Engineered Artificial Antigen Presenting Cells for Tumor Infiltrating Lymphocyte Expansion
20180127715 ยท 2018-05-10
Inventors
- Anand Veerapathran (Tampa, FL, US)
- Aishwarya Gokuldass (Chennai, IN)
- Brian Rabinovich (Winchester, MA, US)
- Michael T. Lotze (Pittsburgh, PA)
Cpc classification
A61K39/4611
HUMAN NECESSITIES
C12N2501/06
CHEMISTRY; METALLURGY
C07K16/4283
CHEMISTRY; METALLURGY
C07K14/70575
CHEMISTRY; METALLURGY
C12N5/0639
CHEMISTRY; METALLURGY
C12N2501/51
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
International classification
A61P35/00
HUMAN NECESSITIES
C07K14/705
CHEMISTRY; METALLURGY
Abstract
In some embodiments, compositions and methods relating to isolated artificial antigen presenting cells (aAPCs) are disclosed, including aAPCs comprising a myeloid cell transduced with one or more viral vectors, such as a MOLM-14 or a EM-3 myeloid cell, wherein the myeloid cell endogenously expresses HLA-AB/C, ICOS-L, and CD58, and wherein the one or more viral vectors comprise a nucleic acid encoding CD86 and a nucleic acid encoding 4-1BBL and/or OX40L and transduce the myeloid cell to express CD86 and 4-1BBL and/or OX40L proteins. In some embodiments, methods of expanding tumor infiltrating lymphocytes (TILs) with aAPCs and methods of treating cancers using TILs after expansion with aAPCs are also disclosed.
Claims
1. An artificial antigen presenting cell (aAPC) comprising a myeloid cell transduced with one or more viral vectors, wherein the one or more viral vectors comprise a nucleic acid encoding CD86 and one or more nucleic acids encoding a costimulatory molecule, and wherein the myeloid cell expresses a CD86 protein and one or more costimulatory molecules.
2. The aAPC of claim 1, wherein the aAPC can stimulate and expand tumor infiltrating lymphocytes (TILs) contacted with the aAPC.
3. The aAPC of claim 1, wherein the aAPC expands a population of TILs by at least 50-fold over a period of 7 days in a cell culture medium comprising IL-2 at a concentration of about 3000 IU/mL and OKT-3 antibody at a concentration of about 30 ng/mL.
4. The aAPC of claim 1, wherein the aAPC can stimulate and expand a T cell contacted with the aAPC.
5. The aAPC of claim 1, wherein the myeloid cell endogenously expresses HLA-A/B/C, ICOS-L, and CD58.
6. The aAPC of claim 1, wherein the myeloid cell is a MOLM-14 cell.
7. The aAPC of claim 1, wherein the myeloid cell is a EM-3 cell.
8. The aAPC of claim 7, wherein the EM-3 cell is further transduced to express a single chain fragment variable (scFv) binding domain capable of binding the Fc domain of OKT-3 antibody.
9. The aAPC of claim 8, wherein the scFv binding domain comprises clone 7C12 (SEQ ID NO:27) or clone 8B3 (SEQ ID NO:28), or a sequence comprising one or more conservative amino acid substitutions thereof.
10. The aAPC of claim 1, wherein the CD86 protein comprises a sequence as set forth in SEQ ID NO:8, or a sequence comprising one or more conservative amino acid substitutions thereof.
11. The aAPC of claim 1, wherein the nucleic acid encoding CD86 comprises SEQ ID NO:19.
12. The aAPC of claim 1, wherein the one or more costimulatory molecules comprises a 4-1BBL protein.
13. The aAPC of claim 12, wherein the 4-1BBL protein comprises a sequence as set forth in SEQ ID NO:9, or a sequence comprising one or more conservative amino acid substitutions thereof.
14. The aAPC of claim 12, wherein the one or more nucleic acids encoding the 4-1BBL protein comprises SEQ ID NO:16.
15. The aAPC of claim 1, wherein the one or more costimulatory molecules comprises an OX40L protein.
16. The aAPC of claim 15, wherein the OX40L protein comprises a sequence as set forth in SEQ ID NO:10, or a sequence comprising one or more conservative amino acid substitutions thereof.
17. A method of expanding a population of tumor infiltrating lymphocytes (TILs), the method comprising the step of contacting the population of TILs with a population of aAPCs according to claim 1 in a cell culture medium.
18. The method of claim 17, wherein the cell culture medium further comprises IL-2 at an initial concentration of about 3000 IU/mL and OKT-3 antibody at an initial concentration of about 30 ng/mL.
19. The method of claim 17, wherein the population of APCs expands the population of TILs by at least 50-fold over a period of 7 days in a cell culture medium.
20. The method of claim 17, wherein the myeloid cell endogenously expresses HLA-A/B/C, ICOS-L, and CD58.
21. The method of claim 17, wherein the myeloid cell is a MOLM-14 cell.
22. The method of claim 17, wherein the myeloid cell is a EM-3 cell.
23. The method of claim 22, wherein the EM-3 cell is further transduced to express a single chain fragment variable (scFv) binding domain capable of binding the Fc domain of OKT-3 antibody.
24. The method of claim 23, wherein the scFv binding domain comprises clone 7C12 (SEQ ID NO:27) or clone 8B3 (SEQ ID NO:28), or a sequence comprising one or more conservative amino acid substitutions thereof.
25. The method of claim 17, wherein the CD86 protein comprises SEQ ID NO:8, or a sequence comprising one or more conservative amino acid substitutions thereof.
26. The method of claim 17, wherein the nucleic acid encoding CD86 comprises SEQ ID NO:19.
27. The method of claim 17, wherein the one or more costimulatory molecules comprises a 4-1BBL protein.
28. The method of claim 27, wherein the 4-1BBL protein comprises a sequence as set forth in SEQ ID NO:9, or a sequence comprising one or more conservative amino acid substitutions thereof.
29. A method of treating a cancer with a population of tumor infiltrating lymphocytes (TILs) comprising the steps of: (a) obtaining a first population of TILs from a tumor resected from a patient; (b) performing an initial expansion of the first population of TILs in a first cell culture medium to obtain a second population of TILs, wherein the second population of TILs is at least 5-fold greater in number than the first population of TILs, and wherein the first cell culture medium comprises IL-2; (c) performing a rapid expansion of the second population of TILs using a population of myeloid artificial antigen presenting cells (myeloid aAPCs) in a second cell culture medium to obtain a third population of TILs, wherein the third population of TILs is at least 50-fold greater in number than the second population of TILs after 7 days from the start of the rapid expansion; and wherein the second cell culture medium comprises IL-2 and OKT-3; (d) administering a therapeutically effective portion of the third population of TILs to a patient with the cancer.
30. An artificial antigen presenting cell (aAPC) comprising a myeloid cell genetically engineered to express CD86 and one or more costimulatory molecules selected from the group consisting of 4-1BBL, OX40L, and a combination thereof.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0242] The foregoing summary, as well as the following detailed description of the invention, will be better understood when read in conjunction with the appended drawings.
[0243]
[0244]
[0245]
[0246]
[0247]
[0248]
[0249]
[0250]
[0251]
[0252]
[0253]
[0254]
[0255]
[0256]
[0257]
[0258]
[0259]
[0260]
[0261]
[0262]
[0263]
[0264]
[0265]
[0266]
[0267]
[0268]
[0269]
[0270]
[0271]
[0272]
[0273]
[0274]
[0275]
[0276]
[0277]
[0278]
[0279]
[0280]
[0281]
[0282]
[0283]
[0284]
[0285]
[0286]
[0287]
[0288]
[0289]
[0290]
[0291]
[0292]
[0293]
[0294]
[0295]
[0296]
[0297]
[0298]
[0299]
[0300]
[0301]
[0302]
[0303]
[0304]
[0305]
[0306]
[0307]
[0308]
[0309]
[0310]
[0311]
[0312]
[0313]
[0314]
[0315]
[0316]
[0317]
[0318]
[0319]
[0320]
[0321]
[0322]
[0323]
[0324]
[0325]
[0326]
[0327]
[0328]
[0329]
[0330]
[0331]
[0332]
[0333]
[0334]
[0335]
[0336]
[0337]
[0338]
BRIEF DESCRIPTION OF THE SEQUENCE LISTING
[0339] SEQ ID NO:1 is an amino acid sequence for the heavy chain of muromonab.
[0340] SEQ ID NO:2 is an amino acid sequence for the light chain of muromonab.
[0341] SEQ ID NO:3 is an amino acid sequence for recombinant human IL-2.
[0342] SEQ ID NO:4 is an amino acid sequence for aldesleukin.
[0343] SEQ ID NO:5 is an amino acid sequence for recombinant human IL-7.
[0344] SEQ ID NO:6 is an amino acid sequence for recombinant human IL-15.
[0345] SEQ ID NO:7 is an amino acid sequence for recombinant IL-21.
[0346] SEQ ID NO:8 is the amino acid sequence of human CD86.
[0347] SEQ ID NO:9 is the amino acid sequence of human 4-1BBL (CD137L).
[0348] SEQ ID NO:10 is the amino acid sequence of human OX40L (CD134L).
[0349] SEQ ID NO:11 is the amino acid sequence of human CD28.
[0350] SEQ ID NO:12 is the amino acid sequence of human CTLA-4.
[0351] SEQ ID NO:13 is the amino acid sequence of human 4-1BB (CD137).
[0352] SEQ ID NO:14 is the amino acid sequence of human OX40 (CD134).
[0353] SEQ ID NO:15 is a nucleotide sequence for the pLV430G 4-1BBL empty vector.
[0354] SEQ ID NO:16 is a nucleotide sequence for the 4-1BBL CoOP portion of the pLV430G human 4-1BBL vector.
[0355] SEQ ID NO:17 is a nucleotide sequence for the 4-1BBL PCRP.
[0356] SEQ ID NO:18 is a nucleotide sequence for the pLV430G hCD86 empty vector.
[0357] SEQ ID NO:19 is a nucleotide sequence for the hCD86 CoOP portion of the pLV430G human hCD86 vector.
[0358] SEQ ID NO:20 is a nucleotide sequence for the hCD86 CoOP B1 B2 PCRP portion of the pLV430G human hCD86 vector.
[0359] SEQ ID NO:21 is a nucleotide sequence for the pDONR221 hCD86 vector.
[0360] SEQ ID NO:22 is a nucleotide sequence for the pDONR221 4-1BBL vector.
[0361] SEQ ID NO:23 is a nucleotide sequence for the pLV430G vector.
[0362] SEQ ID NO:24 is a nucleotide sequence for the pDONR221 vector.
[0363] SEQ ID NO:25 is a nucleotide sequence for the psPAX2 helper plasmid for lentiviral production.
[0364] SEQ ID NO:26 is a nucleotide sequence for the pCIGO-VSV.G helper plasmid for lentiviral production.
[0365] SEQ ID NO:27 is the amino acid sequence of the mFc-7C12 scFv clone.
[0366] SEQ ID NO:28 is the amino acid sequence of the mFc-8B3 scFv clone.
[0367] SEQ ID NO:29 is a nucleotide sequence for the mFC-7C12 scFv.
[0368] SEQ ID NO:30 is a nucleotide sequence for the mFC-8B3 scFv.
[0369] SEQ ID NO:31 is a nucleotide sequence for the destination vector pLV4301G.
[0370] SEQ ID NO:32 is a nucleotide sequence for the donor vector 1, pMK 7c12 anti mFC scFv CoOp ECORV SacII L1R5.
[0371] SEQ ID NO:33 is a nucleotide sequence for the donor vector 2, pMK hCD8a scaffold TN L5 L2.
[0372] SEQ ID NO:34 is a nucleotide sequence for the final vector used for lentiviral production, pLV4301G 7C12 scFv mIgG hCD8 flag.
[0373] SEQ ID NO:35 is a nucleotide sequence for the destination vector, pLV4301G.
[0374] SEQ ID NO:36 is a nucleotide sequence for the donor vector 1, pMK 8B3 anti mFC scFv CoOp ECORV SacII L1R5.
[0375] SEQ ID NO:37 is a nucleotide sequence for the donor vector 2, pMK hCD8a scaffold TN L5 L2.
[0376] SEQ ID NO:38 is a nucleotide sequence for the final vector used for lentiviral production, pLV4301G 8B3 scFv mIgG hCD8 flag.
[0377] SEQ ID NO:39 is a nucleotide sequence for pLenti-C-Myc-DDK OX40L vector for lentiviral production.
[0378] SEQ ID NO:40 is a nucleotide sequence for Tel-1b primer used for quantitative polymerase chain reaction measurements of telomere length.
[0379] SEQ ID NO:41 is a nucleotide sequence for Tel -2b primer used for quantitative polymerase chain reaction measurements of telomere length.
[0380] SEQ ID NO:42 is a nucleotide sequence for Tel-1b primer used for quantitative polymerase chain reaction measurements of telomere length.
[0381] SEQ ID NO:43 is a nucleotide sequence for Tel-1b primer used for quantitative polymerase chain reaction measurements of telomere length.
DETAILED DESCRIPTION OF THE INVENTION
[0382] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as is commonly understood by one of skill in the art to which this invention belongs. All patents and publications referred to herein are incorporated by reference in their entireties.
Definitions
[0383] The terms co-administration, co-administering, administered in combination with, administering in combination with, simultaneous, and concurrent, as used herein, encompass administration of two or more active pharmaceutical ingredients to a human subject so that both active pharmaceutical ingredients and/or their metabolites are present in the human subject at the same time. Co-administration includes simultaneous administration in separate compositions, administration at different times in separate compositions, or administration in a composition in which two or more active pharmaceutical ingredients are present. Simultaneous administration in separate compositions and administration in a composition in which both agents are present is also encompassed in the methods of the invention.
[0384] The term in vivo refers to an event that takes place in a subject's body.
[0385] The term in vitro refers to an event that takes places outside of a subject's body. In vitro assays encompass cell-based assays in which cells alive or dead are employed and may also encompass a cell-free assay in which no intact cells are employed.
[0386] The term ex vivo refers to an event which involves treating or performing a procedure on a cell, tissue and/or organ which has been removed from a subject's body. Aptly, the cell, tissue and/or organ may be returned to the subject's body in a method of surgery or treatment.
[0387] The term antigen refers to a substance that induces an immune response. In some embodiments, an antigen is a molecule capable of being bound by an antibody or a T cell receptor (TCR) if presented by major histocompatibility complex (MEW) molecules. The term antigen, as used herein, also encompasses T cell epitopes. An antigen is additionally capable of being recognized by the immune system. In some embodiments, an antigen is capable of inducing a humoral immune response or a cellular immune response leading to the activation of B lymphocytes and/or T lymphocytes. In some cases, this may require that the antigen contains or is linked to a Th cell epitope. An antigen can also have one or more epitopes (e.g., B- and T-epitopes). In some embodiments, an antigen will preferably react, typically in a highly specific and selective manner, with its corresponding antibody or TCR and not with the multitude of other antibodies or TCRs which may be induced by other antigens.
[0388] The term effective amount or therapeutically effective amount refers to that amount of a compound or combination of compounds as described herein that is sufficient to effect the intended application including, but not limited to, disease treatment. A therapeutically effective amount may vary depending upon the intended application (in vitro or in vivo), or the human subject and disease condition being treated (e.g., the weight, age and gender of the subject), the severity of the disease condition, the manner of administration, etc. which can readily be determined by one of ordinary skill in the art. The term also applies to a dose that will induce a particular response in target cells (e.g., the reduction of platelet adhesion and/or cell migration). The specific dose will vary depending on the particular compounds chosen, the dosing regimen to be followed, whether the compound is administered in combination with other compounds, timing of administration, the tissue to which it is administered, and the physical delivery system in which the compound is carried.
[0389] A therapeutic effect as that term is used herein, encompasses a therapeutic benefit and/or a prophylactic benefit in a human subject. A prophylactic effect includes delaying or eliminating the appearance of a disease or condition, delaying or eliminating the onset of symptoms of a disease or condition, slowing, halting, or reversing the progression of a disease or condition, or any combination thereof.
[0390] Pharmaceutically acceptable carrier or pharmaceutically acceptable excipient is intended to include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and inert ingredients. The use of such pharmaceutically acceptable carriers or pharmaceutically acceptable excipients for active pharmaceutical ingredients is well known in the art. Except insofar as any conventional pharmaceutically acceptable carrier or pharmaceutically acceptable excipient is incompatible with the active pharmaceutical ingredient, its use in the therapeutic compositions of the invention is contemplated. Additional active pharmaceutical ingredients, such as other drugs, can also be incorporated into the described compositions and methods.
[0391] The term rapid expansion means an increase in the number of antigen-specific TILs of at least about 3-fold (or 4-, 5-, 6-, 7-, 8-, or 9-fold) over a period of a week, more preferably at least about 10-fold (or 20-, 30-, 40-, 50-, 60-, 70-, 80-, or 90-fold) over a period of a week, or most preferably at least about 100-fold over a period of a week. A number of rapid expansion protocols are described herein.
[0392] By tumor infiltrating lymphocytes or TILs herein is meant a population of cells originally obtained as white blood cells that have left the bloodstream of a subject and migrated into a tumor. TILs include, but are not limited to, CD8.sup.+ cytotoxic T cells (lymphocytes), Th1 and Th17 CD4.sup.+ T cells, natural killer cells, dendritic cells and M1 macrophages. TILs include both primary and secondary TILs. Primary TILs are those that are obtained from patient tissue samples as outlined herein (sometimes referred to herein as freshly harvested or a first population of TILs), and secondary TILs are any TIL cell populations that have been expanded or proliferated as discussed herein, including, but not limited to bulk TILs and expanded TILs (REP TILs or post-REP TILs, or second population of TILs or third population of TILs where appropriate).
[0393] TILs can generally be defined either biochemically, using cell surface markers, or functionally, by their ability to infiltrate tumors and effect treatment. TILs can be generally categorized by expressing one or more of the following biomarkers: CD4, CD8, TCR ??, CD27, CD28, CD56, CCR7, CD45Ra, CD95, PD-1, and CD25. Additionally, and alternatively, TILs can be functionally defined by their ability to infiltrate solid tumors upon reintroduction into a patient.
[0394] By cryopreserved TILs herein is meant that TILs are treated and stored in the range of about ?150? C. to ?60? C. General methods for cryopreservation are also described elsewhere herein, including in the Examples. For clarity, cryopreserved TILs are distinguishable from frozen tissue samples which may be used as a source of primary TILs.
[0395] By thawed cryopreserved TILs herein is meant a population of TILs that was previously cryopreserved and then treated to return to room temperature or higher, including but not limited to cell culture temperatures or temperatures wherein TILs may be administered to a patient.
[0396] By population of cells (including TILs) herein is meant a number of cells that share common traits.
[0397] The term central memory T cell refers to a subset of T cells that in the human are CD45R0+ and constitutively express CCR7 (CCR7.sup.hi) and CD62L (CD62.sup.hi). The surface phenotype of central memory T cells also includes TCR, CD3, CD127 (IL-7R), and IL-15R. Transcription factors for central memory T cells include BCL-6, BCL-6B, MBD2, and BMI1. Central memory T cells primarily secret IL-2 and CD40L as effector molecules after TCR triggering. Central memory T cells are predominant in the CD4 compartment in blood, and in the human are proportionally enriched in lymph nodes and tonsils.
[0398] The term effector memory T cell refers to a subset of human or mammalian T cells that, like central memory T cells, are CD45R0+, but have lost the constitutive expression of CCR7 (CCR7.sup.lo) and are heterogeneous or low for CD62L expression (CD62L.sup.lo). The surface phenotype of central memory T cells also includes TCR, CD3, CD127 (IL-7R), and IL-15R. Transcription factors for central memory T cells include BLIMP1. Effector memory T cells rapidly secret high levels of inflammatory cytokines following antigenic stimulation, including interferon-?, IL-4, and IL-5. Effector memory T cells are predominant in the CD8 compartment in blood, and in the human are proportionally enriched in the lung, liver, and gut. CD8+ effector memory T cells carry large amounts of perforin.
[0399] The terms sequence identity, percent identity, and sequence percent identity in the context of two or more nucleic acids or polypeptides, refer to two or more sequences or subsequences that are the same or have a specified percentage of nucleotides or amino acid residues that are the same, when compared and aligned (introducing gaps, if necessary) for maximum correspondence, not considering any conservative amino acid substitutions as part of the sequence identity. The percent identity can be measured using sequence comparison software or algorithms or by visual inspection. Various algorithms and software are known in the art that can be used to obtain alignments of amino acid or nucleotide sequences. Suitable programs to determine percent sequence identity include for example the BLAST suite of programs available from the U.S. Government's National Center for Biotechnology Information BLAST web site. Comparisons between two sequences can be carried using either the BLASTN or BLASTP algorithm. BLASTN is used to compare nucleic acid sequences, while BLASTP is used to compare amino acid sequences. ALIGN, ALIGN-2 (Genentech, South San Francisco, Calif.) or MegAlign, available from DNASTAR, are additional publicly available software programs that can be used to align sequences. One skilled in the art can determine appropriate parameters for maximal alignment by particular alignment software. In certain embodiments, the default parameters of the alignment software are used.
[0400] The term conservative amino acid substitutions means amino acid sequence modifications which do not abrogate the binding of an antibody to an antigen or a protein to its ligand. Conservative amino acid substitutions include the substitution of an amino acid in one class by an amino acid of the same class, where a class is defined by common physicochemical amino acid side chain properties and high substitution frequencies in homologous proteins found in nature, as determined, for example, by a standard Dayhoff frequency exchange matrix or BLOSUM matrix. Six general classes of amino acid side chains have been categorized and include: Class I (Cys); Class II (Ser, Thr, Pro, Ala, Gly); Class III (Asn, Asp, Gln, Glu); Class IV (His, Arg, Lys); Class V (Ile, Leu, Val, Met); and Class VI (Phe, Tyr, Trp). For example, substitution of an Asp for another class III residue such as Asn, Gln, or Glu, is a conservative substitution. Thus, a predicted nonessential amino acid residue in a 4-1BBL or CD86 protein is preferably replaced with another amino acid residue from the same class. Methods of identifying amino acid conservative substitutions which do not eliminate antigen or ligand binding are well-known in the art (see, e.g., Brummell, et al., Biochemistry 1993, 32, 1180-1187; Kobayashi, et al., Protein Eng. 1999, 12, 879-884 (1999); and Burks, et al., Proc. Natl. Acad. Sci. USA 1997, 94, 412-417).
[0401] The term retrovirus refers to RNA viruses that utilize reverse transcriptase during their replication cycle, wherein retroviral genomic RNA is converted into double-stranded DNA by reverse transcriptase. The double-stranded DNA form is integrated into the chromosome of the infected cell (a provirus). The provirus serves as a template for RNA polymerase II and directs the expression of RNA molecules which encode the structural proteins and enzymes needed to produce new viral particles. At each end of the provirus are structures called long terminal repeats or LTRs. The LTR contains numerous regulatory signals including transcriptional control elements, polyadenylation signals and sequences needed for replication and integration of the viral genome. Several genera included within the family Retroviridae, including Cisternavirus A, Oncovirus A, Oncovirus B, Oncovirus C, Oncovirus D, Lentivirus, Gammaretrovirus, and Spumavirus. Some of the retroviruses are oncogenic (i.e., tumorigenic), while others are not. The oncoviruses induce sarcomas, leukemias, lymphomas, and mammary carcinomas in susceptible species. Retroviruses infect a wide variety of species, and may be transmitted both horizontally and vertically. Because they are integrated into the host DNA, they are capable of transmitting sequences of host DNA from cell to cell. Example gammaretroviral vectors include those derived from the amphotropic Moloney murine leukemia virus (MLV-A), which use cell surface phosphate transporter receptors for entry and then permanently integrate into proliferating cell chromosomes. The amphotropic MLV vector system has been well established and is a popular tool for gene delivery (See, e.g., Gordon and Anderson, Curr. Op. Biotechnol., 1994, 5, 611-616 and Miller, et al., Meth. Enzymol., 1993, 217, 581-599, the disclosures of which are incorporated herein by reference.
[0402] The term lentivirus refers to a genus that includes HIV (human immunodeficiency virus; including HIV type 1, and HIV type 2), visna-maedi, which causes encephalitis (visna) or pneumonia (maedi) in sheep, the caprine arthritis-encephalitis virus, which causes immune deficiency, arthritis, and encephalopathy in goats; equine infectious anemia virus, which causes autoimmune hemolytic anemia, and encephalopathy in horses; feline immunodeficiency virus (FIV), which causes immune deficiency in cats; bovine immune deficiency virus (BIV), which causes lymphadenopathy, lymphocytosis, and possibly central nervous system infection in cattle; and simian immunodeficiency virus (SIV), which cause immune deficiency and encephalopathy in sub-human primates. Diseases caused by these viruses are characterized by a long incubation period and protracted course. Usually, the viruses latently infect monocytes and macrophages, from which they spread to other cells. HIV, FIV, and SIV also readily infect T lymphocytes (i.e., T cells).
[0403] The term anti-CD3 antibody refers to an antibody or variant thereof, e.g., a monoclonal antibody and including human, humanized, chimeric or murine antibodies which are directed against the CD3 receptor in the T cell antigen receptor of mature T cells. Anti-CD3 antibodies include OKT-3, also known as muromonab. Anti-CD3 antibodies also include the UHCT1 clone, also known as T3 and CD3c. Other anti-CD3 antibodies include, for example, otelixizumab, teplizumab, and visilizumab.
[0404] The term OKT-3 (also referred to herein as OKT3) refers to a monoclonal antibody or variant thereof, including human, humanized, chimeric, or murine antibodies, directed against the CD3 receptor in the T cell antigen receptor of mature T cells, and includes commercially-available forms such as OKT-3 (30 ng/mL, MACS GMP CD3 pure, Miltenyi Biotec GmbH, Bergisch Gladbach, Germany) and muromonab or variants, conservative amino acid substitutions, glycoforms, or biosimilars thereof. The amino acid sequences of the heavy and light chains of muromonab are given in Table 1 (SEQ ID NO:1 and SEQ ID NO:2). A hybridoma capable of producing OKT-3 is deposited with the American Type Culture Collection and assigned the ATCC accession number CRL 8001. A hybridoma capable of producing OKT-3 is also deposited with European Collection of Authenticated Cell Cultures (ECACC) and assigned Catalogue No. 86022706.
