFIV and MSBH-NS.

(143) Interestingly, these three variants at P7-Vero (MSBH-LFNS MSBH-NSLFIV and MSBH-NS) produce a much higher titre than Beau-R at 24 hours post infection. The titre is almost 2 logs (?100 fold) better than Beau-R at 24 hours post infection. The variant sequences therefore offer an added advantage for a vaccine production as they would lead to a greatly increased yield.

(144) All publications mentioned in the above specification are herein incorporated by reference. Various modifications and variations of the described methods and system of the invention will be apparent to those skilled in the art without departing from the scope and spirit of the invention. Although the invention has been described in connection with specific preferred embodiments, it should be understood that the invention as claimed should not be unduly limited to such specific embodiments. Indeed, various modifications of the described modes for carrying out the invention which are obvious to those skilled in molecular biology, virology or related fields are intended to be within the scope of the following claims.