TABLE-US-00001 TABLE1 Aminoacidsequencesofmuromonab. Identifier (Description) Sequence(One-LetterAminoAcidSymbols) SEQIDNO:1 QVQLQQSGAELARPGASVKMSCHASGYTFTRYTMHWVKQRPGQGLEWIGYINPSRGYTNY 60 (Muromonab NQHFKDKATLTTDKSSSTAYMQLSSLTSEDSAVYYCARYYDDHYCLDYWGQGTTLTVSSA 120 heavychain) KTTAPSVYPLAPVCGGTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDL 180 YTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRPKSCDKTHTCPPCPAPELLGG 240 PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN 300 STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKARGQPREPQVYTLPPSRDE 360 LTKNQVSLTCLVEGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW 420 QQGNVFSCSVMHEALHNHYTQKSLSLSPGK 450 SEQIDNO:2 QIVLTQSPAIMSASPGEKVTMTCSASSSVSYMNWYQQKSGTSPKRWIYDTSKLASGVPAH 60 (Muromonab FRGSGSGTSYSLTISGMEAEDAATYYCQQWSSNPFTFGSGTKLEINRADTAPTVSIFPPS 120 lightchain) SEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTL 180 TKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC 213
[0405] The term IL-2 (also referred to herein as IL2) refers to the T cell growth factor known as interleukin-2, and includes all forms of IL-2 including human and mammalian forms, conservative amino acid substitutions, glycoforms, biosimilars, and variants thereof. IL-2 is described, e.g., in Nelson, J. Immunol. 2004, 172, 3983-88 and Malek, Annu. Rev. Immunol. 2008, 26, 453-79, the disclosures of which are incorporated by reference herein. The amino acid sequence of recombinant human IL-2 suitable for use in the invention is given in Table 2 (SEQ ID NO:3). For example, the term IL-2 encompasses human, recombinant forms of IL-2 such as aldesleukin (PROLEUKIN, available commercially from multiple suppliers in 22 million IU per single use vials), as well as the form of recombinant IL-2 commercially supplied by CellGenix, Inc., Portsmouth, N.H., USA (CELLGRO GMP) or ProSpec-Tany TechnoGene Ltd., East Brunswick, N.J., USA (Cat. No. CYT-209-b) and other commercial equivalents from other vendors. Aldesleukin (des-alanyl-1, serine-125 human IL-2) is a nonglycosylated human recombinant form of IL-2 with a molecular weight of approximately 15 kDa. The amino acid sequence of aldesleukin suitable for use in the invention is given in Table 2 (SEQ ID NO:4). The term IL-2 also encompasses pegylated forms of IL-2, as described herein, including the pegylated IL2 prodrug NKTR-214, available from Nektar Therapeutics, South San Francisco, Calif., USA. NKTR-214 and pegylated IL-2 suitable for use in the invention is described in U.S. Patent Application Publication No. US 2014/0328791 A1 and International Patent Application Publication No. WO 2012/065086 A1, the disclosures of which are incorporated by reference herein. Alternative forms of conjugated IL-2 suitable for use in the invention are described in U.S. Pat. Nos. 4,766,106, 5,206,344, 5,089,261 and 4902,502, the disclosures of which are incorporated by reference herein. Formulations of IL-2 suitable for use in the invention are described in U.S. Pat. No. 6,706,289, the disclosure of which is incorporated by reference herein.
[0406] The term IL-7 (also referred to herein as IL7) refers to a glycosylated tissue-derived cytokine known as interleukin 7, which may be obtained from stromal and epithelial cells, as well as from dendritic cells. Fry and Mackall, Blood 2002, 99, 3892-904. IL-7 can stimulate the development of T cells. IL-7 binds to the IL-7 receptor, a heterodimer consisting of IL-7 receptor alpha and common gamma chain receptor, which in a series of signals important for T cell development within the thymus and survival within the periphery. Recombinant human IL-7 suitable for use in the invention is commercially available from multiple suppliers, including ProSpec-Tany TechnoGene Ltd., East Brunswick, N.J., USA (Cat. No. CYT-254) and ThermoFisher Scientific, Inc., Waltham, Mass., USA (human IL-7 recombinant protein, Cat. No. Gibco PHC0071). The amino acid sequence of recombinant human IL-7 suitable for use in the invention is given in Table 2 (SEQ ID NO:5).
[0407] The term IL-15 (also referred to herein as IL15) refers to the T cell growth factor known as interleukin-15, and includes all forms of IL-2 including human and mammalian forms, conservative amino acid substitutions, glycoforms, biosimilars, and variants thereof. IL-15 is described, e.g., in Fehniger and Caligiuri, Blood 2001, 97, 14-32, the disclosure of which is incorporated by reference herein. IL-15 shares 0 and y signaling receptor subunits with IL-2. Recombinant human IL-15 is a single, non-glycosylated polypeptide chain containing 114 amino acids (and an N-terminal methionine) with a molecular mass of 12.8 kDa. Recombinant human IL-15 is commercially available from multiple suppliers, including ProSpec-Tany TechnoGene Ltd., East Brunswick, N.J., USA (Cat. No. CYT-230-b) and ThermoFisher Scientific, Inc., Waltham, Mass., USA (human IL-15 recombinant protein, Cat. No. 34-8159-82). The amino acid sequence of recombinant human IL-15 suitable for use in the invention is given in Table 2 (SEQ ID NO:6).
[0408] The term IL-21 (also referred to herein as IL21) refers to the pleiotropic cytokine protein known as interleukin-21, and includes all forms of IL-21 including human and mammalian forms, conservative amino acid substitutions, glycoforms, biosimilars, and variants thereof. IL-21 is described, e.g., in Spolski and Leonard, Nat. Rev. Drug. Disc. 2014, 13, 379-95, the disclosure of which is incorporated by reference herein. IL-21 is primarily produced by natural killer T cells and activated human CD4.sup.+ T cells. Recombinant human IL-21 is a single, non-glycosylated polypeptide chain containing 132 amino acids with a molecular mass of 15.4 kDa. Recombinant human IL-21 is commercially available from multiple suppliers, including ProSpec-Tany TechnoGene Ltd., East Brunswick, N.J., USA (Cat. No. CYT-408-b) and ThermoFisher Scientific, Inc., Waltham, Mass., USA (human IL-21 recombinant protein, Cat. No. 14-8219-80). The amino acid sequence of recombinant human IL-21 suitable for use in the invention is given in Table 2 (SEQ ID NO:7).
TABLE-US-00002 TABLE2 Aminoacidsequencesofinterleukins. Identifier (Description) Sequence(One-LetterAminoAcidSymbols) SEQIDNO:3 MAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKATELKHLQCL 60 (recombinant EEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSETTFMCEYADETATIVEFLN 120 humanIL-2 RWITFCQSIISTLT 134 (rhIL-2)) SEQIDNO:4 PTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKATELKHLQCLEE 60 (aldesleukin) ELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSETTFMCEYADETATIVEFLNRW 120 ITFSQSIISTLT 132 SEQIDNO:5 MDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRA 60 (recombinant ARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTHSLEENKSL 120 humanIL-7 KEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH 153 (rhIL-7)) SEQIDNO:6 MNWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASI 60 (recombinant HDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS 115 humanIL-15 (rhIL-15)) SEQIDNO:7 MQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTG 60 (recombinant NNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQHMIHQ 120 humanIL-21 HLSSRTHGSEDS 132 (rhIL-21))
[0409] The term myeloid cell as used herein refers to cells of the myeloid lineage or derived therefrom. The myeloid lineage includes a number of morphologically, phenotypically, and functionally distinct cell types including different subsets of granulocytes (neutrophils, eosinophils, and basophils), monocytes, macrophages, erythrocytes, megakaryocytes, and mast cells. In certain embodiments, the myeloid cell is a cell derived from a cell line of myeloid lineage.
[0410] MOLM-14 refers to a human leukemia cell line which was established from the peripheral blood of a patient with relapsed acute monocytic leukemia, and initial phenotypic characterization indicated the presence of at least the following markers: CD4, CD9, CD11 a, CD13, CD14, CD15, CD32, CD33, CD64, CD65, CD87, CD92, CD93, CD116, CD118, and CD155. Matsuo, et al., Leukemia 1997, 11, 1469-77. Additional phenotypic characterization of MOLM-14 found higher levels of HLA-A/B/C, CD64, CD80, ICOS-L, CD58, and lower levels of CD86. The MOLM-14 cell line is deposited at DSMZ under Accession No. ACC777. The closely related MOLM-13 cell line is deposited at DSMZ under Accession No. ACC554. As used herein the term MOLM-14 cell refers to a MOLM-14 cell and/or a cell derived from the deposited MOLM-14 parental cell line. As used herein the term MOLM-13 cell refers to a MOLM-13 cell and/or a cell derived from the deposited MOLM-13 parental cell line.
[0411] EM-3 refers to a human cell line was established from the bone marrow of a patient with Philadelphia chromosome-positive CIVIL. Konopka, et al., Proc. Nat'l Acad. Sci. USA 1985, 82, 1810-4. Phenotypic characterization for EM-3 cells indicates the presence of at least the following markers: CD13, CD15, and CD33. The EM-3 cell line is deposited at DSMZ under Accession No. ACC134 whilst the closely related EM-2 cell line is deposited at DSMZ under Accession No. ACC135. As used herein the term EM-3 cell refers to a EM-3 cell and/or a cell derived from the deposited EM-3 parental cell line.
[0412] As used herein, the term a CD86 protein may refer to a protein comprising an amino acid sequence as set forth in SEQ ID NO:8 or a protein comprising an amino acid sequence having at least 90% sequence identity to the amino acid sequence depicted in SEQ ID NO:8, e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%.
[0413] As used herein, the term 4-1BBL or CD137L may refer to a protein comprising an amino acid sequence as set forth in SEQ ID NO:9 or a protein comprising an amino acid sequence having at least 90% sequence identity to the amino acid sequence depicted in SEQ ID NO:9, e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%.
[0414] As used herein, the term OX40L or CD137L may refer to a protein comprising an amino acid sequence as set forth in SEQ ID NO:10 or a protein comprising an amino acid sequence having at least 90% sequence identity to the amino acid sequence depicted in SEQ ID NO:10, e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%.
[0415] The term biosimilar means a biological product, including a monoclonal antibody or fusion protein, that is highly similar to a U.S. licensed reference biological product notwithstanding minor differences in clinically inactive components, and for which there are no clinically meaningful differences between the biological product and the reference product in terms of the safety, purity, and potency of the product. Furthermore, a similar biological or biosimilar medicine is a biological medicine that is similar to another biological medicine that has already been authorized for use by the European Medicines Agency. The term biosimilar is also used synonymously by other national and regional regulatory agencies. Biological products or biological medicines are medicines that are made by or derived from a biological source, such as a bacterium or yeast. They can consist of relatively small molecules such as human insulin or erythropoietin, or complex molecules such as monoclonal antibodies. For example, if the reference IL-2 protein is aldesleukin (PROLEUKIN), a protein approved by drug regulatory authorities with reference to aldesleukin is a biosimilar to aldesleukin or is a biosimilar thereof of aldesleukin. In Europe, a similar biological or biosimilar medicine is a biological medicine that is similar to another biological medicine that has already been authorized for use by the European Medicines Agency (EMA). The relevant legal basis for similar biological applications in Europe is Article 6 of Regulation (EC) No 726/2004 and Article 10(4) of Directive 2001/83/EC, as amended and therefore in Europe, the biosimilar may be authorized, approved for authorization or subject of an application for authorization under Article 6 of Regulation (EC) No 726/2004 and Article 10(4) of Directive 2001/83/EC. The already authorized original biological medicinal product may be referred to as a reference medicinal product in Europe. Some of the requirements for a product to be considered a biosimilar are outlined in the CHMP Guideline on Similar Biological Medicinal Products. In addition, product specific guidelines, including guidelines relating to monoclonal antibody biosimilars, are provided on a product-by-product basis by the EMA and published on its website. A biosimilar as described herein may be similar to the reference medicinal product by way of quality characteristics, biological activity, mechanism of action, safety profiles and/or efficacy. In addition, the biosimilar may be used or be intended for use to treat the same conditions as the reference medicinal product. Thus, a biosimilar as described herein may be deemed to have similar or highly similar quality characteristics to a reference medicinal product. Alternatively, or in addition, a biosimilar as described herein may be deemed to have similar or highly similar biological activity to a reference medicinal product. Alternatively, or in addition, a biosimilar as described herein may be deemed to have a similar or highly similar safety profile to a reference medicinal product. Alternatively, or in addition, a biosimilar as described herein may be deemed to have similar or highly similar efficacy to a reference medicinal product. As described herein, a biosimilar in Europe is compared to a reference medicinal product which has been authorized by the EMA. However, in some instances, the biosimilar may be compared to a biological medicinal product which has been authorized outside the European Economic Area (a non-EEA authorized comparator) in certain studies. Such studies include for example certain clinical and in vivo non-clinical studies. As used herein, the term biosimilar also relates to a biological medicinal product which has been or may be compared to a non-EEA authorized comparator. Certain biosimilars are proteins such as antibodies, antibody fragments (for example, antigen binding portions) and fusion proteins. A protein biosimilar may have an amino acid sequence that has minor modifications in the amino acid structure (including for example deletions, additions, and/or substitutions of amino acids) which do not significantly affect the function of the polypeptide. The biosimilar may comprise an amino acid sequence having a sequence identity of 97% or greater to the amino acid sequence of its reference medicinal product, e.g., 97%, 98%, 99% or 100%. The biosimilar may comprise one or more post-translational modifications, for example, although not limited to, glycosylation, oxidation, deamidation, and/or truncation which is/are different to the post-translational modifications of the reference medicinal product, provided that the differences do not result in a change in safety and/or efficacy of the medicinal product. The biosimilar may have an identical or different glycosylation pattern to the reference medicinal product. Particularly, although not exclusively, the biosimilar may have a different glycosylation pattern if the differences address or are intended to address safety concerns associated with the reference medicinal product. Additionally, the biosimilar may deviate from the reference medicinal product in for example its strength, pharmaceutical form, formulation, excipients and/or presentation, providing safety and efficacy of the medicinal product is not compromised. The biosimilar may comprise differences in for example pharmacokinetic (PK) and/or pharmacodynamic (PD) profiles as compared to the reference medicinal product but is still deemed sufficiently similar to the reference medicinal product as to be authorized or considered suitable for authorization. In certain circumstances, the biosimilar exhibits different binding characteristics as compared to the reference medicinal product, wherein the different binding characteristics are considered by a Regulatory Authority such as the EMA not to be a barrier for authorization as a similar biological product. The term biosimilar is also used synonymously by other national and regional regulatory agencies.
[0416] As used herein, the term variant encompasses but is not limited to proteins, antibodies or fusion proteins which comprise an amino acid sequence which differs from the amino acid sequence of a reference protein or antibody by way of one or more substitutions, deletions and/or additions at certain positions within or adjacent to the amino acid sequence of the reference protein or antibody. The variant may comprise one or more conservative substitutions in its amino acid sequence as compared to the amino acid sequence of a reference protein or antibody. Conservative substitutions may involve, e.g., the substitution of similarly charged or uncharged amino acids. The variant retains the ability to specifically bind to the antigen of the reference protein or antibody. The term variant also includes pegylated antibodies or proteins.
[0417] Pegylation refers to a modified antibody, or a fragment thereof, or protein that typically is reacted with polyethylene glycol (PEG), such as a reactive ester or aldehyde derivative of PEG, under conditions in which one or more PEG groups become attached to the antibody, antibody fragment, or protein. Pegylation may, for example, increase the biological (e.g., serum) half life of the antibody or protein. Preferably, the pegylation is carried out via an acylation reaction or an alkylation reaction with a reactive PEG molecule (or an analogous reactive water-soluble polymer). As used herein, the term polyethylene glycol is intended to encompass any of the forms of PEG that have been used to derivatize other proteins, such as mono (C.sub.1-C.sub.10) alkoxy- or aryloxy-polyethylene glycol or polyethylene glycol-maleimide. The antibody or protein to be pegylated may be an aglycosylated antibody. Methods for pegylation are known in the art and can be applied to the antibodies and proteins described herein, as described for example in European Patent Nos. EP 0154316 and EP 0401384.
[0418] The terms about and approximately mean within a statistically meaningful range of a value. Such a range can be within an order of magnitude, preferably within 50%, more preferably within 20%, more preferably still within 10%, and even more preferably within 5% of a given value or range. The allowable variation encompassed by the terms about or approximately depends on the particular system under study, and can be readily appreciated by one of ordinary skill in the art. Moreover, as used herein, the terms about and approximately mean that dimensions, sizes, formulations, parameters, shapes and other quantities and characteristics are not and need not be exact, but may be approximate and/or larger or smaller, as desired, reflecting tolerances, conversion factors, rounding off, measurement error and the like, and other factors known to those of skill in the art. In general, a dimension, size, formulation, parameter, shape or other quantity or characteristic is about or approximate whether or not expressly stated to be such. It is noted that embodiments of very different sizes, shapes and dimensions may employ the described arrangements.
[0419] The transitional terms comprising, consisting essentially of, and consisting of, when used in the appended claims, in original and amended form, define the claim scope with respect to what unrecited additional claim elements or steps, if any, are excluded from the scope of the claim(s). The term comprising is intended to be inclusive or open-ended and does not exclude any additional, unrecited element, method, step or material. The term consisting of excludes any element, step or material other than those specified in the claim and, in the latter instance, impurities ordinary associated with the specified material(s). The term consisting essentially of limits the scope of a claim to the specified elements, steps or material(s) and those that do not materially affect the basic and novel characteristic(s) of the claimed invention. All compositions, methods, and kits described herein that embody the present invention can, in alternate embodiments, be more specifically defined by any of the transitional terms comprising, consisting essentially of, and consisting of.
Artificial Antigen Presenting Cells
[0420] In an embodiment, the invention includes an isolated artificial antigen presenting cell (aAPC) comprising a cell that expresses HLA-A/B/C, CD64, CD80, ICOS-L, and CD58, and is modified to express one or more costimulatory molecules. In an embodiment, the invention includes an aAPC comprising a MOLM-14 cell that is modified to express one or more costimulatory molecules. In an embodiment, the invention includes an aAPC comprising a MOLM-13 cell that is modified to express one or more costimulatory molecules.
[0421] In an embodiment, the invention includes an aAPC comprising a MOLM-14 cell that endogenously expresses HLA-A/B/C, CD64, CD80, ICOS-L, and CD58, wherein the cell is modified to express a CD86 protein comprising an amino acid sequence as set forth in SEQ ID NO:8, and conservative amino acid substitutions thereof, and a 4-1BBL protein comprising an amino acid sequence as set forth in SEQ ID NO:9, and conservative amino acid substitutions thereof, and wherein the CD86 protein and the 4-1BBL protein are expressed on the surface of the MOLM-14 cell.
[0422] In an embodiment, the invention includes an aAPC comprising a MOLM-14 cell transduced with one or more viral vectors, wherein the one or more viral vectors comprise a nucleic acid encoding CD86 and a nucleic acid encoding 4-1BBL, and wherein the MOLM-14 cell expresses CD86 and 4-1BBL. In an embodiment, the invention includes an aAPC comprising a MOLM-13 cell transduced with one or more viral vectors, wherein the one or more viral vectors comprise a nucleic acid encoding CD86 and a nucleic acid encoding 4-1BBL, and wherein the MOLM-13 cell expresses CD86 and 4-1BBL. In an embodiment, the invention includes a method of preparing any of the foregoing embodiments of aAPCs.
[0423] In an embodiment, the invention includes an aAPC comprising a MOLM-14 cell modified to express a CD86 protein comprising an amino acid sequence as set forth in SEQ ID NO:8 and a 4-1BBL protein comprising an amino acid sequence as set forth in SEQ ID NO:9, wherein the CD86 protein and the 4-1BBL protein are expressed on the surface of the MOLM-14 cell. In an embodiment, the invention includes an aAPC comprising a MOLM-13 cell modified to express a CD86 protein comprising an amino acid sequence as set forth in SEQ ID NO:8, and conservative amino acid substitutions thereof, and a 4-1BBL protein comprising an amino acid sequence as set forth in SEQ ID NO:9, and conservative amino acid substitutions thereof, wherein the CD86 protein and the 4-1BBL protein are expressed on the surface of the MOLM-13 cell. In an embodiment, the invention includes a method of preparing any of the foregoing embodiments of aAPCs.
[0424] In an embodiment, the invention includes an aAPC comprising a MOLM-14 cell modified to express a CD86 protein comprising a sequence with greater than 99% identity to an amino acid sequence as set forth in SEQ ID NO:8 and a 4-1BBL protein comprising a sequence with greater than 99% identity to an amino acid sequence as set forth in SEQ ID NO:9, wherein the CD86 protein and the 4-1BBL protein are expressed on the surface of the MOLM-14 cell. In an embodiment, the invention includes an aAPC comprising a MOLM-14 cell modified to express a CD86 protein comprising a sequence with greater than 98% identity to an amino acid sequence as set forth in SEQ ID NO:8 and a 4-1BBL protein comprising a sequence with greater than 98% identity to an amino acid sequence as set forth in SEQ ID NO:9, wherein the CD86 protein and the 4-1BBL protein are expressed on the surface of the MOLM-14 cell. In an embodiment, the invention includes an aAPC comprising a MOLM-14 cell modified to express a CD86 protein comprising a sequence with greater than 97% identity to an amino acid sequence as set forth in SEQ ID NO:8 and a 4-1BBL protein comprising a sequence with greater than 97% identity to an amino acid sequence as set forth in SEQ ID NO:9, wherein the CD86 protein and the 4-1BBL protein are expressed on the surface of the MOLM-14 cell. In an embodiment, the invention includes an aAPC comprising a MOLM-14 cell modified to express a CD86 protein comprising a sequence with greater than 96% identity to an amino acid sequence as set forth in SEQ ID NO:8 and a 4-1BBL protein comprising a sequence with greater than 96% identity to an amino acid sequence as set forth in SEQ ID NO:9, wherein the CD86 protein and the 4-1BBL protein are expressed on the surface of the MOLM-14 cell. In an embodiment, the invention includes an aAPC comprising a MOLM-14 cell modified to express a CD86 protein comprising a sequence with greater than 95% identity to an amino acid sequence as set forth in SEQ ID NO:8 and a 4-1BBL protein comprising a sequence with greater than 95% identity to an amino acid sequence as set forth in SEQ ID NO:9, wherein the CD86 protein and the 4-1BBL protein are expressed on the surface of the MOLM-14 cell. In an embodiment, the invention includes an aAPC comprising a MOLM-14 cell modified to express a CD86 protein comprising a sequence with greater than 90% identity to an amino acid sequence as set forth in SEQ ID NO:8 and a 4-1BBL protein comprising a sequence with greater than 90% identity to an amino acid sequence as set forth in SEQ ID NO:9, wherein the CD86 protein and the 4-1BBL protein are expressed on the surface of the MOLM-14 cell. In an embodiment, the invention includes a method of preparing any of the foregoing embodiments of aAPCs.
[0425] In an embodiment, the invention includes an aAPC comprising a MOLM-13 cell modified to express a CD86 protein comprising an amino acid sequence as set forth in SEQ ID NO:8 and a 4-1BBL protein comprising an amino acid sequence as set forth in SEQ ID NO:9, wherein the CD86 protein and the 4-1BBL protein are expressed on the surface of the MOLM-13 cell. In an embodiment, the invention includes an aAPC comprising a MOLM-13 cell modified to express a CD86 protein comprising an amino acid sequence as set forth in SEQ ID NO:8, and conservative amino acid substitutions thereof, and a 4-1BBL protein comprising an amino acid sequence as set forth in SEQ ID NO:9, and conservative amino acid substitutions thereof, wherein the CD86 protein and the 4-1BBL protein are expressed on the surface of the MOLM-13 cell. In an embodiment, the invention includes a method of preparing any of the foregoing embodiments of aAPCs.
[0426] In an embodiment, the invention includes an aAPC comprising a MOLM-13 cell modified to express a CD86 protein comprising a sequence with greater than 99% identity to an amino acid sequence as set forth in SEQ ID NO:8 and a 4-1BBL protein comprising a sequence with greater than 99% identity to an amino acid sequence as set forth in SEQ ID NO:9, wherein the CD86 protein and the 4-1BBL protein are expressed on the surface of the MOLM-13 cell. In an embodiment, the invention includes an aAPC comprising a MOLM-13 cell modified to express a CD86 protein comprising a sequence with greater than 98% identity to an amino acid sequence as set forth in SEQ ID NO:8 and a 4-1BBL protein comprising a sequence with greater than 98% identity to an amino acid sequence as set forth in SEQ ID NO:9, wherein the CD86 protein and the 4-1BBL protein are expressed on the surface of the MOLM-13 cell. In an embodiment, the invention includes an aAPC comprising a MOLM-13 cell modified to express a CD86 protein comprising a sequence with greater than 97% identity to an amino acid sequence as set forth in SEQ ID NO:8 and a 4-1BBL protein comprising a sequence with greater than 97% identity to an amino acid sequence as set forth in SEQ ID NO:9, wherein the CD86 protein and the 4-1BBL protein are expressed on the surface of the MOLM-13 cell. In an embodiment, the invention includes an aAPC comprising a MOLM-13 cell modified to express a CD86 protein comprising a sequence with greater than 96% identity to an amino acid sequence as set forth in SEQ ID NO:8 and a 4-1BBL protein comprising a sequence with greater than 96% identity to an amino acid sequence as set forth in SEQ ID NO:9, wherein the CD86 protein and the 4-1BBL protein are expressed on the surface of the MOLM-13 cell. In an embodiment, the invention includes an aAPC comprising a MOLM-13 cell modified to express a CD86 protein comprising a sequence with greater than 95% identity to an amino acid sequence as set forth in SEQ ID NO:8 and a 4-1BBL protein comprising a sequence with greater than 95% identity to an amino acid sequence as set forth in SEQ ID NO:9, wherein the CD86 protein and the 4-1BBL protein are expressed on the surface of the MOLM-13 cell. In an embodiment, the invention includes an aAPC comprising a MOLM-13 cell modified to express a CD86 protein comprising a sequence with greater than 90% identity to an amino acid sequence as set forth in SEQ ID NO:8 and a 4-1BBL protein comprising a sequence with greater than 90% identity to an amino acid sequence as set forth in SEQ ID NO:9, wherein the CD86 protein and the 4-1BBL protein are expressed on the surface of the MOLM-13 cell. In an embodiment, the invention includes a method of preparing any of the foregoing embodiments of aAPCs.
[0427] In an embodiment, the invention includes an aAPC comprising a MOLM-14 cell transduced with one or more viral vectors, wherein the one or more viral vectors comprise a nucleic acid encoding CD86 and a nucleic acid encoding OX40L, and wherein the MOLM-14 cell expresses CD86 and OX40L. In an embodiment, the invention includes an aAPC comprising a MOLM-13 cell transduced with one or more viral vectors, wherein the one or more viral vectors comprise a nucleic acid encoding CD86 and a nucleic acid encoding OX40L, and wherein the MOLM-13 cell expresses CD86 and OX40L. In an embodiment, the invention includes a method of preparing any of the foregoing embodiments of aAPCs.
[0428] In an embodiment, the invention includes an aAPC comprising a MOLM-14 cell modified to express a CD86 protein comprising an amino acid sequence as set forth in SEQ ID NO:8 and a OX40L protein comprising an amino acid sequence as set forth in SEQ ID NO:10, wherein the CD86 protein and the OX40L protein are expressed on the surface of the MOLM-14 cell. In an embodiment, the invention includes an aAPC comprising a MOLM-13 cell modified to express a CD86 protein comprising an amino acid sequence as set forth in SEQ ID NO:8, and conservative amino acid substitutions thereof, and a OX40L protein comprising an amino acid sequence as set forth in SEQ ID NO:10, and conservative amino acid substitutions thereof, wherein the CD86 protein and the OX40L protein are expressed on the surface of the MOLM-13 cell. In an embodiment, the invention includes a method of preparing any of the foregoing embodiments of aAPCs.
[0429] In an embodiment, the invention includes an aAPC comprising a MOLM-14 cell modified to express a CD86 protein comprising a sequence with greater than 99% identity to an amino acid sequence as set forth in SEQ ID NO:8 and a OX40L protein comprising a sequence with greater than 99% identity to an amino acid sequence as set forth in SEQ ID NO:10, wherein the CD86 protein and the OX40L protein are expressed on the surface of the MOLM-14 cell. In an embodiment, the invention includes an aAPC comprising a MOLM-14 cell modified to express a CD86 protein comprising a sequence with greater than 98% identity to an amino acid sequence as set forth in SEQ ID NO:8 and a OX40L protein comprising a sequence with greater than 98% identity to an amino acid sequence as set forth in SEQ ID NO:10, wherein the CD86 protein and the OX40L protein are expressed on the surface of the MOLM-14 cell. In an embodiment, the invention includes an aAPC comprising a MOLM-14 cell modified to express a CD86 protein comprising a sequence with greater than 97% identity to an amino acid sequence as set forth in SEQ ID NO:8 and a OX40L protein comprising a sequence with greater than 97% identity to an amino acid sequence as set forth in SEQ ID NO:10, wherein the CD86 protein and the OX40L protein are expressed on the surface of the MOLM-14 cell. In an embodiment, the invention includes an aAPC comprising a MOLM-14 cell modified to express a CD86 protein comprising a sequence with greater than 96% identity to an amino acid sequence as set forth in SEQ ID NO:8 and a OX40L protein comprising a sequence with greater than 96% identity to an amino acid sequence as set forth in SEQ ID NO:10, wherein the CD86 protein and the OX40L protein are expressed on the surface of the MOLM-14 cell. In an embodiment, the invention includes an aAPC comprising a MOLM-14 cell modified to express a CD86 protein comprising a sequence with greater than 95% identity to an amino acid sequence as set forth in SEQ ID NO:8 and a OX40L protein comprising a sequence with greater than 95% identity to an amino acid sequence as set forth in SEQ ID NO:10, wherein the CD86 protein and the OX40L protein are expressed on the surface of the MOLM-14 cell. In an embodiment, the invention includes an aAPC comprising a MOLM-14 cell modified to express a CD86 protein comprising a sequence with greater than 90% identity to an amino acid sequence as set forth in SEQ ID NO:8 and a OX40L protein comprising a sequence with greater than 90% identity to an amino acid sequence as set forth in SEQ ID NO:10, wherein the CD86 protein and the OX40L protein are expressed on the surface of the MOLM-14 cell. In an embodiment, the invention includes a method of preparing any of the foregoing embodiments of aAPCs.
[0430] In any of the foregoing embodiments, it will be understood that an aAPC comprising a MOLM-14 or MOLM-13 cell may be modified to express both OX40L and 4-1BBL.
[0431] The sequences for human CD86, human 4-1BBL (CD137L), and human OX40L (CD134L) are given in Table 3.
TABLE-US-00003 TABLE3 AminoacidsequencesforhumanCD86, human4-1BBL,andhumanOX40L. Identifier (Description) Sequence(One-LetterAminoAcidSymbols) SEQIDNO:8 MGLSNILFVMAFLLSGAAPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLN 60 (humanCD86) EVYLGKEKEDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQM 120 NSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGIM 180 QESQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHI 240 PWITAVLPTVIICVMVFCLILWKWKKKKRPRNSYKCGTNTMEREESEQTKKREKIHIPER 300 SDEAQRVFKSSKTSSCDKSDTCF 323 SEQIDNO:9 MEYASDASLDPEAPWPPAPRARACRVLPWALVAGLLLLLLLAAACAVFLACPWAVSGARA 60 (human4-1BBL, SPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSL 120 CD137) TGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALA 180 LTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRV 240 TPEIPAGLPSPRSE 254 SEQIDNO:10 MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQ 60 (humanOX40L, SIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQ 120 CD134L) KDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEF 180 CVL 183
[0432] In an embodiment, the invention includes an aAPC comprising a MOLM-14 cell modified to express a first protein that binds to a second protein comprising an amino acid sequence as set forth in SEQ ID NO:13, and conservative amino acid substitutions thereof, and a third protein that binds to a fourth protein comprising an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12, and conservative amino acid substitutions thereof. In an embodiment, the invention includes an aAPC comprising a MOLM-13 cell modified to express a first protein that binds to a second protein comprising an amino acid sequence as set forth in SEQ ID NO:13, and conservative amino acid substitutions thereof, and a third protein that binds to a fourth protein comprising an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12, and conservative amino acid substitutions thereof. In an embodiment, the invention includes a method of preparing any of the foregoing embodiments of aAPCs.
[0433] In an embodiment, the invention includes an aAPC comprising a MOLM-14 cell modified to express a first protein that binds to a second protein comprising a sequence with greater than 99% identity to an amino acid sequence as set forth in SEQ ID NO:13 and a third protein that binds to a fourth protein comprising a sequence with greater than 99% identity to an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12. In an embodiment, the invention includes an aAPC comprising a MOLM-14 cell modified to express a first protein that binds to a second protein comprising a sequence with greater than 98% identity to an amino acid sequence as set forth in SEQ ID NO:13 and a third protein that binds to a fourth protein comprising a sequence with greater than 98% identity to an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12. In an embodiment, the invention includes an aAPC comprising a MOLM-14 cell modified to express a first protein that binds to a second protein comprising a sequence with greater than 97% identity to an amino acid sequence as set forth in SEQ ID NO:13 and a third protein that binds to a fourth protein comprising a sequence with greater than 97% identity to an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12. In an embodiment, the invention includes an aAPC comprising a MOLM-14 cell modified to express a first protein that binds to a second protein comprising a sequence with greater than 96% identity to an amino acid sequence as set forth in SEQ ID NO:13 and a third protein that binds to a fourth protein comprising a sequence with greater than 96% identity to an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12. In an embodiment, the invention includes an aAPC comprising a MOLM-14 cell modified to express a first protein that binds to a second protein comprising a sequence with greater than 95% identity to an amino acid sequence as set forth in SEQ ID NO:13 and a third protein that binds to a fourth protein comprising a sequence with greater than 95% identity to an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12. In an embodiment, the invention includes an aAPC comprising a MOLM-14 cell modified to express a first protein that binds to a second protein comprising a sequence with greater than 90% identity to an amino acid sequence as set forth in SEQ ID NO:13 and a third protein that binds to a fourth protein comprising a sequence with greater than 90% identity to an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12. In an embodiment, the invention includes a method of preparing any of the foregoing embodiments of aAPCs.
[0434] In an embodiment, the invention includes an aAPC comprising a MOLM-13 cell modified to express a first protein that binds to a second protein comprising a sequence with greater than 99% identity to an amino acid sequence as set forth in SEQ ID NO:13 and a third protein that binds to a fourth protein comprising a sequence with greater than 99% identity to an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12. In an embodiment, the invention includes an aAPC comprising a MOLM-13 cell modified to express a first protein that binds to a second protein comprising a sequence with greater than 98% identity to an amino acid sequence as set forth in SEQ ID NO:13 and a third protein that binds to a fourth protein comprising a sequence with greater than 98% identity to an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12. In an embodiment, the invention includes an aAPC comprising a MOLM-13 cell modified to express a first protein that binds to a second protein comprising a sequence with greater than 97% identity to an amino acid sequence as set forth in SEQ ID NO:13 and a third protein that binds to a fourth protein comprising a sequence with greater than 97% identity to an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12. In an embodiment, the invention includes an aAPC comprising a MOLM-13 cell modified to express a first protein that binds to a second protein comprising a sequence with greater than 96% identity to an amino acid sequence as set forth in SEQ ID NO:13 and a third protein that binds to a fourth protein comprising a sequence with greater than 96% identity to an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12. In an embodiment, the invention includes an aAPC comprising a MOLM-13 cell modified to express a first protein that binds to a second protein comprising a sequence with greater than 95% identity to an amino acid sequence as set forth in SEQ ID NO:13 and a third protein that binds to a fourth protein comprising a sequence with greater than 95% identity to an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12. In an embodiment, the invention includes an aAPC comprising a MOLM-13 cell modified to express a first protein that binds to a second protein comprising a sequence with greater than 90% identity to an amino acid sequence as set forth in SEQ ID NO:13 and a third protein that binds to a fourth protein comprising a sequence with greater than 90% identity to an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12. In an embodiment, the invention includes a method of preparing any of the foregoing embodiments of aAPCs.
[0435] In an embodiment, the invention includes an aAPC comprising a MOLM-14 cell modified to express a first protein that binds to a second protein comprising an amino acid sequence as set forth in SEQ ID NO:14, and conservative amino acid substitutions thereof, and a third protein that binds to a fourth protein comprising an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12, and conservative amino acid substitutions thereof. In an embodiment, the invention includes an aAPC comprising a MOLM-13 cell modified to express a first protein that binds to a second protein comprising an amino acid sequence as set forth in SEQ ID NO:14, and conservative amino acid substitutions thereof, and a third protein that binds to a fourth protein comprising an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12, and conservative amino acid substitutions thereof. In an embodiment, the invention includes a method of preparing any of the foregoing embodiments of aAPCs.
[0436] In an embodiment, the invention includes an aAPC comprising a MOLM-14 cell modified to express a first protein that binds to a second protein comprising a sequence with greater than 99% identity to an amino acid sequence as set forth in SEQ ID NO:14 and a third protein that binds to a fourth protein comprising a sequence with greater than 99% identity to an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12. In an embodiment, the invention includes an aAPC comprising a MOLM-14 cell modified to express a first protein that binds to a second protein comprising a sequence with greater than 98% identity to an amino acid sequence as set forth in SEQ ID NO:14 and a third protein that binds to a fourth protein comprising a sequence with greater than 98% identity to an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12. In an embodiment, the invention includes an aAPC comprising a MOLM-14 cell modified to express a first protein that binds to a second protein comprising a sequence with greater than 97% identity to an amino acid sequence as set forth in SEQ ID NO:14 and a third protein that binds to a fourth protein comprising a sequence with greater than 97% identity to an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12. In an embodiment, the invention includes an aAPC comprising a MOLM-14 cell modified to express a first protein that binds to a second protein comprising a sequence with greater than 96% identity to an amino acid sequence as set forth in SEQ ID NO:14 and a third protein that binds to a fourth protein comprising a sequence with greater than 96% identity to an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12. In an embodiment, the invention includes an aAPC comprising a MOLM-14 cell modified to express a first protein that binds to a second protein comprising a sequence with greater than 95% identity to an amino acid sequence as set forth in SEQ ID NO:14 and a third protein that binds to a fourth protein comprising a sequence with greater than 95% identity to an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12. In an embodiment, the invention includes an aAPC comprising a MOLM-14 cell modified to express a first protein that binds to a second protein comprising a sequence with greater than 90% identity to an amino acid sequence as set forth in SEQ ID NO:14 and a third protein that binds to a fourth protein comprising a sequence with greater than 90% identity to an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12. In an embodiment, the invention includes a method of preparing any of the foregoing embodiments of aAPCs.
[0437] In an embodiment, the invention includes an aAPC comprising a MOLM-13 cell modified to express a first protein that binds to a second protein comprising a sequence with greater than 99% identity to an amino acid sequence as set forth in SEQ ID NO:14 and a third protein that binds to a fourth protein comprising a sequence with greater than 99% identity to an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12. In an embodiment, the invention includes an aAPC comprising a MOLM-13 cell modified to express a first protein that binds to a second protein comprising a sequence with greater than 98% identity to an amino acid sequence as set forth in SEQ ID NO:14 and a third protein that binds to a fourth protein comprising a sequence with greater than 98% identity to an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12. In an embodiment, the invention includes an aAPC comprising a MOLM-13 cell modified to express a first protein that binds to a second protein comprising a sequence with greater than 97% identity to an amino acid sequence as set forth in SEQ ID NO:14 and a third protein that binds to a fourth protein comprising a sequence with greater than 97% identity to an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12. In an embodiment, the invention includes an aAPC comprising a MOLM-13 cell modified to express a first protein that binds to a second protein comprising a sequence with greater than 96% identity to an amino acid sequence as set forth in SEQ ID NO:14 and a third protein that binds to a fourth protein comprising a sequence with greater than 96% identity to an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12. In an embodiment, the invention includes an aAPC comprising a MOLM-13 cell modified to express a first protein that binds to a second protein comprising a sequence with greater than 95% identity to an amino acid sequence as set forth in SEQ ID NO:14 and a third protein that binds to a fourth protein comprising a sequence with greater than 95% identity to an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12. In an embodiment, the invention includes an aAPC comprising a MOLM-13 cell modified to express a first protein that binds to a second protein comprising a sequence with greater than 90% identity to an amino acid sequence as set forth in SEQ ID NO:14 and a third protein that binds to a fourth protein comprising a sequence with greater than 90% identity to an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12. In an embodiment, the invention includes a method of preparing any of the foregoing embodiments of aAPCs.
[0438] The sequences for the ligands to which human CD86 binds (CD28 and CTLA-4), the ligand to which human 4-1BBL binds (4-1BB), and the ligand to which human OX40L binds (OX40) are given in Table 4.
TABLE-US-00004 TABLE4 AminoacidsequencesforhumanCD28, humanCTLA-4,human4-1BB,andhumanOX40. Identifier (Description) Sequence(One-LetterAminoAcidSymbols) SEQIDNO:11 MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLD 60 (humanCD28) SAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPP 120 PYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVR 180 SHRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS 220 SEQIDNO:12 MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEY 60 (humanCTLA-4) ASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLR 120 AMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFL 180 LTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN 223 SEQIDNO:13 MGNSCYNIVATLLLVLNFERTRSLQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQR 60 (human4-1BB) TCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDC 120 CFGTFNDQKRGICRPWTNCSLDGKSVLVNGTHERDVVCGPSPADLSPGASSVTPPAPARE 180 PGHSPQIISFFLALTSTALLFLLFFLTLRFSVVKRGRKKLLYIFKQPFMRPVQTTQEEDG 240 CSCRFPEEEEGGCEL 255 SEQIDNO:14 MCVGARRLGRGPCAALLLLGLGLSTVTGLHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQ 60 (humanOX40) NTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYK 120 PGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQ 180 GPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVAAILGLGLVLGLLGPLAILLALYLL 240 RRDQRLPPDAFKPPGGGSFRTPIQEEQADAHSTLAKI 277
[0439] In an embodiment, the invention includes an isolated artificial antigen presenting cell (aAPC) comprising a cell that expresses HLA-A/B/C, ICOS-L, and CD58, and is modified to express one or more costimulatory molecules, wherein the aAPC is derived from an EM-3 parental cell line. In an embodiment, the invention includes an aAPC comprising an EM-3 cell that is modified to express one or more costimulatory molecules. In an embodiment, the invention includes an aAPC comprising an EM-2 cell that is modified to express one or more costimulatory molecules.
[0440] In an embodiment, the invention includes an aAPC comprising an EM-3 cell that expresses HLA-A/B/C, ICOS-L, and CD58, wherein the cell is modified to express a CD86 protein comprising an amino acid sequence as set forth in SEQ ID NO:8, and conservative amino acid substitutions thereof, and a 4-1BBL protein comprising an amino acid sequence as set forth in SEQ ID NO:9, and conservative amino acid substitutions thereof, and wherein the CD86 protein and the 4-1BBL protein are expressed on the surface of the EM-3 cell.
[0441] In an embodiment, the invention includes an aAPC comprising an EM-3 cell transduced with one or more viral vectors, wherein the one or more viral vectors comprise a nucleic acid encoding CD86 and a nucleic acid encoding 4-1BBL, and wherein the EM-3 cell expresses CD86 and 4-1BBL. In an embodiment, the invention includes a method of preparing any of the foregoing embodiments of aAPCs.
[0442] In an embodiment, the invention includes an aAPC comprising an EM-3 cell modified to express a CD86 protein comprising an amino acid sequence as set forth in SEQ ID NO:8 and a 4-1BBL protein comprising an amino acid sequence as set forth in SEQ ID NO:9, wherein the CD86 protein and the 4-1BBL protein are expressed on the surface of the EM-3 cell. In an embodiment, the invention includes a method of preparing any of the foregoing embodiments of aAPCs.
[0443] In an embodiment, the invention includes an aAPC comprising an EM-3 cell modified to express a CD86 protein comprising a sequence with greater than 99% identity to an amino acid sequence as set forth in SEQ ID NO:8 and a 4-1BBL protein comprising a sequence with greater than 99% identity to an amino acid sequence as set forth in SEQ ID NO:9, wherein the CD86 protein and the 4-1BBL protein are expressed on the surface of the EM-3 cell. In an embodiment, the invention includes an aAPC comprising a EM-3 cell modified to express a CD86 protein comprising a sequence with greater than 98% identity to an amino acid sequence as set forth in SEQ ID NO:8 and a 4-1BBL protein comprising a sequence with greater than 98% identity to an amino acid sequence as set forth in SEQ ID NO:9, wherein the CD86 protein and the 4-1BBL protein are expressed on the surface of the EM-3 cell. In an embodiment, the invention includes an aAPC comprising a EM-3 cell modified to express a CD86 protein comprising a sequence with greater than 97% identity to an amino acid sequence as set forth in SEQ ID NO:8 and a 4-1BBL protein comprising a sequence with greater than 97% identity to an amino acid sequence as set forth in SEQ ID NO:9, wherein the CD86 protein and the 4-1BBL protein are expressed on the surface of the EM-3 cell. In an embodiment, the invention includes an aAPC comprising a EM-3 cell modified to express a CD86 protein comprising a sequence with greater than 96% identity to an amino acid sequence as set forth in SEQ ID NO:8 and a 4-1BBL protein comprising a sequence with greater than 96% identity to an amino acid sequence as set forth in SEQ ID NO:9, wherein the CD86 protein and the 4-1BBL protein are expressed on the surface of the EM-3 cell. In an embodiment, the invention includes an aAPC comprising a EM-3 cell modified to express a CD86 protein comprising a sequence with greater than 95% identity to an amino acid sequence as set forth in SEQ ID NO:8 and a 4-1BBL protein comprising a sequence with greater than 95% identity to an amino acid sequence as set forth in SEQ ID NO:9, wherein the CD86 protein and the 4-1BBL protein are expressed on the surface of the EM-3 cell. In an embodiment, the invention includes an aAPC comprising a EM-3 cell modified to express a CD86 protein comprising a sequence with greater than 90% identity to an amino acid sequence as set forth in SEQ ID NO:8 and a 4-1BBL protein comprising a sequence with greater than 90% identity to an amino acid sequence as set forth in SEQ ID NO:9, wherein the CD86 protein and the 4-1BBL protein are expressed on the surface of the EM-3 cell. In an embodiment, the invention includes a method of preparing any of the foregoing embodiments of aAPCs.
[0444] In an embodiment, the invention includes an aAPC comprising an EM-3 cell modified to express a first protein that binds to a second protein comprising an amino acid sequence as set forth in SEQ ID NO:13, and conservative amino acid substitutions thereof, and a third protein that binds to a fourth protein comprising an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12, and conservative amino acid substitutions thereof. In an embodiment, the invention includes a method of preparing any of the foregoing embodiments of aAPCs.
[0445] In an embodiment, the invention includes an aAPC comprising an EM-3 cell modified to express a first protein that binds to a second protein comprising a sequence with greater than 99% identity to an amino acid sequence as set forth in SEQ ID NO:13 and a third protein that binds to a fourth protein comprising a sequence with greater than 99% identity to an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12. In an embodiment, the invention includes an aAPC comprising an EM-3 cell modified to express a first protein that binds to a second protein comprising a sequence with greater than 98% identity to an amino acid sequence as set forth in SEQ ID NO:13 and a third protein that binds to a fourth protein comprising a sequence with greater than 98% identity to an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12. In an embodiment, the invention includes an aAPC comprising an EM-3 modified to express a first protein that binds to a second protein comprising a sequence with greater than 97% identity to an amino acid sequence as set forth in SEQ ID NO:13 and a third protein that binds to a fourth protein comprising a sequence with greater than 97% identity to an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12. In an embodiment, the invention includes an aAPC comprising an EM-3 cell modified to express a first protein that binds to a second protein comprising a sequence with greater than 96% identity to an amino acid sequence as set forth in SEQ ID NO:13 and a third protein that binds to a fourth protein comprising a sequence with greater than 96% identity to an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12. In an embodiment, the invention includes an aAPC comprising an EM-3 cell modified to express a first protein that binds to a second protein comprising a sequence with greater than 95% identity to an amino acid sequence as set forth in SEQ ID NO:13 and a third protein that binds to a fourth protein comprising a sequence with greater than 95% identity to an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12. In an embodiment, the invention includes an aAPC comprising an EM-3 cell modified to express a first protein that binds to a second protein comprising a sequence with greater than 90% identity to an amino acid sequence as set forth in SEQ ID NO:13 and a third protein that binds to a fourth protein comprising a sequence with greater than 90% identity to an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12. In an embodiment, the invention includes a method of preparing any of the foregoing embodiments of aAPCs.
[0446] In an embodiment, the invention includes an aAPC comprising an EM-3 cell modified to express a single chain fragment variable (scFv) binding domain, such as clones 7C12 and 8B3 described herein, to bind the Fc domain of a monoclonal antibody, such as OKT-3, providing an additional proliferative signal.
[0447] In an embodiment, the invention includes an aAPC comprising an EM-2 cell modified to express a CD86 protein comprising an amino acid sequence as set forth in SEQ ID NO:8 and a 4-1BBL protein comprising an amino acid sequence as set forth in SEQ ID NO:9, wherein the CD86 protein and the 4-1BBL protein are expressed on the surface of the EM-2 cell. In an embodiment, the invention includes a method of preparing any of the foregoing embodiments of aAPCs.
[0448] In an embodiment, the invention includes an aAPC comprising an EM-2 cell modified to express a CD86 protein comprising a sequence with greater than 99% identity to an amino acid sequence as set forth in SEQ ID NO:8 and a 4-1BBL protein comprising a sequence with greater than 99% identity to an amino acid sequence as set forth in SEQ ID NO:9, wherein the CD86 protein and the 4-1BBL protein are expressed on the surface of the EM-2 cell. In an embodiment, the invention includes an aAPC comprising a EM-2 cell modified to express a CD86 protein comprising a sequence with greater than 98% identity to an amino acid sequence as set forth in SEQ ID NO:8 and a 4-1BBL protein comprising a sequence with greater than 98% identity to an amino acid sequence as set forth in SEQ ID NO:9, wherein the CD86 protein and the 4-1BBL protein are expressed on the surface of the EM-2 cell. In an embodiment, the invention includes an aAPC comprising a EM-2 cell modified to express a CD86 protein comprising a sequence with greater than 97% identity to an amino acid sequence as set forth in SEQ ID NO:8 and a 4-1BBL protein comprising a sequence with greater than 97% identity to an amino acid sequence as set forth in SEQ ID NO:9, wherein the CD86 protein and the 4-1BBL protein are expressed on the surface of the EM-2 cell. In an embodiment, the invention includes an aAPC comprising a EM-2 cell modified to express a CD86 protein comprising a sequence with greater than 96% identity to an amino acid sequence as set forth in SEQ ID NO:8 and a 4-1BBL protein comprising a sequence with greater than 96% identity to an amino acid sequence as set forth in SEQ ID NO:9, wherein the CD86 protein and the 4-1BBL protein are expressed on the surface of the EM-2 cell. In an embodiment, the invention includes an aAPC comprising a EM-2 cell modified to express a CD86 protein comprising a sequence with greater than 95% identity to an amino acid sequence as set forth in SEQ ID NO:8 and a 4-1BBL protein comprising a sequence with greater than 95% identity to an amino acid sequence as set forth in SEQ ID NO:9, wherein the CD86 protein and the 4-1BBL protein are expressed on the surface of the EM-2 cell. In an embodiment, the invention includes an aAPC comprising a EM-2 cell modified to express a CD86 protein comprising a sequence with greater than 90% identity to an amino acid sequence as set forth in SEQ ID NO:8 and a 4-1BBL protein comprising a sequence with greater than 90% identity to an amino acid sequence as set forth in SEQ ID NO:9, wherein the CD86 protein and the 4-1BBL protein are expressed on the surface of the EM-2 cell. In an embodiment, the invention includes a method of preparing any of the foregoing embodiments of aAPCs.
[0449] In an embodiment, the invention includes an aAPC comprising an EM-2 cell modified to express a first protein that binds to a second protein comprising an amino acid sequence as set forth in SEQ ID NO:13, and conservative amino acid substitutions thereof, and a third protein that binds to a fourth protein comprising an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12, and conservative amino acid substitutions thereof. In an embodiment, the invention includes a method of preparing any of the foregoing embodiments of aAPCs.
[0450] In an embodiment, the invention includes an aAPC comprising an EM-2 cell modified to express a first protein that binds to a second protein comprising a sequence with greater than 99% identity to an amino acid sequence as set forth in SEQ ID NO:13 and a third protein that binds to a fourth protein comprising a sequence with greater than 99% identity to an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12. In an embodiment, the invention includes an aAPC comprising an EM-2 cell modified to express a first protein that binds to a second protein comprising a sequence with greater than 98% identity to an amino acid sequence as set forth in SEQ ID NO:13 and a third protein that binds to a fourth protein comprising a sequence with greater than 98% identity to an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12. In an embodiment, the invention includes an aAPC comprising an EM-2 modified to express a first protein that binds to a second protein comprising a sequence with greater than 97% identity to an amino acid sequence as set forth in SEQ ID NO:13 and a third protein that binds to a fourth protein comprising a sequence with greater than 97% identity to an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12. In an embodiment, the invention includes an aAPC comprising an EM-2 cell modified to express a first protein that binds to a second protein comprising a sequence with greater than 96% identity to an amino acid sequence as set forth in SEQ ID NO:13 and a third protein that binds to a fourth protein comprising a sequence with greater than 96% identity to an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12. In an embodiment, the invention includes an aAPC comprising an EM-2 cell modified to express a first protein that binds to a second protein comprising a sequence with greater than 95% identity to an amino acid sequence as set forth in SEQ ID NO:13 and a third protein that binds to a fourth protein comprising a sequence with greater than 95% identity to an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12. In an embodiment, the invention includes an aAPC comprising an EM-2 cell modified to express a first protein that binds to a second protein comprising a sequence with greater than 90% identity to an amino acid sequence as set forth in SEQ ID NO:13 and a third protein that binds to a fourth protein comprising a sequence with greater than 90% identity to an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12. In an embodiment, the invention includes a method of preparing any of the foregoing embodiments of aAPCs.
[0451] In an embodiment, the invention includes an aAPC comprising an EM-2 cell modified to express a single chain fragment variable (scFv) binding domain, such as clones 7C12 and 8B3 described herein, to bind the Fc domain of a monoclonal antibody, such as OKT-3, providing an additional proliferative signal.
[0452] In an embodiment, the invention includes an aAPC comprising an EM-3 or an EM-2 cell modified as depicted in
[0453] In an embodiment, the invention includes an aAPC comprising an EM-3 cell that expresses HLA-A/B/C, ICOS-L, and CD58, wherein the cell is modified to express a CD86 protein comprising an amino acid sequence as set forth in SEQ ID NO:8, and conservative amino acid substitutions thereof, and a OX40L protein comprising an amino acid sequence as set forth in SEQ ID NO:10, and conservative amino acid substitutions thereof, and wherein the CD86 protein and the OX40L protein are expressed on the surface of the EM-3 cell.
[0454] In an embodiment, the invention includes an aAPC comprising an EM-3 cell transduced with one or more viral vectors, wherein the one or more viral vectors comprise a nucleic acid encoding CD86 and a nucleic acid encoding OX40L, and wherein the EM-3 cell expresses CD86 and OX40L. In an embodiment, the invention includes a method of preparing any of the foregoing embodiments of aAPCs.
[0455] In an embodiment, the invention includes an aAPC comprising an EM-3 cell modified to express a CD86 protein comprising an amino acid sequence as set forth in SEQ ID NO:8 and a OX40L protein comprising an amino acid sequence as set forth in SEQ ID NO:10, wherein the CD86 protein and the OX40L protein are expressed on the surface of the EM-3 cell. In an embodiment, the invention includes a method of preparing any of the foregoing embodiments of aAPCs.
[0456] In an embodiment, the invention includes an aAPC comprising an EM-3 cell modified to express a CD86 protein comprising a sequence with greater than 99% identity to an amino acid sequence as set forth in SEQ ID NO:8 and a OX40L protein comprising a sequence with greater than 99% identity to an amino acid sequence as set forth in SEQ ID NO:10, wherein the CD86 protein and the OX40L protein are expressed on the surface of the EM-3 cell. In an embodiment, the invention includes an aAPC comprising a EM-3 cell modified to express a CD86 protein comprising a sequence with greater than 98% identity to an amino acid sequence as set forth in SEQ ID NO:8 and a OX40L protein comprising a sequence with greater than 98% identity to an amino acid sequence as set forth in SEQ ID NO:10, wherein the CD86 protein and the OX40L protein are expressed on the surface of the EM-3 cell. In an embodiment, the invention includes an aAPC comprising a EM-3 cell modified to express a CD86 protein comprising a sequence with greater than 97% identity to an amino acid sequence as set forth in SEQ ID NO:8 and a OX40L protein comprising a sequence with greater than 97% identity to an amino acid sequence as set forth in SEQ ID NO:10, wherein the CD86 protein and the OX40L protein are expressed on the surface of the EM-3 cell. In an embodiment, the invention includes an aAPC comprising a EM-3 cell modified to express a CD86 protein comprising a sequence with greater than 96% identity to an amino acid sequence as set forth in SEQ ID NO:8 and a OX40L protein comprising a sequence with greater than 96% identity to an amino acid sequence as set forth in SEQ ID NO:10, wherein the CD86 protein and the OX40L protein are expressed on the surface of the EM-3 cell. In an embodiment, the invention includes an aAPC comprising a EM-3 cell modified to express a CD86 protein comprising a sequence with greater than 95% identity to an amino acid sequence as set forth in SEQ ID NO:8 and a OX40L protein comprising a sequence with greater than 95% identity to an amino acid sequence as set forth in SEQ ID NO:10, wherein the CD86 protein and the OX40L protein are expressed on the surface of the EM-3 cell. In an embodiment, the invention includes an aAPC comprising a EM-3 cell modified to express a CD86 protein comprising a sequence with greater than 90% identity to an amino acid sequence as set forth in SEQ ID NO:8 and a OX40L protein comprising a sequence with greater than 90% identity to an amino acid sequence as set forth in SEQ ID NO:10, wherein the CD86 protein and the OX40L protein are expressed on the surface of the EM-3 cell. In an embodiment, the invention includes a method of preparing any of the foregoing embodiments of aAPCs.
[0457] In an embodiment, the invention includes an aAPC comprising an EM-3 cell modified to express a first protein that binds to a second protein comprising an amino acid sequence as set forth in SEQ ID NO:14, and conservative amino acid substitutions thereof, and a third protein that binds to a fourth protein comprising an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12, and conservative amino acid substitutions thereof. In an embodiment, the invention includes a method of preparing any of the foregoing embodiments of aAPCs.
[0458] In an embodiment, the invention includes an aAPC comprising an EM-3 cell modified to express a first protein that binds to a second protein comprising a sequence with greater than 99% identity to an amino acid sequence as set forth in SEQ ID NO:14 and a third protein that binds to a fourth protein comprising a sequence with greater than 99% identity to an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12. In an embodiment, the invention includes an aAPC comprising an EM-3 cell modified to express a first protein that binds to a second protein comprising a sequence with greater than 98% identity to an amino acid sequence as set forth in SEQ ID NO:14 and a third protein that binds to a fourth protein comprising a sequence with greater than 98% identity to an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12. In an embodiment, the invention includes an aAPC comprising an EM-3 modified to express a first protein that binds to a second protein comprising a sequence with greater than 97% identity to an amino acid sequence as set forth in SEQ ID NO:14 and a third protein that binds to a fourth protein comprising a sequence with greater than 97% identity to an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12. In an embodiment, the invention includes an aAPC comprising an EM-3 cell modified to express a first protein that binds to a second protein comprising a sequence with greater than 96% identity to an amino acid sequence as set forth in SEQ ID NO:14 and a third protein that binds to a fourth protein comprising a sequence with greater than 96% identity to an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12. In an embodiment, the invention includes an aAPC comprising an EM-3 cell modified to express a first protein that binds to a second protein comprising a sequence with greater than 95% identity to an amino acid sequence as set forth in SEQ ID NO:14 and a third protein that binds to a fourth protein comprising a sequence with greater than 95% identity to an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12. In an embodiment, the invention includes an aAPC comprising an EM-3 cell modified to express a first protein that binds to a second protein comprising a sequence with greater than 90% identity to an amino acid sequence as set forth in SEQ ID NO:14 and a third protein that binds to a fourth protein comprising a sequence with greater than 90% identity to an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12. In an embodiment, the invention includes a method of preparing any of the foregoing embodiments of aAPCs.
[0459] In an embodiment, the invention includes an aAPC comprising an EM-3 cell modified to express a single chain fragment variable (scFv) binding domain, such as clones 7C12 and 8B3 described herein, to bind the Fc domain of a monoclonal antibody, such as OKT-3, providing an additional proliferative signal.
[0460] In an embodiment, the invention includes an aAPC comprising an EM-2 cell modified to express a CD86 protein comprising an amino acid sequence as set forth in SEQ ID NO:8 and a OX40L protein comprising an amino acid sequence as set forth in SEQ ID NO:10, wherein the CD86 protein and the OX40L protein are expressed on the surface of the EM-2 cell. In an embodiment, the invention includes a method of preparing any of the foregoing embodiments of aAPCs.
[0461] In an embodiment, the invention includes an aAPC comprising an EM-2 cell modified to express a CD86 protein comprising a sequence with greater than 99% identity to an amino acid sequence as set forth in SEQ ID NO:8 and a OX40L protein comprising a sequence with greater than 99% identity to an amino acid sequence as set forth in SEQ ID NO:10, wherein the CD86 protein and the OX40L protein are expressed on the surface of the EM-2 cell. In an embodiment, the invention includes an aAPC comprising a EM-2 cell modified to express a CD86 protein comprising a sequence with greater than 98% identity to an amino acid sequence as set forth in SEQ ID NO:8 and a OX40L protein comprising a sequence with greater than 98% identity to an amino acid sequence as set forth in SEQ ID NO:10, wherein the CD86 protein and the OX40L protein are expressed on the surface of the EM-2 cell. In an embodiment, the invention includes an aAPC comprising a EM-2 cell modified to express a CD86 protein comprising a sequence with greater than 97% identity to an amino acid sequence as set forth in SEQ ID NO:8 and a OX40L protein comprising a sequence with greater than 97% identity to an amino acid sequence as set forth in SEQ ID NO:10, wherein the CD86 protein and the OX40L protein are expressed on the surface of the EM-2 cell. In an embodiment, the invention includes an aAPC comprising a EM-2 cell modified to express a CD86 protein comprising a sequence with greater than 96% identity to an amino acid sequence as set forth in SEQ ID NO:8 and a OX40L protein comprising a sequence with greater than 96% identity to an amino acid sequence as set forth in SEQ ID NO:10, wherein the CD86 protein and the OX40L protein are expressed on the surface of the EM-2 cell. In an embodiment, the invention includes an aAPC comprising a EM-2 cell modified to express a CD86 protein comprising a sequence with greater than 95% identity to an amino acid sequence as set forth in SEQ ID NO:8 and a OX40L protein comprising a sequence with greater than 95% identity to an amino acid sequence as set forth in SEQ ID NO:10, wherein the CD86 protein and the OX40L protein are expressed on the surface of the EM-2 cell. In an embodiment, the invention includes an aAPC comprising a EM-2 cell modified to express a CD86 protein comprising a sequence with greater than 90% identity to an amino acid sequence as set forth in SEQ ID NO:8 and a OX40L protein comprising a sequence with greater than 90% identity to an amino acid sequence as set forth in SEQ ID NO:10, wherein the CD86 protein and the OX40L protein are expressed on the surface of the EM-2 cell. In an embodiment, the invention includes a method of preparing any of the foregoing embodiments of aAPCs.
[0462] In an embodiment, the invention includes an aAPC comprising an EM-2 cell modified to express a first protein that binds to a second protein comprising an amino acid sequence as set forth in SEQ ID NO:14, and conservative amino acid substitutions thereof, and a third protein that binds to a fourth protein comprising an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12, and conservative amino acid substitutions thereof. In an embodiment, the invention includes a method of preparing any of the foregoing embodiments of aAPCs.
[0463] In an embodiment, the invention includes an aAPC comprising an EM-2 cell modified to express a first protein that binds to a second protein comprising a sequence with greater than 99% identity to an amino acid sequence as set forth in SEQ ID NO:14 and a third protein that binds to a fourth protein comprising a sequence with greater than 99% identity to an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12. In an embodiment, the invention includes an aAPC comprising an EM-2 cell modified to express a first protein that binds to a second protein comprising a sequence with greater than 98% identity to an amino acid sequence as set forth in SEQ ID NO:14 and a third protein that binds to a fourth protein comprising a sequence with greater than 98% identity to an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12. In an embodiment, the invention includes an aAPC comprising an EM-2 modified to express a first protein that binds to a second protein comprising a sequence with greater than 97% identity to an amino acid sequence as set forth in SEQ ID NO:14 and a third protein that binds to a fourth protein comprising a sequence with greater than 97% identity to an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12. In an embodiment, the invention includes an aAPC comprising an EM-2 cell modified to express a first protein that binds to a second protein comprising a sequence with greater than 96% identity to an amino acid sequence as set forth in SEQ ID NO:14 and a third protein that binds to a fourth protein comprising a sequence with greater than 96% identity to an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12. In an embodiment, the invention includes an aAPC comprising an EM-2 cell modified to express a first protein that binds to a second protein comprising a sequence with greater than 95% identity to an amino acid sequence as set forth in SEQ ID NO:14 and a third protein that binds to a fourth protein comprising a sequence with greater than 95% identity to an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12. In an embodiment, the invention includes an aAPC comprising an EM-2 cell modified to express a first protein that binds to a second protein comprising a sequence with greater than 90% identity to an amino acid sequence as set forth in SEQ ID NO:14 and a third protein that binds to a fourth protein comprising a sequence with greater than 90% identity to an amino acid sequence as set forth in SEQ ID NO:11 or SEQ ID NO:12. In an embodiment, the invention includes a method of preparing any of the foregoing embodiments of aAPCs.
[0464] In an embodiment, the invention includes an aAPC comprising an EM-2 cell modified to express a single chain fragment variable (scFv) binding domain, such as clones 7C12 and 8B3 described herein, to bind the Fc domain of a monoclonal antibody, such as OKT-3, providing an additional proliferative signal.
[0465] In an embodiment, the invention includes an aAPC comprising an EM-3 or an EM-2 cell modified as depicted in
[0466] In any of the foregoing embodiments, it is understood that an aAPC comprising an EM-3 or EM-2 cell may be modified to express both OX40L and 4-1BBL.
[0467] In an embodiment, the invention includes an isolated artificial antigen presenting cell (aAPC) comprising a cell that expresses CD58, and is modified to express one or more costimulatory molecules, wherein the aAPC is derived from a K562-lineage parental cell line. In an embodiment, the invention includes an aAPC comprising a K562-lineage cell that is modified to express one or more costimulatory molecules. In an embodiment, the K562 lineage parental cell line is deposited under accession no. ATCC CCL-243 and also at European Collection of Authenticated Cell Cultures (ECACCECACC 89121407).
[0468] In an embodiment, the invention includes an aAPC comprising a K562-lineage cell that expresses CD58, wherein the cell is modified to express a CD86 protein comprising an amino acid sequence as set forth in SEQ ID NO:8, and conservative amino acid substitutions thereof, and a 4-1BBL protein comprising an amino acid sequence as set forth in SEQ ID NO:9, and conservative amino acid substitutions thereof, and wherein the CD86 protein and the 4-1BBL protein are expressed on the surface of the K562-lineage cell.
[0469] In an embodiment, the invention includes an aAPC comprising a K562-lineage cell transduced with one or more viral vectors, wherein the one or more viral vectors comprise a nucleic acid encoding CD86 and a nucleic acid encoding 4-1BBL, and wherein the K562-lineage cell expresses CD86 and 4-1BBL. In an embodiment, the invention includes a method of preparing any of the foregoing embodiments of aAPCs.
[0470] In an embodiment, the invention includes an aAPC comprising a K562-lineage cell modified to express a CD86 protein comprising an amino acid sequence as set forth in SEQ ID NO:8 and a 4-1BBL protein comprising an amino acid sequence as set forth in SEQ ID NO:9, wherein the CD86 protein and the 4-1BBL protein are expressed on the surface of the K562-lineage cell. In an embodiment, the invention includes a method of preparing any of the foregoing embodiments of aAPCs.
[0471] In an embodiment, the invention includes an aAPC comprising a K562-lineage cell modified to express a CD86 protein comprising a sequence with greater than 99% identity to an amino acid sequence as set forth in SEQ ID NO:8 and a 4-1BBL protein comprising a sequence with greater than 99% identity to an amino acid sequence as set forth in SEQ ID NO:9, wherein the CD86 protein and the 4-1BBL protein are expressed on the surface of the K562-lineage cell. In an embodiment, the invention includes an aAPC comprising a K562-lineage cell modified to express a CD86 protein comprising a sequence with greater than 98% identity to an amino acid sequence as set forth in SEQ ID NO:8 and a 4-1BBL protein comprising a sequence with greater than 98% identity to an amino acid sequence as set forth in SEQ ID NO:9, wherein the CD86 protein and the 4-1BBL protein are expressed on the surface of the K562-lineage cell. In an embodiment, the invention includes an aAPC comprising a K562-lineage cell modified to express a CD86 protein comprising a sequence with greater than 97% identity to an amino acid sequence as set forth in SEQ ID NO:8 and a 4-1BBL protein comprising a sequence with greater than 97% identity to an amino acid sequence as set forth in SEQ ID NO:9, wherein the CD86 protein and the 4-1BBL protein are expressed on the surface of the K562-lineage cell. In an embodiment, the invention includes an aAPC comprising a K562-lineage cell modified to express a CD86 protein comprising a sequence with greater than 96% identity to an amino acid sequence as set forth in SEQ ID NO:8 and a 4-1BBL protein comprising a sequence with greater than 96% identity to an amino acid sequence as set forth in SEQ ID NO:9, wherein the CD86 protein and the 4-1BBL protein are expressed on the surface of the K562-lineage cell. In an embodiment, the invention includes an aAPC comprising a K562-lineage cell modified to express a CD86 protein comprising a sequence with greater than 95% identity to an amino acid sequence as set forth in SEQ ID NO:8 and a 4-1BBL protein comprising a sequence with greater than 95% identity to an amino acid sequence as set forth in SEQ ID NO:9, wherein the CD86 protein and the 4-1BBL protein are expressed on the surface of the K562-lineage cell. In an embodiment, the invention includes an aAPC comprising a K562-lineage cell modified to express a CD86 protein comprising a sequence with greater than 90% identity to an amino acid sequence as set forth in SEQ ID NO:8 and a 4-1BBL protein comprising a sequence with greater than 90% identity to an amino acid sequence as set forth in SEQ ID NO:9, wherein the CD86 protein and the 4-1BBL protein are expressed on the surface of the K562-lineage cell. In an embodiment, the invention includes a method of preparing any of the foregoing embodiments of aAPCs.
[0472] In an embodiment, the invention includes an aAPC comprising a K562-lineage cell modified to express a first protein that binds to a second protein comprising an amino acid sequence as set forth in SEQ ID NO:11, and conservative amino acid substitutions thereof, and a third protein that binds to a fourth protein comprising an amino acid sequence as set forth in SEQ ID NO:12 or SEQ ID NO:13, and conservative amino acid substitutions thereof. In an embodiment, the invention includes a method of preparing any of the foregoing embodiments of aAPCs.
[0473] In an embodiment, the invention includes an aAPC comprising a K562-lineage cell modified to express a first protein that binds to a second protein comprising a sequence with greater than 99% identity to an amino acid sequence as set forth in SEQ ID NO:11 and a third protein that binds to a fourth protein comprising a sequence with greater than 99% identity to an amino acid sequence as set forth in SEQ ID NO:12 or SEQ ID NO:13. In an embodiment, the invention includes an aAPC comprising a K562-lineage cell modified to express a first protein that binds to a second protein comprising a sequence with greater than 98% identity to an amino acid sequence as set forth in SEQ ID NO:11 and a third protein that binds to a fourth protein comprising a sequence with greater than 98% identity to an amino acid sequence as set forth in SEQ ID NO:12 or SEQ ID NO:13. In an embodiment, the invention includes an aAPC comprising a K562-lineage modified to express a first protein that binds to a second protein comprising a sequence with greater than 97% identity to an amino acid sequence as set forth in SEQ ID NO:11 and a third protein that binds to a fourth protein comprising a sequence with greater than 97% identity to an amino acid sequence as set forth in SEQ ID NO:12 or SEQ ID NO:13. In an embodiment, the invention includes an aAPC comprising a K562-lineage cell modified to express a first protein that binds to a second protein comprising a sequence with greater than 96% identity to an amino acid sequence as set forth in SEQ ID NO:11 and a third protein that binds to a fourth protein comprising a sequence with greater than 96% identity to an amino acid sequence as set forth in SEQ ID NO:12 or SEQ ID NO:13. In an embodiment, the invention includes an aAPC comprising a K562-lineage cell modified to express a first protein that binds to a second protein comprising a sequence with greater than 95% identity to an amino acid sequence as set forth in SEQ ID NO:11 and a third protein that binds to a fourth protein comprising a sequence with greater than 95% identity to an amino acid sequence as set forth in SEQ ID NO:12 or SEQ ID NO:13. In an embodiment, the invention includes an aAPC comprising a K562-lineage cell modified to express a first protein that binds to a second protein comprising a sequence with greater than 90% identity to an amino acid sequence as set forth in SEQ ID NO:11 and a third protein that binds to a fourth protein comprising a sequence with greater than 90% identity to an amino acid sequence as set forth in SEQ ID NO:12 or SEQ ID NO:13. In an embodiment, the invention includes a method of preparing any of the foregoing embodiments of aAPCs.
[0474] In an embodiment, the invention includes an aAPC comprising an K562-lineage cell modified to express a single chain fragment variable (scFv) binding domain, such as clones 7C12 and 8B3 described herein, to bind the Fc domain of a monoclonal antibody, such as OKT-3, providing an additional proliferative signal.
Methods of Preparing Artificial Antigen Presenting Cells
[0475] In an embodiment, a method of preparing an aAPC includes the step of stable incorporation of genes for production of CD86 and 4-1BBL. In an embodiment, a method of preparing an aAPC includes the step of retroviral transduction. In an embodiment, a method of preparing an aAPC includes the step of lentiviral transduction. Lentiviral transduction systems are known in the art and are described, e.g., in Levine, et al., Proc. Nat'l Acad. Sci. 2006, 103, 17372-77; Zufferey, et al., Nat. Biotechnol. 1997, 15, 871-75; Dull, et al., J. Virology 1998, 72, 8463-71, and U.S. Pat. No. 6,627,442, the disclosures of each of which are incorporated by reference herein. In an embodiment, a method of preparing an aAPC includes the step of gamma-retroviral transduction. Gamma-retroviral transduction systems are known in the art and are described, e.g., Cepko and Pear, Cur. Prot. Mol. Biol. 1996, 9.9.1-9.9.16, the disclosure of which is incorporated by reference herein. In an embodiment, a method of preparing an aAPC includes the step of transposon-mediated gene transfer. Transposon-mediated gene transfer systems are known in the art and include systems wherein the transposase is provided as DNA expression vector or as an expressible RNA or a protein such that long-term expression of the transposase does not occur in the transgenic cells, for example, a transposase provided as an mRNA (e.g., an mRNA comprising a cap and poly-A tail). Suitable transposon-mediated gene transfer systems, including the salmonid-type Tel-like transposase (SB or Sleeping Beauty transposase), such as SB10, SB11, and SB100x, and engineered enzymes with increased enzymatic activity, are described in, e.g., Hackett, et al., Mol. Therapy 2010, 18, 674-83 and U.S. Pat. No. 6,489,458, the disclosures of each of which are incorporated by reference herein.
[0476] In an embodiment, a method of preparing an aAPC includes the step of stable incorporation of genes for transient production of CD86 and 4-1BBL. In an embodiment, a method of preparing an aAPC includes the step of electroporation. Electroporation methods are known in the art and are described, e.g., in Tsong, Biophys. J. 1991, 60, 297-306, and U.S. Patent Application Publication No. 2014/0227237 A1, the disclosures of each of which are incorporated by reference herein. In an embodiment, a method of preparing an aAPC includes the step of calcium phosphate transfection. Calcium phosphate transfection methods (calcium phosphate DNA precipitation, cell surface coating, and endocytosis) are known in the art and are described in Graham and van der Eb, Virology 1973, 52, 456-467; Wigler, et al., Proc. Natl. Acad. Sci. 1979, 76, 1373-1376; and Chen and Okayarea, Mol. Cell. Biol. 1987, 7, 2745-2752; and in U.S. Pat. No. 5,593,875, the disclosures of each of which are incorporated by reference herein. In an embodiment, a method of preparing an aAPC includes the step of liposomal transfection. Liposomal transfection methods, such as methods that employ a 1:1 (w/w) liposome formulation of the cationic lipid N-[1-(2,3-dioleyloxy)propyl]-n,n,n-trimethylammonium chloride (DOTMA) and dioleoyl phophotidylethanolamine (DOPE) in filtered water, are known in the art and are described in Rose, et al., Biotechniques 1991, 10, 520-525 and Felgner, et al., Proc. Natl. Acad. Sci. USA, 1987, 84, 7413-7417 and in U.S. Pat. Nos. 5,279,833; 5,908,635; 6,056,938; 6,110,490; 6,534,484; and 7,687,070, the disclosures of each of which are incorporated by reference herein. In an embodiment, a method of preparing an aAPC includes the step of transfection using methods described in U.S. Pat. Nos. 5,766,902; 6,025,337; 6,410,517; 6,475,994; and 7,189,705; the disclosures of each of which are incorporated by reference herein.
[0477] In an embodiment, the aAPC is transduced by first using the Gateway cloning method (commercially available from ThermoFisher, Inc.) to prepare vector for lentiviral transduction, followed by lentiviral transduction using the vector and one or more associated helper plasmids, as is also described elsewhere herein. In the Gateway cloning method, a gene is selected (such as CD86) and is then provided with primers and amplified using PCR technology with the help of an attB tagged primer pair. The PCR fragment is then combined with a donor vector (pDONR, such as pDONR221) that includes attP sites to provide an entry clone, using the BP reaction. An integration reaction between the attB and the attP sites combines the PCR fragment with the donor vector. The resulting entry clone contains the gene of interest flanked by attL sites. The LR reaction is then used to combine the entry clone with a destination vector to produce an expression vector. In the LR reaction, a recombination reaction is used to link the entry clone with the destination vector (such as pLV430G) using the attL and attR sites and a clonase enzyme. The attL sites are already found in the entry clone, while the destination vector includes the attR sites. The LR reaction is carried out to transfer the sequence of interest into one or more destination vectors in simultaneous reactions.
[0478] In some embodiments, the aAPCs described herein may be grown and maintained under serum-based media and/or serum free media. According to an exemplary method, aAPCs may be cultured in 24 well plates at a cell density of about 1?10.sup.6 cells per well for 3 to 5 days. The cells may then be isolated and/or washed by centrifugation and resuspended in media or cryopreserved in an appropriate cryopreservation media (e.g., CryoStor 10 (BioLife Solutions)) and stored in a ?80? C. freezer.
[0479] In some embodiments, the aAPCs described herein may be grown in the presence of serum-based media. In some embodiments, the aAPCs described herein by may be grown in the presence of serum-based media that includes human serum (hSerum) containing media (e.g., cDMEM with 10% hSerum). In some embodiments, the aAPCs grown in the presence of serum-based media may be selected from the group consisting of aMOLM-13 cells, aMOLM-14 cells, and aEM3 cells.
[0480] In some embodiments, the aAPCs described herein may be grown in the presence of serum free media. In some embodiments, the serum free media may be selected from the group consisting of CTS Optmizer (ThermoFisher), Xvivo-20 (Lonza), Prime T Cell CDM (Irvine), XFSM (MesenCult), and the like. In some embodiments, the aAPCs grown in the presence of serum free media may be selected from the group consisting of aMOLM-13 cells, aMOLM-14 cells, and aEM3 cells.
Methods of Expanding Tumor Infiltrating Lymphocytes and T Cells
[0481] In an embodiment, the invention includes a method of expanding tumor infiltrating lymphocytes (TILs), the method comprising contacting a population of TILs comprising at least one TIL with an aAPC described herein, wherein said aAPC comprises at least one co-stimulatory ligand that specifically binds with a co-stimulatory molecule expressed on the cellular surface of the TILs, wherein binding of said co-stimulatory molecule with said co-stimulatory ligand induces proliferation of the TILs, thereby specifically expanding TILs.
[0482] In an embodiment, the invention provides a method of expanding a population of tumor infiltrating lymphocytes (TILs) using any of the aAPCs of the present disclosure, the method comprising the steps as described in Jin, et al., J. Immunotherapy 2012, 35, 283-292, the disclosure of which is incorporated by reference herein. For example, the tumor may be placed in enzyme media and mechanically dissociated for approximately 1 minute. The mixture may then be incubated for 30 minutes at 37? C. in 5% CO.sub.2 and then mechanically disrupted again for approximately 1 minute. After incubation for 30 minutes at 37? C. in 5% CO.sub.2, the tumor may be mechanically disrupted a third time for approximately 1 minute. If after the third mechanical disruption, large pieces of tissue are present, 1 or 2 additional mechanical dissociations may be applied to the sample, with or without 30 additional minutes of incubation at 37? C. in 5% CO.sub.2. At the end of the final incubation, if the cell suspension contains a large number of red blood cells or dead cells, a density gradient separation using Ficoll may be performed to remove these cells. TIL cultures were initiated in 24-well plates (Costar 24-well cell culture cluster, flat bottom; Corning Incorporated, Corning, N.Y.), each well may be seeded with 1?10.sup.6tumor digest cells or one tumor fragment approximately 1 to 8 mm.sup.3 in size in 2 mL of complete medium (CM) with IL-2 (6000 IU/mL; Chiron Corp., Emeryville, Calif.). CM consists of RPMI 1640 with GlutaMAX, supplemented with 10% human AB serum, 25 mM Hepes, and 10 mg/mL gentamicin. Cultures may be initiated in gas-permeable flasks with a 40 mL capacity and a 10 cm.sup.2 gas-permeable silicon bottom (G-Rex 10; Wilson Wolf Manufacturing, New Brighton, each flask may be loaded with 10-40?10.sup.6 viable tumor digest cells or 5-30 tumor fragments in 10-40 mL of CM with IL-2. G-Rex 10 and 24-well plates may be incubated in a humidified incubator at 37? C. in 5% CO.sub.2 and 5 days after culture initiation, half the media may be removed and replaced with fresh CM and IL-2 and after day 5, half the media may be changed every 2-3 days. Rapid expansion protocol (REP) of TILs may be performed using T-175 flasks and gas-permeable bags or gas-permeable G-Rex flasks, as described elsewhere herein, using the aAPCs of the present disclosure. For REP in T-175 flasks, 1?10.sup.6 TILs may be suspended in 150 mL of media in each flask. The TIL may be cultured with aAPCs of the present disclosure at a ratio described herein, in a 1 to 1 mixture of CM and AIM-V medium (50/50 medium), supplemented with 3000 IU/mL of IL-2 and 30 ng/mL of anti-CD3 antibody (OKT-3). The T-175 flasks may be incubated at 37? C. in 5% CO.sub.2. Half the media may be changed on day 5 using 50/50 medium with 3000 IU/mL of IL-2. On day 7, cells from 2 T-175 flasks may be combined in a 3L bag and 300 mL of AIM-V with 5% human AB serum and 3000 IU/mL of IL-2 may be added to the 300 mL of TIL suspension. The number of cells in each bag may be counted every day or two days, and fresh media may be added to keep the cell count between 0.5 and 2.0?10.sup.6 cells/mL. For REP in 500 mL capacity flasks with 100 cm.sup.2 gas-permeable silicon bottoms (e.g., G-Rex 100, Wilson Wolf Manufacturing, as described elsewhere herein), 5?10.sup.6 or 10?10.sup.6 TILs may be cultured with aAPCs at a ratio described herein (e.g., 1 to 100) in 400 mL of 50/50 medium, supplemented with 3000 IU/mL of IL-2 and 30 ng/mL of anti-CD3 antibody (OKT-3). The G-Rex 100 flasks may be incubated at 37? C. in 5% CO.sub.2. On day five, 250 mL of supernatant may be removed and placed into centrifuge bottles and centrifuged at 1500 rpm (491 g) for 10 minutes. The obtained TIL pellets may be resuspended with 150 mL of fresh 50/50 medium with 3000 IU/mL of IL-2 and added back to the G-Rex 100 flasks. When TIL are expanded serially in G-Rex 100 flasks, on day seven the TIL in each G-Rex100 are suspended in the 300 mL of media present in each flask and the cell suspension may be divided into three 100 mL aliquots that may be used to seed 3 G-Rex100 flasks. About 150 mL of AIM-V with 5% human AB serum and 3000 IU/mL of IL-2 may then be added to each flask. G-Rex100 flasks may then be incubated at 37? C. in 5% CO.sub.2, and after four days, 150 mL of AIM-V with 3000 IU/mL of IL-2 may be added to each G-Rex100 flask. After this, the REP may be completed by harvesting cells on day 14 of culture.
[0483] As described herein, TILs may be expanded advantageously in the presence of serum free media. In some embodiments, the TIL expansion methods described herein may include the use of serum free media rather than serum-based media (e.g., complete media or CM1). In some embodiments, the TIL expansion methods described herein may use serum free media rather than serum-based media. In some embodiments, the serum free media may be selected from the group consisting of CTS Optmizer (ThermoFisher), Xvivo-20 (Lonza), Prime T Cell CDM (Irvine), and the like.
[0484] In an embodiment, the invention provides a method of expanding a population of tumor infiltrating lymphocytes (TILs), the method comprising the steps of: [0485] (a) transducing a myeloid cell with one or more viral vectors to obtain a population of artificial antigen presenting cells (aAPCs), wherein the one or more viral vectors comprise a nucleic acid encoding CD86 and a nucleic acid encoding 4-1BBL, and wherein the myeloid cell expresses a CD86 protein and a 4-1BBL protein, and [0486] (b) contacting the population of TILs with the population of aAPCs in a cell culture medium.
[0487] In an embodiment, the invention provides a method of expanding a population of tumor infiltrating lymphocytes (TILs), the method comprising the steps of: [0488] (a) transducing a myeloid cell with one or more viral vectors to obtain a population of artificial antigen presenting cells (aAPCs), wherein the one or more viral vectors comprise a nucleic acid encoding CD86 and a nucleic acid encoding 4-1BBL, and wherein the myeloid cell expresses a CD86 protein and a 4-1BBL protein, and [0489] (b) contacting the population of TILs with the population of aAPCs in a cell culture medium, [0490] wherein the cell culture medium further comprises IL-2 at an initial concentration of about 3000 IU/mL and OKT-3 antibody at an initial concentration of about 30 ng/mL.
[0491] In an embodiment, the invention provides a method of expanding a population of tumor infiltrating lymphocytes (TILs), the method comprising the steps of: [0492] (a) transducing a myeloid cell with one or more viral vectors to obtain a population of artificial antigen presenting cells (aAPCs), wherein the one or more viral vectors comprise a nucleic acid encoding CD86 and a nucleic acid encoding 4-1BBL, and wherein the myeloid cell expresses a CD86 protein and a 4-1BBL protein, and [0493] (b) contacting the population of TILs with the population of aAPCs in a cell culture medium, [0494] wherein the population of APCs expands the population of TILs by at least 50-fold over a period of 7 days in a cell culture medium.
[0495] In an embodiment, the invention provides a method of expanding a population of tumor infiltrating lymphocytes (TILs), the method comprising the steps of: [0496] (a) transducing a myeloid cell with one or more viral vectors to obtain a population of artificial antigen presenting cells (aAPCs), wherein the one or more viral vectors comprise a nucleic acid encoding CD86 and a nucleic acid encoding 4-1BBL, and wherein the myeloid cell expresses a CD86 protein and a 4-1BBL protein, and [0497] (b) contacting the population of TILs with the population of aAPCs in a cell culture medium, [0498] wherein the myeloid cell endogenously expresses HLA-A/B/C, ICOS-L, and CD58.
[0499] In an embodiment, the invention provides a method of expanding a population of tumor infiltrating lymphocytes (TILs), the method comprising the steps of: [0500] (a) transducing a myeloid cell with one or more viral vectors to obtain a population of artificial antigen presenting cells (aAPCs), wherein the one or more viral vectors comprise a nucleic acid encoding CD86 and a nucleic acid encoding 4-1BBL, and wherein the myeloid cell expresses a CD86 protein and a 4-1BBL protein, and [0501] (b) contacting the population of TILs with the population of aAPCs in a cell culture medium, [0502] wherein the myeloid cell is a MOLM-14 cell.
[0503] In an embodiment, the invention provides a method of expanding a population of tumor infiltrating lymphocytes (TILs), the method comprising the steps of: [0504] (a) transducing a myeloid cell with one or more viral vectors to obtain a population of artificial antigen presenting cells (aAPCs), wherein the one or more viral vectors comprise a nucleic acid encoding CD86 and a nucleic acid encoding 4-1BBL, and wherein the myeloid cell expresses a CD86 protein and a 4-1BBL protein, and [0505] (b) contacting the population of TILs with the population of aAPCs in a cell culture medium, [0506] wherein the myeloid cell is a MOLM-13 cell.
[0507] In an embodiment, the invention provides a method of expanding a population of tumor infiltrating lymphocytes (TILs), the method comprising the steps of: [0508] (c) transducing a myeloid cell with one or more viral vectors to obtain a population of artificial antigen presenting cells (aAPCs), wherein the one or more viral vectors comprise a nucleic acid encoding CD86 and a nucleic acid encoding 4-1BBL, and wherein the myeloid cell expresses a CD86 protein and a 4-1BBL protein, and [0509] (d) contacting the population of TILs with the population of aAPCs in a cell culture medium, [0510] wherein the myeloid cell is a EM-3 cell.
[0511] In an embodiment, the invention provides a method of expanding a population of tumor infiltrating lymphocytes (TILs), the method comprising the steps of: [0512] (a) transducing a myeloid cell with one or more viral vectors to obtain a population of artificial antigen presenting cells (aAPCs), wherein the one or more viral vectors comprise a nucleic acid encoding CD86 and a nucleic acid encoding 4-1BBL, and wherein the myeloid cell expresses a CD86 protein and a 4-1BBL protein, and [0513] (b) contacting the population of TILs with the population of aAPCs in a cell culture medium, [0514] wherein the CD86 protein comprises an amino acid sequence as set forth in SEQ ID NO:8, or conservative amino acid substitutions thereof, and the 4-1BBL protein comprises an amino acid sequence as set forth in SEQ ID NO:9, or conservative amino acid substitutions thereof.
[0515] In an embodiment, the invention provides a method of expanding a population of tumor infiltrating lymphocytes (TILs), the method comprising the steps of: [0516] (a) transducing a myeloid cell with one or more viral vectors to obtain a population of artificial antigen presenting cells (aAPCs), wherein the one or more viral vectors comprise a nucleic acid encoding CD86 and a nucleic acid encoding 4-1BBL, and wherein the myeloid cell expresses a CD86 protein and a 4-1BBL protein, and [0517] (b) contacting the population of TILs with the population of aAPCs in a cell culture medium, [0518] wherein the nucleic acid encoding CD86 comprises a nucleic acid sequence as set forth in SEQ ID NO:19 and the nucleic acid encoding 4-1BBL comprises a nucleic acid sequence as set forth in SEQ ID NO:16.
[0519] In an embodiment, the invention provides a method of expanding a population of tumor infiltrating lymphocytes (TILs), the method comprising the steps of: [0520] (a) transducing a myeloid cell with one or more viral vectors to obtain a population of artificial antigen presenting cells (aAPCs), wherein the one or more viral vectors comprise a nucleic acid encoding CD86 and a nucleic acid encoding 4-1BBL, and wherein the myeloid cell expresses a CD86 protein and a 4-1BBL protein, and [0521] (b) contacting the population of TILs with the population of aAPCs in a cell culture medium, [0522] wherein the expansion is performed using a gas permeable container.
[0523] In an embodiment, the invention provides a method of expanding a population of tumor infiltrating lymphocytes (TILs), the method comprising the steps of: [0524] (a) transducing a myeloid cell with one or more viral vectors to obtain a population of artificial antigen presenting cells (aAPCs), wherein the one or more viral vectors comprise a nucleic acid encoding CD86 and a nucleic acid encoding 4-1BBL, and wherein the myeloid cell expresses a CD86 protein and a 4-1BBL protein, and [0525] (b) contacting the population of TILs with the population of aAPCs in a cell culture medium, [0526] wherein the ratio of the population of TILs to the population of aAPCs is between 1 to 200 and 1 to 400.
[0527] In an embodiment, the invention provides a method of expanding a population of tumor infiltrating lymphocytes (TILs), the method comprising the steps of: [0528] (a) transducing a myeloid cell with one or more viral vectors to obtain a population of artificial antigen presenting cells (aAPCs), wherein the one or more viral vectors comprise a nucleic acid encoding CD86 and a nucleic acid encoding 4-1BBL, and wherein the myeloid cell expresses a CD86 protein and a 4-1BBL protein, and [0529] (b) contacting the population of TILs with the population of aAPCs in a cell culture medium, [0530] wherein the ratio of the population of TILs to the population of aAPCs is about 1 to 300.
[0531] In an embodiment, the invention provides a method of expanding tumor infiltrating lymphocytes (TILs), the method comprising contacting a population of TILs comprising a population of TILs with a myeloid artificial antigen presenting cell (aAPC), wherein the myeloid aAPC comprises at least two co-stimulatory ligands that specifically bind with at least two co-stimulatory molecule on the TILs, wherein binding of the co-stimulatory molecules with the co-stimulatory ligand induces proliferation of the TILs, thereby specifically expanding TILs, and wherein the at least two co-stimulatory ligands comprise CD86 and 4-1BBL.
[0532] In any of the foregoing embodiments, the aAPC may further comprise OX40L in addition to 4-1BBL, or may comprise OX40L instead of 4-1BBL.
[0533] In an embodiment, a method of expanding or treating a cancer includes a step wherein TILs are obtained from a patient tumor sample. A patient tumor sample may be obtained using methods known in the art. For example, TILs may be cultured from enzymatic tumor digests and tumor fragments (about 1 to about 8 mm.sup.3 in size) from sharp dissection. Such tumor digests may be produced by incubation in enzymatic media (e.g., Roswell Park Memorial Institute (RPMI) 1640 buffer, 2 mM glutamate, 10 mcg/mL gentamicine, 30 units/mL of DNase and 1.0 mg/mL of collagenase) followed by mechanical dissociation (e.g., using a tissue dissociator). Tumor digests may be produced by placing the tumor in enzymatic media and mechanically dissociating the tumor for approximately 1 minute, followed by incubation for 30 minutes at 37? C. in 5% CO.sub.2, followed by repeated cycles of mechanical dissociation and incubation under the foregoing conditions until only small tissue pieces are present. At the end of this process, if the cell suspension contains a large number of red blood cells or dead cells, a density gradient separation using FICOLL branched hydrophilic polysaccharide may be performed to remove these cells. Alternative methods known in the art may be used, such as those described in U.S. Patent Application Publication No. 2012/0244133 A1, the disclosure of which is incorporated by reference herein. Any of the foregoing methods may be used in any of the embodiments described herein for methods of expanding TILs or methods treating a cancer.
[0534] In an embodiment, REP can be performed in a gas permeable container using the aAPCs of the present disclosure by any suitable method. For example, TILs can be rapidly expanded using non-specific T cell receptor stimulation in the presence of interleukin-2 (IL-2) or interleukin-15 (IL-15). The non-specific T cell receptor stimulus can include, for example, about 30 ng/mL of an anti-CD3 antibody, e.g. OKT-3, a monoclonal anti-CD3 antibody (commercially available from Ortho-McNeil, Raritan, N.J., USA or Miltenyi Biotech, Auburn, Calif., USA) or UHCT-1 (commercially available from BioLegend, San Diego, Calif., USA). TILs can be rapidly expanded by further stimulation of the TILs in vitro with one or more antigens, including antigenic portions thereof, such as epitope(s), of the cancer, which can be optionally expressed from a vector, such as a human leukocyte antigen A2 (HLA-A2) binding peptide, e.g., 0.3 ?M MART-1:26-35 (27 L) or gpl 00:209-217 (210M), optionally in the presence of a T cell growth factor, such as 300 IU/mL IL-2 or IL-15. Other suitable antigens may include, e.g., NY-ESO-1, TRP-1, TRP-2, tyrosinase cancer antigen, MAGE-A3, SSX-2, and VEGFR2, or antigenic portions thereof. TIL may also be rapidly expanded by re-stimulation with the same antigen(s) of the cancer pulsed onto HLA-A2-expressing antigen-presenting cells. Alternatively, the TILs can be further re-stimulated with, e.g., example, irradiated, autologous lymphocytes or with irradiated HLA-A2+allogeneic lymphocytes and IL-2.
[0535] In an embodiment, a method for expanding TILs may include using about 5000 mL to about 25000 mL of cell culture medium, about 5000 mL to about 10000 mL of cell culture medium, or about 5800 mL to about 8700 mL of cell culture medium. In an embodiment, a method for expanding TILs may include using about 1000 mL to about 2000 mL of cell medium, about 2000 mL to about 3000 mL of cell culture medium, about 3000 mL to about 4000 mL of cell culture medium, about 4000 mL to about 5000 mL of cell culture medium, about 5000 mL to about 6000 mL of cell culture medium, about 6000 mL to about 7000 mL of cell culture medium, about 7000 mL to about 8000 mL of cell culture medium, about 8000 mL to about 9000 mL of cell culture medium, about 9000 mL to about 10000 mL of cell culture medium, about 10000 mL to about 15000 mL of cell culture medium, about 15000 mL to about 20000 mL of cell culture medium, or about 20000 mL to about 25000 mL of cell culture medium. In an embodiment, expanding the number of TILs uses no more than one type of cell culture medium. Any suitable cell culture medium may be used, e.g., AIM-V cell medium (L-glutamine, 50 ?M streptomycin sulfate, and 10 ?M gentamicin sulfate) cell culture medium (Invitrogen, Carlsbad, Calif., USA). In this regard, the inventive methods advantageously reduce the amount of medium and the number of types of medium required to expand the number of TIL. In an embodiment, expanding the number of TIL may comprise feeding the cells no more frequently than every third or fourth day. Expanding the number of cells in a gas permeable container simplifies the procedures necessary to expand the number of cells by reducing the feeding frequency necessary to expand the cells.
[0536] In an embodiment, the rapid expansion is performed using a gas permeable container. Such embodiments allow for cell populations to expand from about 5?10.sup.5 cells/cm.sup.2 to between 10?10.sup.6 and 30?10.sup.6 cells/cm.sup.2. In an embodiment, this expansion occurs without feeding. In an embodiment, this expansion occurs without feeding so long as medium resides at a height of about 10 cm in a gas-permeable flask. In an embodiment this is without feeding but with the addition of one or more cytokines. In an embodiment, the cytokine can be added as a bolus without any need to mix the cytokine with the medium. Such containers, devices, and methods are known in the art and have been used to expand TILs, and include those described in U.S. Patent Application Publication No. US 2014/0377739 A1, International Patent Application Publication No. WO 2014/210036 A1, U.S. Patent Application Publication No. US 2013/0115617 A1, International Publication No. WO 2013/188427 A1, U.S. Patent Application Publication No. US 2011/0136228 A1, U.S. Pat. No. 8,809,050, International Patent Application Publication No. WO 2011/072088 A2, U.S. Patent Application Publication No. US 2016/0208216 A1, U.S. Patent Application Publication No. US 2012/0244133 A1, International Patent Application Publication No. WO 2012/129201 A1, U.S. Patent Application Publication No. US 2013/0102075 A1, U.S. Patent No. 8,956,860, International Patent Application Publication No. WO 2013/173835 A1, and U.S. Patent Application Publication No. US 2015/0175966 A1, the disclosures of which are incorporated herein by reference. Such processes are also described in Jin, et al., J. Immunotherapy 2012, 35, 283-292, the disclosure of which is incorporated by reference herein.
[0537] In an embodiment, the gas permeable container is a G-Rex 10 flask (Wilson Wolf Manufacturing Corporation, New Brighton, Minn., USA). In an embodiment, the gas permeable container includes a 10 cm.sup.2 gas permeable culture surface. In an embodiment, the gas permeable container includes a 40 mL cell culture medium capacity. In an embodiment, the gas permeable container provides 100 to 300 million TILs after 2 medium exchanges.
[0538] In an embodiment, the gas permeable container is a G-Rex 100 flask (Wilson Wolf Manufacturing Corporation, New Brighton, Minn., USA). In an embodiment, the gas permeable container includes a 100 cm.sup.2 gas permeable culture surface. In an embodiment, the gas permeable container includes a 450 mL cell culture medium capacity. In an embodiment, the gas permeable container provides 1 to 3 billion TILs after 2 medium exchanges.
[0539] In an embodiment, the gas permeable container is a G-Rex 100M flask (Wilson Wolf Manufacturing Corporation, New Brighton, Minn., USA). In an embodiment, the gas permeable container includes a 100 cm.sup.2 gas permeable culture surface. In an embodiment, the gas permeable container includes a 1000 mL cell culture medium capacity. In an embodiment, the gas permeable container provides 1 to 3 billion TILs without medium exchange.
[0540] In an embodiment, the gas permeable container is a G-Rex 100L flask (Wilson Wolf Manufacturing Corporation, New Brighton, Minn., USA). In an embodiment, the gas permeable container includes a 100 cm.sup.2 gas permeable culture surface. In an embodiment, the gas permeable container includes a 2000 mL cell culture medium capacity. In an embodiment, the gas permeable container provides 1 to 3 billion TILs without medium exchange.
[0541] In an embodiment, the gas permeable container is a G-Rex 24 well plate (Wilson Wolf Manufacturing Corporation, New Brighton, Minn., USA). In an embodiment, the gas permeable container includes a plate with wells, wherein each well includes a 2 cm.sup.2 gas permeable culture surface. In an embodiment, the gas permeable container includes a plate with wells, wherein each well includes a 8 mL cell culture medium capacity. In an embodiment, the gas permeable container provides 20 to 60 million cells per well after 2 medium exchanges.
[0542] In an embodiment, the gas permeable container is a G-Rex 6 well plate (Wilson Wolf Manufacturing Corporation, New Brighton, Minn., USA). In an embodiment, the gas permeable container includes a plate with wells, wherein each well includes a 10 cm.sup.2 gas permeable culture surface. In an embodiment, the gas permeable container includes a plate with wells, wherein each well includes a 40 mL cell culture medium capacity. In an embodiment, the gas permeable container provides 100 to 300 million cells per well after 2 medium exchanges.
[0543] In an embodiment, the cell medium in the first and/or second gas permeable container is unfiltered. The use of unfiltered cell medium may simplify the procedures necessary to expand the number of cells. In an embodiment, the cell medium in the first and/or second gas permeable container lacks beta-mercaptoethanol (BME).
[0544] In an embodiment, the duration of the method comprising obtaining a tumor tissue sample from the mammal; culturing the tumor tissue sample in a first gas permeable container containing cell medium therein; obtaining TILs from the tumor tissue sample; expanding the number of TILs in a second gas permeable container containing cell medium therein using aAPCs for a duration of about 14 to about 42 days, e.g., about 28 days.
[0545] In an embodiment, the rapid expansion uses about 1?10.sup.9 to about 1?10.sup.11 aAPCs. In an embodiment, the rapid expansion uses about 1?10.sup.9 aAPCs. In an embodiment, the rapid expansion uses about 1?10.sup.10 aAPCs. In an embodiment, the rapid expansion uses about 1?10.sup.11 aAPCs.
[0546] In an embodiment, the ratio of TILs to aAPCs (TIL:aAPC) is selected from the group consisting of 1:5, 1:10, 1:15, 1:20, 1:25, 1:30, 1:35, 1:40, 1:45, 1:50, 1:55, 1:60, 1:65, 1:70, 1:75, 1:80, 1:85, 1:90, 1:95, 1:100, 1:105, 1:110, 1:115, 1:120, 1:125, 1:130, 1:135, 1:140, 1:145, 1:150, 1:155, 1:160, 1:165, 1:170, 1:175, 1:180, 1:185, 1:190, 1:195, 1:200, 1:225, 1:250, 1:275, 1:300, 1:350, 1:400, 1:450, and 1:500. In a preferred embodiment, the ratio of TILs to aAPCs (TIL:aAPC) is about 1:90. In a preferred embodiment, the ratio of TILs to aAPCs (TIL:aAPC) is about 1:95. In a preferred embodiment, the ratio of TILs to aAPCs (TIL:aAPC) is about 1:100. In a preferred embodiment, the ratio of TILs to aAPCs (TIL:aAPC) is about 1:105. In a preferred embodiment, the ratio of TILs to aAPCs (TIL:aAPC) is about 1:110.
[0547] In an embodiment, the ratio of TILs to aAPCs in the rapid expansion is about 1 to 25, about 1 to 50, about 1 to 100, about 1 to 125, about 1 to 150, about 1 to 175, about 1 to 200, about 1 to 225, about 1 to 250, about 1 to 275, about 1 to 300, about 1 to 325, about 1 to 350, about 1 to 375, about 1 to 400, or about 1 to 500. In an embodiment, the ratio of TILs to aAPCs in the rapid expansion is between 1 to 50 and 1 to 300. In an embodiment, the ratio of TILs to aAPCs in the rapid expansion is between 1 to 100 and 1 to 200.
[0548] In an embodiment, the cell culture medium further comprises IL-2. In a preferred embodiment, the cell culture medium comprises about 3000 IU/mL of IL-2. In an embodiment, the cell culture medium comprises about 1000 IU/mL, about 1500 IU/mL, about 2000 IU/mL, about 2500 IU/mL, about 3000 IU/mL, about 3500 IU/mL, about 4000 IU/mL, about 4500 IU/mL, about 5000 IU/mL, about 5500 IU/mL, about 6000 IU/mL, about 6500 IU/mL, about 7000 IU/mL, about 7500 IU/mL, or about 8000 IU/mL of IL-2. In an embodiment, the cell culture medium comprises between 1000 and 2000 IU/mL, between 2000 and 3000 IU/mL, between 3000 and 4000 IU/mL, between 4000 and 5000 IU/mL, between 5000 and 6000 IU/mL, between 6000 and 7000 IU/mL, between 7000 and 8000 IU/mL, or between 8000 IU/mL of IL-2.
[0549] In an embodiment, the cell culture medium comprises an OKT-3 antibody. In a preferred embodiment, the cell culture medium comprises about 30 ng/mL of OKT-3 antibody. In an embodiment, the cell culture medium comprises about 0.1 ng/mL, about 0.5 ng/mL, about 1 ng/mL, about 2.5 ng/mL, about 5 ng/mL, about 7.5 ng/mL, about 10 ng/mL, about 15 ng/mL, about 20 ng/mL, about 25 ng/mL, about 30 ng/mL, about 35 ng/mL, about 40 ng/mL, about 50 ng/mL, about 60 ng/mL, about 70 ng/mL, about 80 ng/mL, about 90 ng/mL, about 100 ng/mL, about 200 ng/mL, about 500 ng/mL, and about 1 ?g/mL of OKT-3 antibody. In an embodiment, the cell culture medium comprises between 0.1 ng/mL and 1 ng/mL, between 1 ng/mL and 5 ng/mL, between 5 ng/mL and 10 ng/mL, between 10 ng/mL and 20 ng/mL, between 20 ng/mL and 30 ng/mL, between 30 ng/mL and 40 ng/mL, between 40 ng/mL and 50 ng/mL, and between 50 ng/mL and 100 ng/mL of OKT-3 antibody.
[0550] In an embodiment, a rapid expansion process for TILs may be performed using T-175 flasks and gas permeable bags as previously described (Tran, et al., J. Immunother. 2008, 31, 742-51; Dudley, et al., J. Immunother. 2003, 26, 332-42) or gas permeable cultureware (G-Rex flasks, commercially available from Wilson Wolf Manufacturing Corporation, New Brighton, Minn., USA). For TIL rapid expansion in T-175 flasks, 1?10.sup.6 TILs suspended in 150 mL of media may be added to each T-175 flask. The TILs may be cultured with aAPCs at a ratio of 1 TIL to 100 aAPCs and the cells were cultured in a 1 to 1 mixture of CM and AIM-V medium, supplemented with 3000 IU (international units) per mL of IL-2 and 30 ng per ml of anti-CD3 antibody (e.g., OKT-3). The T-175 flasks may be incubated at 37? C. in 5% CO.sub.2. Half the media may be exchanged on day 5 using 50/50 medium with 3000 IU per mL of IL-2. On day 7 cells from two T-175 flasks may be combined in a 3 liter bag and 300 mL of AIM V with 5% human AB serum and 3000 IU per mL of IL-2 was added to the 300 ml of TIL suspension. The number of cells in each bag was counted every day or two and fresh media was added to keep the cell count between 0.5 and 2.0?10.sup.6 cells/mL.
[0551] In an embodiment, for TIL rapid expansions in 500 mL capacity gas permeable flasks with 100 cm gas-permeable silicon bottoms (G-Rex 100, commercially available from Wilson Wolf Manufacturing Corporation, New Brighton, Minn., USA), 5?10.sup.6 or 10?10.sup.6 TIL may be cultured with aAPCs at a ratio of 1 to 100 in 400 mL of 50/50 medium, supplemented with 5% human AB serum, 3000 IU per mL of IL-2 and 30 ng per mL of anti-CD3 (OKT-3). The G-Rex 100 flasks may be incubated at 37? C. in 5% CO.sub.2. On day 5, 250 mL of supernatant may be removed and placed into centrifuge bottles and centrifuged at 1500 rpm (revolutions per minute; 491?g) for 10 minutes. The TIL pellets may be re-suspended with 150 mL of fresh medium with 5% human AB serum, 3000 IU per mL of IL-2, and added back to the original G-Rex 100 flasks. When TIL are expanded serially in G-Rex 100 flasks, on day 7 the TIL in each G-Rex 100 may be suspended in the 300 mL of media present in each flask and the cell suspension may be divided into 3 100 mL aliquots that may be used to seed 3 G-Rex 100 flasks. Then 150 mL of AIM-V with 5% human AB serum and 3000 IU per mL of IL-2 may be added to each flask. The G-Rex 100 flasks may be incubated at 37? C. in 5% CO.sub.2 and after 4 days 150 mL of AIM-V with 3000 IU per mL of IL-2 may be added to each G-Rex 100 flask. The cells may be harvested on day 14 of culture.
[0552] In an embodiment, TILs may be prepared as follows. 2 mm.sup.3 tumor fragments are cultured in complete media (CM) comprised of AIM-V medium (Invitrogen Life Technologies, Carlsbad, Calif.) supplemented with 2 mM glutamine (Mediatech, Inc. Manassas, Va.), 100 U/mL penicillin (Invitrogen Life Technologies), 100 ?g/mL streptomycin (Invitrogen Life Technologies), 5% heat-inactivated human AB serum (Valley Biomedical, Inc. Winchester, Va.) and 600 IU/mL rhIL-2 (Chiron, Emeryville, Calif.). For enzymatic digestion of solid tumors, tumor specimens were diced into RPMI-1640, washed and centrifuged at 800 rpm for 5 minutes at 15-22? C., and resuspended in enzymatic digestion buffer (0.2 mg/mL Collagenase and 30 units/ml of DNase in RPMI-1640) followed by overnight rotation at room temperature. TILs established from fragments may be grown for 3-4 weeks in CM and expanded fresh or cryopreserved in heat-inactivated HAB serum with 10% dimethylsulfoxide (DMSO) and stored at ?180? C. until the time of study. Tumor associated lymphocytes (TAL) obtained from ascites collections were seeded at 3?10.sup.6 cells/well of a 24 well plate in CM. TIL growth was inspected about every other day using a low-power inverted microscope.
[0553] In an embodiment, TILs are expanded in gas-permeable containers. Gas-permeable containers have been used to expand TILs using PBMCs using methods, compositions, and devices known in the art, including those described in U.S. Patent Application Publication No. U.S. Patent Application Publication No. 2005/0106717 A1, the disclosures of which are incorporated herein by reference. In an embodiment, TILs are expanded in gas-permeable bags. In an embodiment, TILs are expanded using a cell expansion system that expands TILs in gas permeable bags, such as the Xuri Cell Expansion System W25 (GE Healthcare). In an embodiment, TILs are expanded using a cell expansion system that expands TILs in gas permeable bags, such as the WAVE Bioreactor System, also known as the Xuri Cell Expansion System W5 (GE Healthcare). In an embodiment, the cell expansion system includes a gas permeable cell bag with a volume selected from the group consisting of about 100 mL, about 200 mL, about 300 mL, about 400 mL, about 500 mL, about 600 mL, about 700 mL, about 800 mL, about 900 mL, about 1 L, about 2 L, about 3 L, about 4 L, about 5 L, about 6 L, about 7 L, about 8 L, about 9 L, about 10 L, about 11 L, about 12 L, about 13 L, about 14 L, about 15 L, about 16 L, about 17 L, about 18 L, about 19 L, about 20 L, about 25 L, and about 30 L. In an embodiment, the cell expansion system includes a gas permeable cell bag with a volume range selected from the group consisting of between 50 and 150 mL, between 150 and 250 mL, between 250 and 350 mL, between 350 and 450 mL, between 450 and 550 mL, between 550 and 650 mL, between 650 and 750 mL, between 750 and 850 mL, between 850 and 950 mL, and between 950 and 1050 mL. In an embodiment, the cell expansion system includes a gas permeable cell bag with a volume range selected from the group consisting of between 1 L and 2 L, between 2 L and 3 L, between 3 L and 4 L, between 4 L and 5 L, between 5 L and 6 L, between 6 L and 7 L, between 7 L and 8 L, between 8 L and 9 L, between 9 L and 10 L, between 10 L and 11 L, between 11 L and 12 L, between 12 L and 13 L, between 13 L and 14 L, between 14 L and 15 L, between 15 L and 16 L, between 16 L and 17 L, between 17 L and 18 L, between 18 L and 19 L, and between 19 L and 20 L. In an embodiment, the cell expansion system includes a gas permeable cell bag with a volume range selected from the group consisting of between 0.5 L and 5 L, between 5 L and 10 L, between 10 L and 15 L, between 15 L and 20 L, between 20 L and 25 L, and between 25 L and 30 L. In an embodiment, the cell expansion system utilizes a rocking time of about 30 minutes, about 1 hour, about 2 hours, about 3 hours, about 4 hours, about 5 hours, about 6 hours, about 7 hours, about 8 hours, about 9 hours, about 10 hours, about 11 hours, about 12 hours, about 24 hours, about 2 days, about 3 days, about 4 days, about 5 days, about 6 days, about 7 days, about 8 days, about 9 days, about 10 days, about 11 days, about 12 days, about 13 days, about 14 days, about 15 days, about 16 days, about 17 days, about 18 days, about 19 days, about 20 days, about 21 days, about 22 days, about 23 days, about 24 days, about 25 days, about 26 days, about 27 days, and about 28 days. In an embodiment, the cell expansion system utilizes a rocking time of between 30 minutes and 1 hour, between 1 hour and 12 hours, between 12 hours and 1 day, between 1 day and 7 days, between 7 days and 14 days, between 14 days and 21 days, and between 21 days and 28 days. In an embodiment, the cell expansion system utilizes a rocking rate of about 2 rocks/minute, about 5 rocks/minute, about 10 rocks/minute, about 20 rocks/minute, about 30 rocks/minute, and about 40 rocks/minute. In an embodiment, the cell expansion system utilizes a rocking rate of between 2 rocks/minute and 5 rocks/minute, 5 rocks/minute and 10 rocks/minute, 10 rocks/minute and 20 rocks/minute, 20 rocks/minute and 30 rocks/minute, and 30 rocks/minute and 40 rocks/minute. In an embodiment, the cell expansion system utilizes a rocking angle of about 2?, about 3?, about 4?, about 5?, about 6?, about 7?, about 8?, about 9?, about 10?, about 11?, and about 12?. In an embodiment, the cell expansion system utilizes a rocking angle of between 2? and 3?, between 3? and 4?, between 4? and 5?, between 5? and 6?, between 6? and 7?, between 7? and 8?, between 8? and 9?, between 9? and 10?, between 10? and 11?, and between 11? and 12?.
[0554] In an embodiment, a method of expanding TILs using aAPCs further comprises a step wherein TILs are selected for superior tumor reactivity. Any selection method known in the art may be used. For example, the methods described in U.S. Patent Application Publication No. 2016/0010058 A1, the disclosures of which are incorporated herein by reference, may be used for selection of TILs for superior tumor reactivity.
[0555] In an embodiment, the aAPCs of the present invention may be used to expand T cells. Any of the foregoing embodiments of the present invention described for the expansion of TILs may also be applied to the expansion of T cells. In an embodiment, the aAPCs of the present invention may be used to expand CD8.sup.+ T cells. In an embodiment, the aAPCs of the present invention may be used to expand CD4.sup.+ T cells. In an embodiment, the aAPCs of the present invention may be used to expand T cells transduced with a chimeric antigen receptor (CAR-T). In an embodiment, the aAPCs of the present invention may be used to expand T cells comprising a modified T cell receptor (TCR). The CAR-T cells may be targeted against any suitable antigen, including CD19, as described in the art, e.g., in U.S. Pat. Nos. 7,070,995; 7,446,190; 8,399,645; 8,916,381; and 9,328,156; the disclosures of which are incorporated by reference herein. The modified TCR cells may be targeted against any suitable antigen, including NY-ESO-1, TRP-1, TRP-2, tyrosinase cancer antigen, MAGE-A3, SSX-2, and VEGFR2, or antigenic portions thereof, as described in the art, e.g., in U.S. Pat. Nos. 8,367,804 and 7,569,664, the disclosures of which are incorporated by reference herein.
Methods of Treating Cancers and Other Diseases
[0556] The compositions and methods described herein can be used in a method for treating diseases. In an embodiment, they are for use in treating hyperproliferative disorders. They may also be used in treating other disorders as described herein and in the following paragraphs. The TILs, populations and compositions thereof described herein may be for use in the treatment of a disease. In an embodiment, the TILs, populations and compositions described herein are for use in the treatment of a hyperproliferative disorder.
[0557] In some embodiments, the hyperproliferative disorder is cancer. In some embodiments, the hyperproliferative disorder is a solid tumor cancer. In some embodiments, the solid tumor cancer is selected from the group consisting of melanoma, ovarian cancer, cervical cancer, non-small-cell lung cancer (NSCLC), lung cancer, bladder cancer, breast cancer, cancer caused by human papilloma virus, head and neck cancer, renal cancer, and renal cell carcinoma, pancreatic cancer, and glioblastoma. In some embodiments, the hyperproliferative disorder is a hematological malignancy. In some embodiments, the hematological malignancy is selected from the group consisting of chronic lymphocytic leukemia, acute lymphoblastic leukemia, diffuse large B cell lymphoma, non-Hodgkin's lymphoma, Hodgkin's lymphoma, follicular lymphoma, and mantle cell lymphoma.
[0558] In an embodiment, the invention includes a method of treating a cancer with a population of tumor infiltrating lymphocytes (TILs) comprising the steps of: (a) obtaining a first population of TILs from a tumor resected from a patient; (b) performing a rapid expansion of the first population of TILs using a population of artificial antigen presenting cells (aAPCs) in a cell culture medium to obtain a second population of TILs, wherein the second population of TILs is at least 50-fold greater in number than the first population of TILs; and (c) administering a therapeutically effective portion of the second population of TILs to a patient with the cancer. In an embodiment, the aAPCs comprise MOLM-14 cells transduced with one or more viral vectors, wherein the one or more viral vectors comprise a nucleic acid encoding CD86 and a nucleic acid encoding 4-1BBL, and wherein the MOLM-14 cells express a CD86 protein and a 4-1BBL protein. In an embodiment, the rapid expansion is performed over a period not greater than 14 days.
[0559] In an embodiment, the invention includes a method of treating a cancer with a population of tumor infiltrating lymphocytes (TILs) comprising the steps of: (a) obtaining a first population of TILs from a tumor resected from a patient; (b) performing an initial expansion of the first population of TILs using a first population of artificial antigen presenting cells (aAPCs) in a first cell culture medium to obtain a second population of TILs, wherein the second population of TILs is at least 10-fold greater in number than the first population of TILs, and wherein the first cell culture medium comprises IL-2; (c) performing a rapid expansion of the second population of TILs using a second population of aAPCs in a second cell culture medium to obtain a third population of TILs, wherein the third population of TILs is at least 50-fold greater in number than the first population of TILs; and wherein the second cell culture medium comprises IL-2 and OKT-3; (d) administering a therapeutically effective portion of the third population of TILs to a patient with the cancer. In an embodiment, the aAPCs comprise MOLM-14 cells transduced with one or more viral vectors, wherein the one or more viral vectors comprise a nucleic acid encoding CD86 and a nucleic acid encoding 4-1BBL, and wherein the MOLM-14 cells express a CD86 protein and a 4-1BBL protein. In an embodiment, the rapid expansion is performed over a period not greater than 14 days. In an embodiment, the initial expansion is performed using a gas permeable container.
[0560] In an embodiment, the invention includes a method of treating a cancer with a population of tumor infiltrating lymphocytes (TILs) comprising the steps of: (a) obtaining a first population of TILs from a tumor resected from a patient; (b) performing an initial expansion of the first population of TILs in a first cell culture medium to obtain a second population of TILs, wherein the second population of TILs is at least 10-fold greater in number than the first population of TILs, and wherein the first cell culture medium comprises IL-2; (c) performing a rapid expansion of the second population of TILs using a population of artificial antigen presenting cells (aAPCs) in a second cell culture medium to obtain a third population of TILs, wherein the third population of TILs is at least 50-fold greater in number than the first population of TILs; and wherein the second cell culture medium comprises IL-2 and OKT-3; (d) administering a therapeutically effective portion of the third population of TILs to a patient with the cancer. In an embodiment, the aAPCs comprise MOLM-14 cells transduced with one or more viral vectors, wherein the one or more viral vectors comprise a nucleic acid encoding CD86 and a nucleic acid encoding 4-1BBL, and wherein the MOLM-14 cells express a CD86 protein and a 4-1BBL protein. In an embodiment, the rapid expansion is performed over a period not greater than 14 days.
[0561] In an embodiment, the invention includes a method of treating a cancer with a population of TILs, wherein a patient is pre-treated with non-myeloablative chemotherapy prior to an infusion of TILs according to the present disclosure. In an embodiment, the non-myeloablative chemotherapy is cyclophosphamide 60 mg/kg/d for 2 days (days 27 and 26 prior to TIL infusion) and fludarabine 25 mg/m.sup.2/d for 5 days (days 27 to 23 prior to TIL infusion). In an embodiment, after non-myeloablative chemotherapy and TIL infusion (at day 0) according to the present disclosure, the patient receives an intravenous infusion of IL-2 intravenously at 720,000 IU/kg every 8 hours to physiologic tolerance.
[0562] Efficacy of the compounds and combinations of compounds described herein in treating, preventing and/or managing the indicated diseases or disorders can be tested using various models known in the art, which provide guidance for treatment of human disease. For example, models for determining efficacy of treatments for ovarian cancer are described, e.g., in Mullany, et al., Endocrinology 2012, 153, 1585-92; and Fong, et al., J. Ovarian Res. 2009, 2, 12. Models for determining efficacy of treatments for pancreatic cancer are described in Herreros-Villanueva, et al., World J. Gastroenterol. 2012, 18,1286-1294. Models for determining efficacy of treatments for breast cancer are described, e.g., in Fantozzi, Breast Cancer Res. 2006, 8, 212. Models for determining efficacy of treatments for melanoma are described, e.g., in Damsky, et al., Pigment Cell & Melanoma Res. 2010, 23, 853-859. Models for determining efficacy of treatments for lung cancer are described, e.g., in Meuwissen, et al., Genes & Development, 2005, 19, 643-664. Models for determining efficacy of treatments for lung cancer are described, e.g., in Kim, Clin. Exp. Otorhinolaryngol. 2009, 2, 55-60; and Sano, Head Neck Oncol. 2009, 1, 32.
Non-Myeloablative Lymphodepletion with Chemotherapy
[0563] In an embodiment, the invention includes a method of treating a cancer with a population of TILs, wherein a patient is pre-treated with non-myeloablative chemotherapy prior to an infusion of TILs according to the present disclosure. In an embodiment, the invention provides a population of TILs obtainable by a method described herein for use in treating a cancer, wherein the population of TILs is for treating a patient which is pre-treated with non-myeloablative chemotherapy. In an embodiment, the non-myeloablative chemotherapy is cyclophosphamide 60 mg/kg/d for 2 days (days 27 and 26 prior to TIL infusion) and fludarabine 25 mg/m.sup.2/d for 5 days (days 27 to 23 prior to TIL infusion). In an embodiment, after non-myeloablative chemotherapy and TIL infusion (at day 0) according to the present disclosure, the patient receives an intravenous infusion of IL-2 (aldesleukin, commercially available as PROLEUKIN) intravenously at 720,000 IU/kg every 8 hours to physiologic tolerance.
[0564] Experimental findings indicate that lymphodepletion prior to adoptive transfer of tumor-specific T lymphocytes plays a key role in enhancing treatment efficacy by eliminating regulatory T cells and competing elements of the immune system (cytokine sinks). Accordingly, some embodiments of the invention utilize a lymphodepletion step (sometimes also referred to as immunosuppressive conditioning) on the patient prior to the introduction of the aAPC-expanded TILs of the invention.
[0565] In general, lymphodepletion is achieved using administration of fludarabine or cyclophosphamide (the active form being referred to as mafosfamide) and combinations thereof. Such methods are described in Gassner, et al., Cancer Immunol. Immunother. 2011, 60, 75-85, Muranski, et al., Nat. Clin. Pract. Oncol., 2006, 3, 668-681, Dudley, et al., J. Clin. Oncol. 2008, 26, 5233-5239, and Dudley, et al., J. Clin. Oncol. 2005, 23, 2346-2357, all of which are incorporated by reference herein in their entireties.
[0566] In some embodiments, the fludarabine is administered at a concentration of 0.5 ?g/mL-10 ?g/mL fludarabine. In some embodiments, the fludarabine is administered at a concentration of 1 ?g/mL fludarabine. In some embodiments, the fludarabine treatment is administered for 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, or 7 days or more. In some embodiments, the fludarabine is administered at a dosage of 10 mg/kg/day, 15 mg/kg/day, 20 mg/kg/day, 25 mg/kg/day, 30 mg/kg/day, 35 mg/kg/day, 40 mg/kg/day, or 45 mg/kg/day. In some embodiments, the fludarabine treatment is administered for 2-7 days at 35 mg/kg/day. In some embodiments, the fludarabine treatment is administered for 4-5 days at 35 mg/kg/day. In some embodiments, the fludarabine treatment is administered for 4-5 days at 25 mg/kg/day.
[0567] In some embodiments, the mafosfamide, the active form of cyclophosphamide, is obtained at a concentration of 0.5 ?g/ml-10 ?g/ml by administration of cyclophosphamide. In some embodiments, mafosfamide, the active form of cyclophosphamide, is obtained at a concentration of 1 ?g/mL by administration of cyclophosphamide. In some embodiments, the cyclophosphamide treatment is administered for 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, or 7 days or more. In some embodiments, the cyclophosphamide is administered at a dosage of 100 mg/m.sup.2/day, 150 mg/m.sup.2/day, 175 mg/m.sup.2/day 200 mg/m.sup.2/day, 225 mg/m.sup.2/day, 250 mg/m.sup.2/day, 275 mg/m.sup.2/day, or 300 mg/m.sup.2/day. In some embodiments, the cyclophosphamide is administered intravenously (i.v.) In some embodiments, the cyclophosphamide treatment is administered for 2-7 days at 35 mg/kg/day. In some embodiments, the cyclophosphamide treatment is administered for 4-5 days at 250 mg/m.sup.2/day i.v. In some embodiments, the cyclophosphamide treatment is administered for 4 days at 250 mg/m.sup.2/day i.v.
[0568] In some embodiments, lymphodepletion is performed by administering the fludarabine and the cyclophosphamide are together to a patient. In some embodiments, fludarabine is administered at 25 mg/m.sup.2/day i.v. and cyclophosphamide is administered at 250 mg/m.sup.2/day i.v. over 4 days.
[0569] In an embodiment, the lymphodepletion is performed by administration of cyclophosphamide at a dose of 60 mg/m.sup.2/day for two days followed by administration of fludarabine at a dose of 25 mg/m.sup.2/day for five days.
Pharmaceutical Compositions, Dosages, and Dosing Regimens
[0570] In an embodiment, TILs expanded using aAPCs of the present disclosure are administered to a patient as a pharmaceutical composition. In an embodiment, the pharmaceutical composition is a suspension of TILs in a sterile buffer. TILs expanded using aAPCs of the present disclosure may be administered by any suitable route as known in the art. Preferably, the TILs are administered as a single infusion, such as an intra-arterial or intravenous infusion, which preferably lasts approximately 30 to 60 minutes. Other suitable routes of administration include intraperitoneal, intrathecal, and intralymphatic administration.
[0571] Any suitable dose of TILs can be administered. Preferably, from about 2.3?10.sup.10 to about 13.7?10.sup.10 TILs are administered, with an average of around 7.8?10.sup.10 TILs, particularly if the cancer is melanoma. In an embodiment, about 1.2?10.sup.10 to about 4.3?10.sup.10 of TILs are administered.
[0572] In some embodiments, the number of the TILs provided in the pharmaceutical compositions of the invention is about 1?10.sup.6, 2?10.sup.6, 3?10.sup.6, 4?10.sup.6, 5?10.sup.6, 6X 10.sup.6, 7X 10.sup.6, 8?10.sup.6, 9?10.sup.6, 2?10.sup.7, 2?10.sup.7, 3?10.sup.7, 4?10.sup.7, 5?10.sup.7, 6?10.sup.7, 7?10.sup.7, 8?10.sup.7, 9?10.sup.7, 1?10.sup.8, 2?10.sup.8, 3?10.sup.8, 4?10.sup.8, 5?10.sup.8, 6?10.sup.8, 7?10.sup.8, 8?10.sup.8, 9?10.sup.8, 1?10.sup.9, 2?10.sup.9, 3?10.sup.9, 4?10.sup.9, 5?10.sup.9, 6?10.sup.9, 7?10.sup.9, 8?10.sup.9, 9?10.sup.9, 1?10.sup.10, 2?10.sup.10, 3?10.sup.10, 4?10.sup.10, 5?10.sup.10, 6?10.sup.10, 7?10.sup.10, 8?10.sup.10, 9?10.sup.10, 1?10.sup.11, 2?10.sup.11, 3?10.sup.11, 4?10.sup.11, 5?10.sup.11, 6?10.sup.11, 7?10.sup.11, 8?10.sup.11, 9?10.sup.11, 1?10.sup.12, 2?10.sup.12, 3?10.sup.12, 4?10.sup.12, 5?10.sup.12, 6?10.sup.12, 7?10.sup.12, 8?10.sup.12, 9?10.sup.12, 1?10.sup.13, 2?10.sup.13, 3?10.sup.13, 4?10.sup.13, 5?10.sup.13, 6?10.sup.13, 7?10.sup.13, 8?10.sup.13, and 9?10.sup.13. In an embodiment, the number of the TILs provided in the pharmaceutical compositions of the invention is in the range of 1?10.sup.6 to 5?10.sup.6, 5?10.sup.6 to 1?10.sup.7, 1?10.sup.7 to 5?10.sup.7, 5?10.sup.7 to 1?10.sup.8, 1?10.sup.8 to 5?10.sup.8, 5?10.sup.8 to 1?10.sup.9, 1?10.sup.9 to 5?10.sup.9, 5?10.sup.9 to 1?10.sup.10, 1?10.sup.10 to 5?10.sup.10, 5?10.sup.10 to 1?10.sup.11, 5?10.sup.11 to 1?10.sup.12, 1?10.sup.12 to 5?10.sup.12, and 5?10.sup.12 to 1?10.sup.13.
[0573] In some embodiments, the concentration of the TILs provided in the pharmaceutical compositions of the invention is less than, for example, 100%, 90%, 80%, 70%, 60%, 50%, 40%, 30%, 20%, 19%, 18%, 17%, 16%, 15%, 14%, 13%, 12%, 11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0.5%, 0.4%, 0.3%, 0.2%, 0.1%, 0.09%, 0.08%, 0.07%, 0.06%, 0.05%, 0.04%, 0.03%, 0.02%, 0.01%, 0.009%, 0.008%, 0.007%, 0.006%, 0.005%, 0.004%, 0.003%, 0.002%, 0.001%, 0.0009%, 0.0008%, 0.0007%, 0.0006%, 0.0005%, 0.0004%, 0.0003%, 0.0002% or 0.0001% w/w, w/v or v/v of the pharmaceutical composition.
[0574] In some embodiments, the concentration of the TILs provided in the pharmaceutical compositions of the invention is greater than 90%, 80%, 70%, 60%, 50%, 40%, 30%, 20%, 19.75%, 19.50%, 19.25% 19%, 18.75%, 18.50%, 18.25% 18%, 17.75%, 17.50%, 17.25% 17%, 16.75%, 16.50%, 16.25% 16%, 15.75%, 15.50%, 15.25% 15%, 14.75%, 14.50%, 14.25% 14%, 13.75%, 13.50%, 13.25% 13%, 12.75%, 12.50%, 12.25% 12%, 11.75%, 11.50%, 11.25% 11%, 10.75%, 10.50%, 10.25% 10%, 9.75%, 9.50%, 9.25% 9%, 8.75%, 8.50%, 8.25% 8%, 7.75%, 7.50%, 7.25% 7%, 6.75%, 6.50%, 6.25% 6%, 5.75%, 5.50%, 5.25% 5%, 4.75%, 4.50%, 4.25%, 4%, 3.75%, 3.50%, 3.25%, 3%, 2.75%, 2.50%, 2.25%, 2%, 1.75%, 1.50%, 125%, 1%, 0.5%, 0.4%, 0.3%, 0.2%, 0.1%, 0.09%, 0.08%, 0.07%, 0.06%, 0.05%, 0.04%, 0.03%, 0.02%, 0.01%, 0.009%, 0.008%, 0.007%, 0.006%, 0.005%, 0.004%, 0.003%, 0.002%, 0.001%, 0.0009%, 0.0008%, 0.0007%, 0.0006%, 0.0005%, 0.0004%, 0.0003%, 0.0002% or 0.0001% w/w, w/v, or v/v of the pharmaceutical composition.
[0575] In some embodiments, the concentration of the TILs provided in the pharmaceutical compositions of the invention is in the range from about 0.0001% to about 50%, about 0.001% to about 40%, about 0.01% to about 30%, about 0.02% to about 29%, about 0.03% to about 28%, about 0.04% to about 27%, about 0.05% to about 26%, about 0.06% to about 25%, about 0.07% to about 24%, about 0.08% to about 23%, about 0.09% to about 22%, about 0.1% to about 21%, about 0.2% to about 20%, about 0.3% to about 19%, about 0.4% to about 18%, about 0.5% to about 17%, about 0.6% to about 16%, about 0.7% to about 15%, about 0.8% to about 14%, about 0.9% to about 12% or about 1% to about 10% w/w, w/v or v/v of the pharmaceutical composition.
[0576] In some embodiments, the concentration of the TILs provided in the pharmaceutical compositions of the invention is in the range from about 0.001% to about 10%, about 0.01% to about 5%, about 0.02% to about 4.5%, about 0.03% to about 4%, about 0.04% to about 3.5%, about 0.05% to about 3%, about 0.06% to about 2.5%, about 0.07% to about 2%, about 0.08% to about 1.5%, about 0.09% to about 1%, about 0.1% to about 0.9% w/w, w/v or v/v of the pharmaceutical composition.
[0577] In some embodiments, the amount of the TILs provided in the pharmaceutical compositions of the invention is equal to or less than 10 g, 9.5 g, 9.0 g, 8.5 g, 8.0 g, 7.5 g, 7.0 g, 6.5 g, 6.0 g, 5.5 g, 5.0 g, 4.5 g, 4.0 g, 3.5 g, 3.0 g, 2.5 g, 2.0 g, 1.5 g, 1.0 g, 0.95 g, 0.9 g, 0.85 g, 0.8 g, 0.75 g, 0.7 g, 0.65 g, 0.6 g, 0.55 g, 0.5 g, 0.45 g, 0.4 g, 0.35 g, 0.3 g, 0.25 g, 0.2 g, 0.15 g, 0.1 g, 0.09 g, 0.08 g, 0.07 g, 0.06 g, 0.05 g, 0.04 g, 0.03 g, 0.02 g, 0.01 g, 0.009 g, 0.008 g, 0.007 g, 0.006 g, 0.005 g, 0.004 g, 0.003 g, 0.002 g, 0.001 g, 0.0009 g, 0.0008 g, 0.0007 g, 0.0006 g, 0.0005 g, 0.0004 g, 0.0003 g, 0.0002 g, or 0.0001 g.
[0578] In some embodiments, the amount of the TILs provided in the pharmaceutical compositions of the invention is more than 0.0001 g, 0.0002 g, 0.0003 g, 0.0004 g, 0.0005 g, 0.0006 g, 0.0007 g, 0.0008 g, 0.0009 g, 0.001 g, 0.0015 g, 0.002 g, 0.0025 g, 0.003 g, 0.0035 g, 0.004 g, 0.0045 g, 0.005 g, 0.0055 g, 0.006 g, 0.0065 g, 0.007 g, 0.0075 g, 0.008 g, 0.0085 g, 0.009 g, 0.0095 g, 0.01 g, 0.015 g, 0.02 g, 0.025 g, 0.03 g, 0.035 g, 0.04 g, 0.045 g, 0.05 g, 0.055 g, 0.06 g, 0.065 g, 0.07 g, 0.075 g, 0.08 g, 0.085 g, 0.09 g, 0.095 g, 0.1 g, 0.15 g, 0.2 g, 0.25 g, 0.3 g, 0.35 g, 0.4 g, 0.45 g, 0.5 g, 0.55 g, 0.6 g, 0.65 g, 0.7 g, 0.75 g, 0.8 g, 0.85 g, 0.9 g, 0.95 g, 1 g, 1.5 g, 2 g, 2.5, 3 g, 3.5, 4 g, 4.5 g, 5 g, 5.5 g, 6 g, 6.5 g, 7 g, 7.5 g, 8 g, 8.5 g, 9 g, 9.5 g, or 10 g.
[0579] The TILs provided in the pharmaceutical compositions of embodiments of the invention are effective over a wide dosage range. The exact dosage will depend upon the route of administration, the form in which the compound is administered, the gender and age of the subject to be treated, the body weight of the subject to be treated, and the preference and experience of the attending physician. The clinically-established dosages of the TILs may also be used if appropriate. The amounts of the pharmaceutical compositions administered using the methods herein, such as the dosages of TILs, will be dependent on the human or mammal being treated, the severity of the disorder or condition, the rate of administration, the disposition of the active pharmaceutical ingredients and the discretion of the prescribing physician.
[0580] In some embodiments, TILs may be administered in a single dose. Such administration may be by injection, e.g., intravenous injection. In some embodiments, TILs may be administered in multiple doses. Dosing may be once, twice, three times, four times, five times, six times, or more than six times per year. Dosing may be once a month, once every two weeks, once a week, or once every other day. Administration of TILs may continue as long as necessary.
[0581] In some embodiments, an effective dosage of TILs is about 1?10.sup.6, 2?10.sup.6, 3?10.sup.6, 4?10.sup.6, 5?10.sup.6, 6?10.sup.6, 7?10.sup.6, 8?10.sup.6, 9?10.sup.6, 1?10.sup.7, 2?10.sup.7, 3?10.sup.7, 4?10.sup.7, 5?10.sup.7, 6?10.sup.7, 7?10.sup.7, 8?10.sup.7, 9?10.sup.7, 1?10.sup.8, 2?10.sup.8, 3?10.sup.8, 4?10.sup.8, 5?10.sup.8, 6?10.sup.8, 7?10.sup.8, 8?10.sup.8, 9?10.sup.8, 1?10.sup.9, 2?10.sup.9, 3?10.sup.9, 4?10.sup.9, 5?10.sup.9, 6?10.sup.9, 7?10.sup.9, 8?10.sup.9, 9?10.sup.9, 1?10.sup.10, 2?10.sup.10, 3?10.sup.10, 4?10.sup.10, 5?10.sup.10, 6?10.sup.10, 7?10.sup.10, 8?10.sup.10, 9?10.sup.10, 1?10.sup.11, 2?10.sup.11, 3?10.sup.11, 4?10.sup.11, 5?10.sup.11, 6?10.sup.11, 7?10.sup.11, 8?10.sup.11, 9?10.sup.11, 1?10.sup.12, 2?10.sup.12, 3?10.sup.12, 4?10.sup.12, 5?10.sup.12 6?10.sup.12, 7?10.sup.12, 8?10.sup.12, 9?10.sup.12, 1?10.sup.13, 2?10.sup.13, 3?10.sup.13, 4?10.sup.13, 5?10.sup.13, 6?10.sup.13, 7?10.sup.13, 8?10.sup.13, and 9?10.sup.13. In some embodiments, an effective dosage of TILs is in the range of 1?10.sup.6 to 5?10.sup.6, 5?10.sup.6 to 1?10.sup.7, 1?10.sup.7 to 5?10.sup.7, 5?10.sup.7 to 1?10.sup.8, 1?10.sup.8 to 5?10.sup.8, 5?10.sup.8 to 1?10.sup.9, 1?10.sup.9 to 5?10.sup.9, 5?10.sup.9 to 1?10.sup.10, 1?10.sup.10 to 5?10.sup.10, 5?10.sup.10 to 1?10.sup.11, 5?10.sup.11 to 1?10.sup.12, 1?10.sup.12 to 5?10.sup.12, and 5?10.sup.12 to 1?10.sup.13.
[0582] In some embodiments, an effective dosage of TILs is in the range of about 0.01 mg/kg to about 4.3 mg/kg, about 0.15 mg/kg to about 3.6 mg/kg, about 0.3 mg/kg to about 3.2 mg/kg, about 0.35 mg/kg to about 2.85 mg/kg, about 0.15 mg/kg to about 2.85 mg/kg, about 0.3 mg to about 2.15 mg/kg, about 0.45 mg/kg to about 1.7 mg/kg, about 0.15 mg/kg to about 1.3 mg/kg, about 0.3 mg/kg to about 1.15 mg/kg, about 0.45 mg/kg to about 1 mg/kg, about 0.55 mg/kg to about 0.85 mg/kg, about 0.65 mg/kg to about 0.8 mg/kg, about 0.7 mg/kg to about 0.75 mg/kg, about 0.7 mg/kg to about 2.15 mg/kg, about 0.85 mg/kg to about 2 mg/kg, about 1 mg/kg to about 1.85 mg/kg, about 1.15 mg/kg to about 1.7 mg/kg, about 1.3 mg/kg mg to about 1.6 mg/kg, about 1.35 mg/kg to about 1.5 mg/kg, about 2.15 mg/kg to about 3.6 mg/kg, about 2.3 mg/kg to about 3.4 mg/kg, about 2.4 mg/kg to about 3.3 mg/kg, about 2.6 mg/kg to about 3.15 mg/kg, about 2.7 mg/kg to about 3 mg/kg, about 2.8 mg/kg to about 3 mg/kg, or about 2.85 mg/kg to about 2.95 mg/kg.
[0583] In some embodiments, an effective dosage of TILs is in the range of about 1 mg to about 500 mg, about 10 mg to about 300 mg, about 20 mg to about 250 mg, about 25 mg to about 200 mg, about 1 mg to about 50 mg, about 5 mg to about 45 mg, about 10 mg to about 40 mg, about 15 mg to about 35 mg, about 20 mg to about 30 mg, about 23 mg to about 28 mg, about 50 mg to about 150 mg, about 60 mg to about 140 mg, about 70 mg to about 130 mg, about 80 mg to about 120 mg, about 90 mg to about 110 mg, or about 95 mg to about 105 mg, about 98 mg to about 102 mg, about 150 mg to about 250 mg, about 160 mg to about 240 mg, about 170 mg to about 230 mg, about 180 mg to about 220 mg, about 190 mg to about 210 mg, about 195 mg to about 205 mg, or about 198 to about 207 mg.
[0584] An effective amount of the TILs may be administered in either single or multiple doses by any of the accepted modes of administration of agents having similar utilities, including intranasal and transdermal routes, by intra-arterial injection, intravenously, intraperitoneally, parenterally, intramuscularly, subcutaneously, topically, by transplantation, or by inhalation.
EXAMPLES
[0585] The embodiments encompassed herein are now described with reference to the following examples. These examples are provided for the purpose of illustration only and the disclosure encompassed herein should in no way be construed as being limited to these examples, but rather should be construed to encompass any and all variations which become evident as a result of the teachings provided herein.
Example 1
Variability in Expansion of Tumor Infiltrating Lymphocytes using PBMC Feeder Cells
[0586] The variability in TIL expansion obtained by use of PBMC feeder cells may be demonstrated by comparing the results of multiple TIL expansions on the same line of TILs obtained from a patient.
Example 2
Selection of Myeloid Cells for aAPC Development
[0587] Phenotypic characterization was performed on various myeloid-lineage cell lines to identify potential candidates for further modification into aAPCs for TIL expansion. The results are summarized in Table 5. The MOLM-14 cell line exhibited endogenous expression of CD64, and was selected for further development. The EM-3 cell line was selected based on the observation of endogenous expression of ICOS-L (which was not observed for the EM-2 cell line, despite being taken from the same patient).
TABLE-US-00005 TABLE 5 Summary of costimulatory molecules expressed endogenously on candidate cell lines for aAPCs. CML refers to chronic myeloid leukemia, and AML refers to acute myeloid leukemia. Pop refers to the population of cells observed to express the marker (? pop = 50%). Cell line K562 myeloid EM-2 EM-3 erythro- Myeloid blast Myeloid blast KG1-246 KG1-8031 leukemia, MOLM-14 Origin crisis, CML crisis, CML AML AML CML AML HLA-A/B/C + + + + ? + CD64 ? ? ? ? ? + CD80 ? ? ? ? ? + ICOS-L ? + ? ? ? + 4-1BBL ? ? ? ? ? ? PD-L1 ? ? ? ? ? ? CD58 + + + + + + CD86 ? ? ? ? ? + (? pop)
Example 3
Preparation of MOLM-14 Artificial Antigen Presenting Cells (aMOLM14 aAPCs)
[0588] MOLM-14 cells were obtained from Leibniz-Institut DSMZ-Deutsche Sammlung von Mikroorganismen and Zellkulturen GmbH. To develop MOLM-14 based aAPCs, MOLM-14 cells were engineered with the costimulatory molecules CD86 and 4-1BBL (CD137L). Human CD86 (hCD86) and human 4-1BBL (h4-1BBL) genes were cloned into commercially-available PLV430G and co-transfected with PDONR221 vectors (Invitrogen/Thermo Fisher Scientific, Carlsbad, Calif., USA) using a lentiviral transduction method. The gateway cloning method was used as described in Katzen, Expert Opin. Drug Disc. 2007, 4, 571-589, to clone hCD86 and hCD137L genes onto the PLV430G and PDONR221 vectors. The 293T cell line (human embryonic kidney cells transformed with large T antigen) was used for lentiviral production, transduced to MOLM-14 cells. The transfected cells were sorted (S3e Cell Sorter, Bio-Rad, Hercules, Calif., USA) using APC-conjugated CD86 and PE-conjugated CD137L to isolate and enrich the cells. The enriched cells were checked for purity by flow cytometry.
[0589] The vectors and portions thereof used for cloning are depicted in
TABLE-US-00006 TABLE6 Nucleotidesequencesforpreparationof lentivirusfortransductionofaAPCs. Identifier (Description) Sequence SEQIDNO:15 cgataaccctaattcgatagcatatgcttcccgttgggtaacatatgctattgaattagg 60 (pLV430Ghuman gttagtctggatagtatatactactacccgggaagcatatgctacccgtttagggttcac 120 4-1BBLvector) cggtgatgccggccacgatgcgtccggcgtagaggatctaatgtgagttagctcactcat 180 taggcaccccaggctttacactttatgcttccggctcgtatgttgtgtggaattgtgagc 240 ggataacaatttcacacaggaaacagctatgaccatgattacgccaagcgcgcaattaac 300 cctcactaaagggaacaaaagctggagctgcaagcttaatgtagtcttatgcaatactct 360 tgtagtcttgcaacatggtaacgatgagttagcaacatgccttacaaggagagaaaaagc 420 accgtgcatgccgattggtggaagtaaggtggtacgatcgtgccttattaggaaggcaac 480 agacgggtctgacatggattggacgaaccactgaattgccgcattgcagagatattgtat 540 ttaagtgcctagctcgatacataaacgggtctctctggttagaccagatctgagcctggg 600 agctctctggctaactagggaacccactgcttaagcctcaataaagcttgccttgagtgc 660 ttcaagtagtgtgtgcccgtctgttgtgtgactctggtaactagagatccctcagaccct 720 tttagtcagtgtggaaaatctctagcagtggcgcccgaacagggacttgaaagcgaaagg 780 gaaaccagaggagctctctcgacgcaggactcggcttgctgaagcgcgcacggcaagagg 840 cgaggggcggcgactggtgagtacgccaaaaattttgactagcggaggctagaaggagag 900 agatgggtgcgagagcgtcagtattaagcgggggagaattagatcgcgatgggaaaaaat 960 tcggttaaggccagggggaaagaaaaaatataaattaaaacatatagtatgggcaagcag 1020 ggagctagaacgattcgcagttaatcctggcctgttagaaacatcagaaggctgtagaca 1080 aatactgggacagctacaaccatcccttcagacaggatcagaagaacttagatcattata 1140 taatacagtagcaaccctctattgtgtgcatcaaaggatagagataaaagacaccaagga 1200 agctttagacaagatagaggaagagcaaaacaaaagtaagaccaccgcacagcaagcggc 1260 cgctgatcttcagacctggaggaggagatatgagggacaattggagaagtgaattatata 1320 aatataaagtagtaaaaattgaaccattaggagtagcacccaccaaggcaaagagaagag 1380 tggtgcagagagaaaaaagagcagtgggaataggagctttgttccttgggttcttgggag 1440 cagcaggaagcactatgggcgcagcgtcaatgacgctgacggtacaggccagacaattat 1500 tgtctggtatagtgcagcagcagaacaatttgctgagggctattgaggcgcaacagcatc 1560 tgttgcaactcacagtctggggcatcaagcagctccaggcaagaatcctggctgtggaaa 1620 gatacctaaaggatcaacagctcctggggatttggggttgctctggaaaactcatttgca 1680 ccactgctgtgccttggaatgctagttggagtaataaatctctggaacagatttggaatc 1740 acacgacctggatggagtgggacagagaaattaacaattacacaagcttaatacactcct 1800 taattgaagaatcgcaaaaccagcaagaaaagaatgaacaagaattattggaattagata 1860 aatgggcaagtttgtggaattggtttaacataacaaattggctgtggtatataaaattat 1920 tcataatgatagtaggaggcttggtaggtttaagaatagtttttgctgtactttctatag 1980 tgaatagagttaggcagggatattcaccattatcgtttcagacccacctcccaaccccga 2040 ggggacccgacaggcccgaaggaatagaagaagaaggtggagagagagacagagacagat 2100 ccattcgattagtgaacggatctcgacggtatcggttttaaaagaaaaggggggattggg 2160 gggtacagtgcaggggaaagaatagtagacataatagcaacagacatacaaactaaagaa 2220 ttacaaaaacaaattacaaaaattcaaaattttatcgattttatttagtctccagaaaaa 2280 ggggggaatgaaagaccccacctgtaggtttggcaagctagcttaagtaacgccattttg 2340 caaggcatggaaaatacataactgagaatagagaagttcagatcaaggttaggaacagag 2400 agacaggagaatatgggccaaacaggatatctgtggtaagcagttcctgccccggctcag 2460 ggccaagaacagatggtccccagatgcggtcccgccctcagcagtttctagagaaccatc 2520 agatgtttccagggtgccccaaggacctgaaatgaccctgtgccttatttgaactaacca 2580 atcagttcgcttctcgcttctgttcgcgcgcttctgctccccgagctcaataaaagagcc 2640 cacaacccctcactcggcgcgccagtcctccgatagactgcgtcgcccgggtaccgatat 2700 caacaagtttgtacaaaaaagcaggcttcgccaccatggaatacgcctctgatgccagcc 2760 tggaccccgaagctccttggcctcctgcccctagagccagagcctgtagagtgctgcctt 2820 gggctctggtggctggccttctccttctgctgctgctggccgctgcctgcgctgtgtttc 2880 tggcttgtccttgggccgtgtcaggcgccagagcttctcctggatctgccgccagcccca 2940 gactgagagagggacctgagctgagccccgatgatcctgccggactgctggatctgagac 3000 agggcatgttcgcccagctggtggcccagaacgtgctgctgatcgatggccccctgagct 3060 ggtacagcgatcctggactggctggcgtgtcactgacaggcggcctgagctacaaagagg 3120 acaccaaagaactggtggtggccaaggccggcgtgtactacgtgttctttcagctggaac 3180 tgcggagagtggtggccggcgaaggatccggctctgtgtctctggcactgcatctgcagc 3240 ccctgagatctgctgcaggcgctgctgcactggccctgacagtggacctgcctccagcct 3300 ctagcgaggccagaaactccgcattcgggtttcaaggcagactgctgcacctgtctgccg 3360 gccagagactgggagtgcatctgcacacagaggccagagccagacacgcctggcagctga 3420 cacagggcgctacagtgctgggcctgttcagagtgacccccgaaattccagccggcctgc 3480 ccagccctagaagcgagtaggacccagctttcttgtacaaagtggtgattcgagttaatt 3540 aagctagcctagtgccatttgttcagtggttcgtagggctttcccccactgtttggcttt 3600 cagttatatggatgatgtggtattgggggccaagtctgtacagcatcttgagtccctttt 3660 taccgctgttaccaattttcttttgtctttgggtatacatttaaaccctaacaaaacaaa 3720 gagatggggttactctctaaattttatgggttatgtcattggatgttatgggtccttgcc 3780 acaagaacacatcatacaaaaaatcaaagaatgttttagaaaacttcctattaacaggcc 3840 tattgattggaaagtatgtcaacgaattgtgggtcttttgggttttgctgccccttttac 3900 acaatgtggttatcctgcgttgatgcctttgtatgcatgtattcaatctaagcaggcttt 3960 cactttctcgccaacttacaaggcctttctgtgtaaacaatacctgaacctttaccccgt 4020 tgcccggcaacggccaggtctgtgccaagtgtttgctgacgcaacccccactggctgggg 4080 cttggtcatgggccatcagcgcatgcgtggaaccttttcggctcctctgccgatccatac 4140 tgcggaactcctagccgcttgttttgctcgcagcaggtctggagcaaacattatcgggac 4200 tgataactctgttgtcctatcccgcaaatatacatcgtttccatggctgctaggctgtgc 4260 tgccaactggatcctgcgcgggacgtcctttgtttacgtcccgtcggcgctgaatcctgc 4320 ggacgacccttctcggggtcgcttgggactctctcgtccccttctccgtctgccgttccg 4380 accgaccacggggcgcacctctctttacgcggactccccgtctgtgccttctcatctgcc 4440 ggaccgtgtgcacttcgcttcacctctgcacgtcgcatggagaccaccgtgaacgcccac 4500 caaatattgcccaaggtcttacataagaggactcttggactctcagcaatgtcaacgacc 4560 gaccttgaggcatacttcaaagactgtttgtttaaagactgggaggagttgggggaggag 4620 attaggttaaaggtctttgtactaggaggctgtaggcataaattggtctgcgcaccagca 4680 ccatggcgcaatcactagagcggggtacctttaagaccaatgacttacaaggcagctgta 4740 gatcttagccactttttaaaagaaaaggggggactggaagggctaattcactcccaacga 4800 agacaagatctgctttttgcttgtactgggtctctctggttagaccagatctgagcctgg 4860 gagctctctggctaactagggaacccactgcttaagcctcaataaagcttgccttgagtg 4920 cttcaagtagtgtgtgcccgtctgttgtgtgactctggtaactagagatccctcagaccc 4980 ttttagtcagtgtggaaaatctctagcagtagtagttcatgtcatcttattattcagtat 5040 ttataacttgcaaagaaatgaatatcagagagtgagaggaacttgtttattgcagcttat 5100 aatggttacaaataaagcaatagcatcacaaatttcacaaataaagcatttttttcactg 5160 cattctagttgtggtttgtccaaactcatcaatgtatcttatcatgtctggctctagcta 5220 tcccgcccctaactccgcccatcccgcccctaactccgcccagttccgcccattctccgc 5280 cccatggctgactaattttttttatttatgcagaggccgaggccggatcccttgagtggc 5340 tttcatcctggagcagactttgcagtctgtggactgcaacacaacattgcctttatgtgt 5400 aactcttggctgaagctcttacaccaatgctgggggacatgtacctcccaggggcccagg 5460 aagactacgggaggctacaccaacgtcaatcagaggggcctgtgtagctaccgataagcg 5520 gaccctcaagagggcattagcaatagtgtttataaggcccccttgttaattcttgaagac 5580 gaaagggcctcgtgatacgcctatttttataggttaatgtcatgataataatggtttctt 5640 agacgtcaggtggcacttttcggggaaatgtgcgcggaacccctatttgtttatttttct 5700 aaatacattcaaatatgtatccgctcatgagacaataaccctgataaatgcttcaataat 5760 attgaaaaaggaagagtatgagtattcaacatttccgtgtcgcccttattcccttttttg 5820 cggcattttgccttcctgtttttgctcacccagaaacgctggtgaaagtaaaagatgctg 5880 aagatcagttgggtgcacgagtgggttacatcgaactggatctcaacagcggtaagatcc 5940 ttgagagttttcgccccgaagaacgttttccaatgatgagcacttttaaagttctgctat 6000 gtggcgcggtattatcccgtgttgacgccgggcaagagcaactcggtcgccgcatacact 6060 attctcagaatgacttggttgagtactcaccagtcacagaaaagcatcttacggatggca 6120 tgacagtaagagaattatgcagtgctgccataaccatgagtgataacactgcggccaact 6180 tacttctgacaacgatcggaggaccgaaggagctaaccgcttttttgcacaacatggggg 6240 atcatgtaactcgccttgatcgttgggaaccggagctgaatgaagccataccaaacgacg 6300 agcgtgacaccacgatgcctgcagcaatggcaacaacgttgcgcaaactattaactggcg 6360 aactacttactctagcttcccggcaacaattaatagactggatggaggcggataaagttg 6420 caggaccacttctgcgctcggcccttccggctggctggtttattgctgataaatctggag 6480 ccggtgagcgtgggtctcgcggtatcattgcagcactggggccagatggtaagccctccc 6540 gtatcgtagttatctacacgacggggagtcaggcaactatggatgaacgaaatagacaga 6600 tcgctgagataggtgcctcactgattaagcattggtaactgtcagaccaagtttactcat 6660 atatactttagattgatttaaaacttcatttttaatttaaaaggatctaggtgaagatcc 6720 tttttgataatctcatgaccaaaatcccttaacgtgagttttcgttccactgagcgtcag 6780 accccgtagaaaagatcaaaggatcttcttgagatcctttttttctgcgcgtaatctgct 6840 gcttgcaaacaaaaaaaccaccgctaccagcggtggtttgtttgccggatcaagagctac 6900 caactctttttccgaaggtaactggcttcagcagagcgcagataccaaatactgtccttc 6960 tagtgtagccgtagttaggccaccacttcaagaactctgtagcaccgcctacatacctcg 7020 ctctgctaatcctgttaccagtggctgctgccagtggcgataagtcgtgtcttaccgggt 7080 tggactcaagacgatagttaccggataaggcgcagcggtcgggctgaacggggggttcgt 7140 gcacacagcccagcttggagcgaacgacctacaccgaactgagatacctacagcgtgagc 7200 attgagaaagcgccacgcttcccgaagggagaaaggcggacaggtatccggtaagcggca 7260 gggtcggaacaggagagcgcacgagggagcttccagggggaaacgcctggtatctttata 7320 gtcctgtcgggtttcgccacctctgacttgagcgtcgatttttgtgatgctcgtcagggg 7380 ggcggagcctatggaaaaacgccagcaacgcggcctttttacggttcctggccttttgct 7440 ggcctttttgaagctgtccctgatggtcgtcatctacctgcctggacagcatggcctgca 7500 acgcgggcatcccgatgccgccggaagcgagaagaatcataatggggaaggccatccagc 7560 ctcgcgtcg 7569 SEQIDNO:16 atggaatacgcctctgatgccagcctggaccccgaagctccttggcctcctgcccctaga 60 (4-1BBLCoOP) gccagagcctgtagagtgctgccttgggctctggtggctggccttctccttctgctgctg 120 ctggccgctgcctgcgctgtgtttctggcttgtccttgggccgtgtcaggcgccagagct 180 tctcctggatctgccgccagccccagactgagagagggacctgagctgagccccgatgat 240 cctgccggactgctggatctgagacagggcatgttcgcccagctggtggcccagaacgtg 300 ctgctgatcgatggccccctgagctggtacagcgatcctggactggctggcgtgtcactg 360 acaggcggcctgagctacaaagaggacaccaaagaactggtggtggccaaggccggcgtg 420 tactacgtgttctttcagctggaactgcggagagtggtggccggcgaaggatccggctct 480 gtgtctctggcactgcatctgcagcccctgagatctgctgcaggcgctgctgcactggcc 540 ctgacagtggacctgcctccagcctctagcgaggccagaaactccgcattcgggtttcaa 600 ggcagactgctgcacctgtctgccggccagagactgggagtgcatctgcacacagaggcc 660 agagccagacacgcctggcagctgacacagggcgctacagtgctgggcctgttcagagtg 720 acccccgaaattccagccggcctgcccagccctagaagcgagtag 765 SEQIDNO:17 ggggacaagtttgtacaaaaaagcaggcttcgccaccatggaatacgcctctgatgccag 60 (4-1BBLPRCP) cctggaccccgaagctccttggcctcctgcccctagagccagagcctgtagagtgctgcc 120 ttgggctctggtggctggccttctccttctgctgctgctggccgctgcctgcgctgtgtt 180 tctggcttgtccttgggccgtgtcaggcgccagagcttctcctggatctgccgccagccc 240 cagactgagagagggacctgagctgagccccgatgatcctgccggactgctggatctgag 300 acagggcatgttcgcccagctggtggcccagaacgtgctgctgatcgatggccccctgag 360 ctggtacagcgatcctggactggctggcgtgtcactgacaggcggcctgagctacaaaga 420 ggacaccaaagaactggtggtggccaaggccggcgtgtactacgtgttctttcagctgga 480 actgcggagagtggtggccggcgaaggatccggctctgtgtctctggcactgcatctgca 540 gcccctgagatctgctgcaggcgctgctgcactggccctgacagtggacctgcctccagc 600 ctctagcgaggccagaaactccgcattcgggtttcaaggcagactgctgcacctgtctgc 660 cggccagagactgggagtgcatctgcacacagaggccagagccagacacgcctggcagct 720 gacacagggcgctacagtgctgggcctgttcagagtgacccccgaaattccagccggcct 780 gcccagccctagaagcgagtaggacccagctttcttgtacaaagtggtcccc 832 SEQIDNO:18 cgataaccctaattcgatagcatatgcttcccgttgggtaacatatgctattgaattagg 60 (pLV430Ghuman gttagtctggatagtatatactactacccgggaagcatatgctacccgtttagggttcac 120 CD86vector) cggtgatgccggccacgatgcgtccggcgtagaggatctaatgtgagttagctcactcat 180 taggcaccccaggctttacactttatgcttccggctcgtatgttgtgtggaattgtgagc 240 ggataacaatttcacacaggaaacagctatgaccatgattacgccaagcgcgcaattaac 300 cctcactaaagggaacaaaagctggagctgcaagcttaatgtagtcttatgcaatactct 360 tgtagtcttgcaacatggtaacgatgagttagcaacatgccttacaaggagagaaaaagc 420 accgtgcatgccgattggtggaagtaaggtggtacgatcgtgccttattaggaaggcaac 480 agacgggtctgacatggattggacgaaccactgaattgccgcattgcagagatattgtat 540 ttaagtgcctagctcgatacataaacgggtctctctggttagaccagatctgagcctggg 600 agctctctggctaactagggaacccactgcttaagcctcaataaagcttgccttgagtgc 660 ttcaagtagtgtgtgcccgtctgttgtgtgactctggtaactagagatccctcagaccct 720 tttagtcagtgtggaaaatctctagcagtggcgcccgaacagggacttgaaagcgaaagg 780 gaaaccagaggagctctctcgacgcaggactcggcttgctgaagcgcgcacggcaagagg 840 cgaggggcggcgactggtgagtacgccaaaaattttgactagcggaggctagaaggagag 900 agatgggtgcgagagcgtcagtattaagcgggggagaattagatcgcgatgggaaaaaat 960 tcggttaaggccagggggaaagaaaaaatataaattaaaacatatagtatgggcaagcag 1020 ggagctagaacgattcgcagttaatcctggcctgttagaaacatcagaaggctgtagaca 1080 aatactgggacagctacaaccatcccttcagacaggatcagaagaacttagatcattata 1140 taatacagtagcaaccctctattgtgtgcatcaaaggatagagataaaagacaccaagga 1200 agctttagacaagatagaggaagagcaaaacaaaagtaagaccaccgcacagcaagcggc 1260 cgctgatcttcagacctggaggaggagatatgagggacaattggagaagtgaattatata 1320 aatataaagtagtaaaaattgaaccattaggagtagcacccaccaaggcaaagagaagag 1380 tggtgcagagagaaaaaagagcagtgggaataggagctttgttccttgggttcttgggag 1440 cagcaggaagcactatgggcgcagcgtcaatgacgctgacggtacaggccagacaattat 1500 tgtctggtatagtgcagcagcagaacaatttgctgagggctattgaggcgcaacagcatc 1560 tgttgcaactcacagtctggggcatcaagcagctccaggcaagaatcctggctgtggaaa 1620 gatacctaaaggatcaacagctcctggggatttggggttgctctggaaaactcatttgca 1680 ccactgctgtgccttggaatgctagttggagtaataaatctctggaacagatttggaatc 1740 acacgacctggatggagtgggacagagaaattaacaattacacaagcttaatacactcct 1800 taattgaagaatcgcaaaaccagcaagaaaagaatgaacaagaattattggaattagata 1860 aatgggcaagtttgtggaattggtttaacataacaaattggctgtggtatataaaattat 1920 tcataatgatagtaggaggcttggtaggtttaagaatagtttttgctgtactttctatag 1980 tgaatagagttaggcagggatattcaccattatcgtttcagacccacctcccaaccccga 2040 ggggacccgacaggcccgaaggaatagaagaagaaggtggagagagagacagagacagat 2100 ccattcgattagtgaacggatctcgacggtatcggttttaaaagaaaaggggggattggg 2160 gggtacagtgcaggggaaagaatagtagacataatagcaacagacatacaaactaaagaa 2220 ttacaaaaacaaattacaaaaattcaaaattttatcgattttatttagtctccagaaaaa 2280 ggggggaatgaaagaccccacctgtaggtttggcaagctagcttaagtaacgccattttg 2340 caaggcatggaaaatacataactgagaatagagaagttcagatcaaggttaggaacagag 2400 agacagcagaatatgggccaaacaggatatctgtggtaagcagttcctgccccggctcag 2460 ggccaagaacagatggtccccagatgcggtcccgccctcagcagtttctagagaaccatc 2520 agatgtttccagggtgccccaaggacctgaaatgaccctgtgccttatttgaactaacca 2580 atcagttcgcttctcgcttctgttcgcgcgcttctgctccccgagctcaataaaagagcc 2640 cacaacccctcactcggcgcgccagtcctccgatagactgcgtcgcccgggtaccgatat 2700 caacaagtttgtacaaaaaagcaggcttcgccaccatgggcctgagcaacatcctgttcg 2760 tgatggccttcctgctgtccggagccgcccctctgaagatccaggcctacttcaacgaga 2820 ccgccgacctgccctgccagttcgccaacagccagaaccagagcctgagcgaactggtgg 2880 tgttctggcaggaccaggaaaacctggtcctgaacgaggtgtacctgggcaaagaaaagt 2940 tcgacagcgtgcacagcaagtacatgggccggaccagcttcgacagcgacagctggaccc 3000 tgcggctgcacaacctgcagatcaaggacaagggcctgtaccagtgcatcatccaccaca 3060 agaaacccaccggcatgatcagaatccaccagatgaacagcgagctgtccgtgctggcca 3120 acttcagccagcccgagatcgtgcccatcagcaacatcaccgagaacgtgtacatcaacc 3180 tgacctgcagcagcatccacggctaccccgagcccaagaaaatgagcgtgctgctgcgga 3240 ccaagaacagcaccatcgagtacgacggcgtgatgcagaaaagccaggacaacgtgaccg 3300 agctgtacgacgtgagcatcagcctgagcgtgagcttccccgacgtgaccagcaacatga 3360 ccatcttttgcatcctggaaaccgacaagacccggctgctgtccagccccttcagcatcg 3420 agctggaagatccccagccccctcccgaccacatcccctggatcaccgccgtgctgccca 3480 ccgtgatcatctgcgtgatggtgttctgcctgatcctgtggaagtggaagaagaagaagc 3540 ggcctaggaacagctacaagtgcggcaccaacaccatggaacgggaggaaagcgagcaga 3600 ccaagaagcgggagaagatccacatccccgagcggagcgacgaggcccagcgggtgttca 3660 agagcagcaagaccagcagctgcgacaagagcgacacctgcttctaggacccagctttct 3720 tgtacaaagtggtgattcgagttaattaagctagcctagtgccatttgttcagtggttcg 3780 tagggctttcccccactgtttggctttcagttatatggatgatgtggtattgggggccaa 3840 gtctgtacagcatcttgagtccctttttaccgctgttaccaattttcttttgtctttggg 3900 tatacatttaaaccctaacaaaacaaagagatggggttactctctaaattttatgggtta 3960 tgtcattggatgttatgggtccttgccacaagaacacatcatacaaaaaatcaaagaatg 4020 ttttagaaaacttcctattaacaggcctattgattggaaagtatgtcaacgaattgtggg 4080 tcttttgggttttgctgccccttttacacaatgtggttatcctgcgttgatgcctttgta 4140 tgcatgtattcaatctaagcaggctttcactttctcgccaacttacaaggcctttctgtg 4200 taaacaatacctgaacctttaccccgttgcccggcaacggccaggtctgtgccaagtgtt 4260 tgctgacgcaacccccactggctggggcttggtcatgggccatcagcgcatgcgtggaac 4320 cttttcggctcctctgccgatccatactgcggaactcctagccgcttgttttgctcgcag 4380 caggtctggagcaaacattatcgggactgataactctgttgtcctatcccgcaaatatac 4440 atcgtttccatggctgctaggctgtgctgccaactggatcctgcgcgggacgtcctttgt 4500 ttacgtcccgtcggcgctgaatcctgcggacgacccttctcggggtcgcttgggactctc 4560 tcgtccccttctccgtctgccgttccgaccgaccacggggcgcacctctctttacgcgga 4620 ctccccgtctgtgccttctcatctgccggaccgtgtgcacttcgcttcacctctgcacgt 4680 cgcatggagaccaccgtgaacgcccaccaaatattgcccaaggtcttacataagaggact 4740 cttggactctcagcaatgtcaacgaccgaccttgaggcatacttcaaagactgtttgttt 4800 aaagactgggaggagttgggggaggagattaggttaaaggtctttgtactaggaggctgt 4860 aggcataaattggtctgcgcaccagcaccatggcgcaatcactagagcggggtaccttta 4920 agaccaatgacttacaaggcagctgtagatcttagccactttttaaaagaaaagggggga 4980 ctggaagggctaattcactcccaacgaagacaagatctgctttttgcttgtactgggtct 5040 ctctggttagaccagatctgagcctgggagctctctggctaactagggaacccactgctt 5100 aagcctcaataaagcttgccttgagtgcttcaagtagtgtgtgcccgtctgttgtgtgac 5160 tctggtaactagagatccctcagacccttttagtcagtgtggaaaatctctagcagtagt 5220 agttcatgtcatcttattattcagtatttataacttgcaaagaaatgaatatcagagagt 5280 gagaggaacttgtttattgcagcttataatggttacaaataaagcaatagcatcacaaat 5340 ttcacaaataaagcatttttttcactgcattctagttgtggtttgtccaaactcatcaat 5400 gtatcttatcatgtctggctctagctatcccgcccctaactccgcccatcccgcccctaa 5460 ctccgcccagttccgcccattctccgccccatggctgactaattttttttatttatgcag 5520 aggccgaggccggatcccttgagtggctttcatcctggagcagactttgcagtctgtgga 5580 ctgcaacacaacattgcctttatgtgtaactcttggctgaagctcttacaccaatgctgg 5640 gggacatgtacctcccaggggcccaggaagactacgggaggctacaccaacgtcaatcag 5700 aggggcctgtgtagctaccgataagcggaccctcaagagggcattagcaatagtgtttat 5760 aaggcccccttgttaattcttgaagacgaaagggcctcgtgatacgcctatttttatagg 5820 ttaatgtcatgataataatggtttcttagacgtcaggtggcacttttcggggaaatgtgc 5880 gcggaacccctatttgtttatttttctaaatacattcaaatatgtatccgctcatgagac 5940 aataaccctgataaatgcttcaataatattgaaaaaggaagagtatgagtattcaacatt 6000 tccgtgtcgcccttattcccttttttgcggcattttgccttcctgtttttgctcacccag 6060 aaacgctggtgaaagtaaaagatgctgaagatcagttgggtgcacgagtgggttacatcg 6120 aactggatctcaacagcggtaagatccttgagagttttcgccccgaagaacgttttccaa 6180 tgatgagcacttttaaagttctgctatgtggcgcggtattatcccgtgttgacgccgggc 6240 aagagcaactcggtcgccgcatacactattctcagaatgacttggttgagtactcaccag 6300 tcacagaaaagcatcttacggatggcatgacagtaagagaattatgcagtgctgccataa 6360 ccatgagtgataacactgcggccaacttacttctgacaacgatcggaggaccgaaggagc 6420 taaccgcttttttgcacaacatgggggatcatgtaactcgccttgatcgttgggaaccgg 6480 agctgaatgaagccataccaaacgacgagcgtgacaccacgatgcctgcagcaatggcaa 6540 caacgttgcgcaaactattaactggcgaactacttactctagcttcccggcaacaattaa 6600 tagactggatggaggcggataaagttgcaggaccacttctgcgctcggcccttccggctg 6660 gctggtttattgctgataaatctggagccggtgagcgtgggtctcgcggtatcattgcag 6720 cactggggccagatggtaagccctcccgtatcgtagttatctacacgacggggagtcagg 6780 caactatggatgaacgaaatagacagatcgctgagataggtgcctcactgattaagcatt 6840 ggtaactgtcagaccaagtttactcatatatactttagattgatttaaaacttcattttt 6900 aatttaaaaggatctaggtgaagatcctttttgataatctcatgaccaaaatcccttaac 6960 gtgagttttcgttccactgagcgtcagaccccgtagaaaagatcaaaggatcttcttgag 7020 atcctttttttctgcgcgtaatctgctgcttgcaaacaaaaaaaccaccgctaccagcgg 7080 tggtttgtttgccggatcaagagctaccaactctttttccgaaggtaactggcttcagca 7140 gagcgcagataccaaatactgtccttctagtgtagccgtagttaggccaccacttcaaga 7200 actctgtagcaccgcctacatacctcgctctgctaatcctgttaccagtggctgctgcca 7260 gtggcgataagtcgtgtcttaccgggttggactcaagacgatagttaccggataaggcgc 7320 agcggtcgggctgaacggggggttcgtgcacacagcccagcttggagcgaacgacctaca 7380 ccgaactgagatacctacagcgtgagcattgagaaagcgccacgcttcccgaagggagaa 7440 aggcggacaggtatccggtaagcggcagggtcggaacaggagagcgcacgagggagcttc 7500 cagggggaaacgcctggtatctttatagtcctgtcgggtttcgccacctctgacttgagc 7560 gtcgatttttgtgatgctcgtcaggggggcggagcctatggaaaaacgccagcaacgcgg 7620 cctttttacggttcctggccttttgctggcctttttgaagctgtccctgatggtcgtcat 7680 ctacctgcctggacagcatggcctgcaacgcgggcatcccgatgccgccggaagcgagaa 7740 gaatcataatggggaaggccatccagcctcgcgtcg 7776 SEQIDNO:19 atgggcctgagcaacatcctgttcgtgatggccttcctgctgtccggagccgcccctctg 60 (CD86CoOP) aagatccaggcctacttcaacgagaccgccgacctgccctgccagttcgccaacagccag 120 aaccagagcctgagcgaactggtggtgttctggcaggaccaggaaaacctggtcctgaac 180 gaggtgtacctgggcaaagaaaagttcgacagcgtgcacagcaagtacatgggccggacc 240 agcttcgacagcgacagctggaccctgcggctgcacaacctgcagatcaaggacaagggc 300 ctgtaccagtgcatcatccaccacaagaaacccaccggcatgatcagaatccaccagatg 360 aacagcgagctgtccgtgctggccaacttcagccagcccgagatcgtgcccatcagcaac 420 atcaccgagaacgtgtacatcaacctgacctgcagcagcatccacggctaccccgagccc 480 aagaaaatgagcgtgctgctgcggaccaagaacagcaccatcgagtacgacggcgtgatg 540 cagaaaagccaggacaacgtgaccgagctgtacgacgtgagcatcagcctgagcgtgagc 600 ttccccgacgtgaccagcaacatgaccatcttttgcatcctggaaaccgacaagacccgg 660 ctgctgtccagccccttcagcatcgagctggaagatccccagccccctcccgaccacatc 720 ccctggatcaccgccgtgctgcccaccgtgatcatctgcgtgatggtgttctgcctgatc 780 ctgtggaagtggaagaagaagaagcggcctaggaacagctacaagtgcggcaccaacacc 840 atggaacgggaggaaagcgagcagaccaagaagcgggagaagatccacatccccgagcgg 900 agcgacgaggcccagcgggtgttcaagagcagcaagaccagcagctgcgacaagagcgac 960 acctgcttc 969 SEQIDNO:20 ggggacaagtttgtacaaaaaagcaggcttcgccaccatgggcctgagcaacatcctgtt 60 (CD86PCRP) cgtgatggccttcctgctgtccggagccgcccctctgaagatccaggcctacttcaacga 120 gaccgccgacctgccctgccagttcgccaacagccagaaccagagcctgagcgaactggt 180 ggtgttctggcaggaccaggaaaacctggtcctgaacgaggtgtacctgggcaaagaaaa 240 gttcgacagcgtgcacagcaagtacatgggccggaccagcttcgacagcgacagctggac 300 cctgcggctgcacaacctgcagatcaaggacaagggcctgtaccagtgcatcatccacca 360 caagaaacccaccggcatgatcagaatccaccagatgaacagcgagctgtccgtgctggc 420 caacttcagccagcccgagatcgtgcccatcagcaacatcaccgagaacgtgtacatcaa 480 cctgacctgcagcagcatccacggctaccccgagcccaagaaaatgagcgtgctgctgcg 540 gaccaagaacagcaccatcgagtacgacggcgtgatgcagaaaagccaggacaacgtgac 600 cgagctgtacgacgtgagcatcagcctgagcgtgagcttccccgacgtgaccagcaacat 660 gaccatcttttgcatcctggaaaccgacaagacccggctgctgtccagccccttcagcat 720 cgagctggaagatccccagccccctcccgaccacatcccctggatcaccgccgtgctgcc 780 caccgtgatcatctgcgtgatggtgttctgcctgatcctgtggaagtggaagaagaagaa 840 gcggcctaggaacagctacaagtgcggcaccaacaccatggaacgggaggaaagcgagca 900 gaccaagaagcgggagaagatccacatccccgagcggagcgacgaggcccagcgggtgtt 960 caagagcagcaagaccagcagctgcgacaagagcgacacctgcttctaggacccagcttt 1020 cttgtacaaagtggtcccc 1039 SEQIDNO:21 ctttcctgcgttatcccctgattctgtggataaccgtattaccgcctttgagtgagctga 60 (pDONR221CD86 taccgctcgccgcagccgaacgaccgagcgcagcgagtcagtgagcgaggaagcggaaga 120 vector) gcgcccaatacgcaaaccgcctctccccgcgcgttggccgattcattaatgcagctggca 180 cgacaggtttcccgactggaaagcgggcagtgagcgcaacgcaattaatacgcgtaccgc 240 tagccaggaagagtttgtagaaacgcaaaaaggccatccgtcaggatggccttctgctta 300 gtttgatgcctggcagtttatggcgggcgtcctgcccgccaccctccgggccgttgcttc 360 acaacgttcaaatccgctcccggcggatttgtcctactcaggagagcgttcaccgacaaa 420 caacagataaaacgaaaggcccagtcttccgactgagcctttcgttttatttgatgcctg 480 gcagttccctactctcgcgttaacgctagcatggatgttttcccagtcacgacgttgtaa 540 aacgacggccagtcttaagctcgggccccaaataatgattttattttgactgatagtgac 600 ctgttcgttgcaacacattgatgagcaatgcttttttataatgcacaagtttgtacaaaa 660 aagcaggcttcgccaccatgggcctgagcaacatcctgttcgtgatggccttcctgctgt 720 ccggagccgcccctctgaagatccaggcctacttcaacgagaccgccgacctgccctgcc 780 agttcgccaacagccagaaccagagcctgagcgaactggtggtgttctggcaggaccagg 840 aaaacctggtcctgaacgaggtgtacctgggcaaagaaaagttcgacagcgtgcacagca 900 agtacatgggccggaccagcttcgacagcgacagctggaccctgcggctgcacaacctgc 960 agatcaaggacaagggcctgtaccagtgcatcatccaccacaagaaacccaccggcatga 1020 tcagaatccaccagatgaacagcgagctgtccgtgctggccaacttcagccagcccgaga 1080 tcgtgcccatcagcaacatcaccgagaacgtgtacatcaacctgacctgcagcagcatcc 1140 acggctaccccgagcccaagaaaatgagcgtgctgctgcggaccaagaacagcaccatcg 1200 agtacgacggcgtgatgcagaaaagccaggacaacgtgaccgagctgtacgacgtgagca 1260 tcagcctgagcgtgagcttccccgacgtgaccagcaacatgaccatcttttgcatcctgg 1320 aaaccgacaagacccggctgctgtccagccccttcagcatcgagctggaagatccccagc 1380 cccctcccgaccacatcccctggatcaccgccgtgctgcccaccgtgatcatctgcgtga 1440 tggtgttctgcctgatcctgtggaagtggaagaagaagaagcggcctaggaacagctaca 1500 agtgcggcaccaacaccatggaacgggaggaaagcgagcagaccaagaagcgggagaaga 1560 tccacatccccgagcggagcgacgaggcccagcgggtgttcaagagcagcaagaccagca 1620 gctgcgacaagagcgacacctgcttctaggacccagctttcttgtacaaagtggtcatta 1680 taagaaagcattgcttatcaatttgttgcaacgaacaggtcactatcagtcaaaataaaa 1740 tcattatttgccatccagctgatatcccctatagtgagtcgtattacatggtcatagctg 1800 tttcctggcagctctggcccgtgtctcaaaatctctgatgttacattgcacaagataaaa 1860 taatatcatcatgaacaataaaactgtctgcttacataaacagtaatacaaggggtgtta 1920 tgagccatattcaacgggaaacgtcgaggccgcgattaaattccaacatggatgctgatt 1980 tatatgggtataaatgggctcgcgataatgtcgggcaatcaggtgcgacaatctatcgct 2040 tgtatgggaagcccgatgcgccagagttgtttctgaaacatggcaaaggtagcgttgcca 2100 atgatgttacagatgagatggtcagactaaactggctgacggaatttatgcctcttccga 2160 ccatcaagcattttatccgtactcctgatgatgcatggttactcaccactgcgatccccg 2220 gaaaaacagcattccaggtattagaagaatatcctgattcaggtgaaaatattgttgatg 2280 cgctggcagtgttcctgcgccggttgcattcgattcctgtttgtaattgtccttttaaca 2340 gcgatcgcgtatttcgtctcgctcaggcgcaatcacgaatgaataacggtttggttgatg 2400 cgagtgattttgatgacgagcgtaatggctggcctgttgaacaagtctggaaagaaatgc 2460 ataaacttttgccattctcaccggattcagtcgtcactcatggtgatttctcacttgata 2520 accttatttttgacgaggggaaattaataggttgtattgatgttggacgagtcggaatcg 2580 cagaccgataccaggatcttgccatcctatggaactgcctcggtgagttttctccttcat 2640 tacagaaacggctttttcaaaaatatggtattgataatcctgatatgaataaattgcagt 2700 ttcatttgatgctcgatgagtttttctaatcagaattggttaattggttgtaacactggc 2760 agagcattacgctgacttgacgggacggcgcaagctcatgaccaaaatcccttaacgtga 2820 gttacgcgtcgttccactgagcgtcagaccccgtagaaaagatcaaaggatcttcttgag 2880 atcctttttttctgcgcgtaatctgctgcttgcaaacaaaaaaaccaccgctaccagcgg 2940 tggtttgtttgccggatcaagagctaccaactctttttccgaaggtaactggcttcagca 3000 gagcgcagataccaaatactgttcttctagtgtagccgtagttaggccaccacttcaaga 3060 actctgtagcaccgcctacatacctcgctctgctaatcctgttaccagtggctgctgcca 3120 gtggcgataagtcgtgtcttaccgggttggactcaagacgatagttaccggataaggcgc 3180 agcggtcgggctgaacggggggttcgtgcacacagcccagcttggagcgaacgacctaca 3240 ccgaactgagatacctacagcgtgagctatgagaaagcgccacgcttcccgaagggagaa 3300 aggcggacaggtatccggtaagcggcagggtcggaacaggagagcgcacgagggagcttc 3360 cagggggaaacgcctggtatctttatagtcctgtcgggtttcgccacctctgacttgagc 3420 gtcgatttttgtgatgctcgtcaggggggcggagcctatggaaaaacgccagcaacgcgg 3480 cctttttacggttcctggccttttgctggccttttgctcacatgtt 3526 SEQIDNO:22 ctttcctgcgttatcccctgattctgtggataaccgtattaccgcctttgagtgagctga 60 (pDONR2214- taccgctcgccgcagccgaacgaccgagcgcagcgagtcagtgagcgaggaagcggaaga 120 1BBLvector) gcgcccaatacgcaaaccgcctctccccgcgcgttggccgattcattaatgcagctggca 180 cgacaggtttcccgactggaaagcgggcagtgagcgcaacgcaattaatacgcgtaccgc 240 tagccaggaagagtttgtagaaacgcaaaaaggccatccgtcaggatggccttctgctta 300 gtttgatgcctggcagtttatggcgggcgtcctgcccgccaccctccgggccgttgcttc 360 acaacgttcaaatccgctcccggcggatttgtcctactcaggagagcgttcaccgacaaa 420 caacagataaaacgaaaggcccagtcttccgactgagcctttcgttttatttgatgcctg 480 gcagttccctactctcgcgttaacgctagcatggatgttttcccagtcacgacgttgtaa 540 aacgacggccagtcttaagctcgggccccaaataatgattttattttgactgatagtgac 600 ctgttcgttgcaacacattgatgagcaatgcttttttataatgcacaagtttgtacaaaa 660 aagcaggcttcgccaccatggaatacgcctctgatgccagcctggaccccgaagctcctt 720 ggcctcctgcccctagagccagagcctgtagagtgctgccttgggctctggtggctggcc 780 ttctccttctgctgctgctggccgctgcctgcgctgtgtttctggcttgtccttgggccg 840 tgtcaggcgccagagcttctcctggatctgccgccagccccagactgagagagggacctg 900 agctgagccccgatgatcctgccggactgctggatctgagacagggcatgttcgcccagc 960 tggtggcccagaacgtgctgctgatcgatggccccctgagctggtacagcgatcctggac 1020 tggctggcgtgtcactgacaggcggcctgagctacaaagaggacaccaaagaactggtgg 1080 tggccaaggccggcgtgtactacgtgttctttcagctggaactgcggagagtggtggccg 1140 gcgaaggatccggctctgtgtctctggcactgcatctgcagcccctgagatctgctgcag 1200 gcgctgctgcactggccctgacagtggacctgcctccagcctctagcgaggccagaaact 1260 ccgcattcgggtttcaaggcagactgctgcacctgtctgccggccagagactgggagtgc 1320 atctgcacacagaggccagagccagacacgcctggcagctgacacagggcgctacagtgc 1380 tgggcctgttcagagtgacccccgaaattccagccggcctgcccagccctagaagcgagt 1440 aggacccagctttcttgtacaaagtggtcattataagaaagcattgcttatcaatttgtt 1500 gcaacgaacaggtcactatcagtcaaaataaaatcattatttgccatccagctgatatcc 1560 cctatagtgagtcgtattacatggtcatagctgtttcctggcagctctggcccgtgtctc 1620 aaaatctctgatgttacattgcacaagataaaataatatcatcatgaacaataaaactgt 1680 ctgcttacataaacagtaatacaaggggtgttatgagccatattcaacgggaaacgtcga 1740 ggccgcgattaaattccaacatggatgctgatttatatgggtataaatgggctcgcgata 1800 atgtcgggcaatcaggtgcgacaatctatcgcttgtatgggaagcccgatgcgccagagt 1860 tgtttctgaaacatggcaaaggtagcgttgccaatgatgttacagatgagatggtcagac 1920 taaactggctgacggaatttatgcctcttccgaccatcaagcattttatccgtactcctg 1980 atgatgcatggttactcaccactgcgatccccggaaaaacagcattccaggtattagaag 2040 aatatcctgattcaggtgaaaatattgttgatgcgctggcagtgttcctgcgccggttgc 2100 attcgattcctgtttgtaattgtccttttaacagcgatcgcgtatttcgtctcgctcagg 2160 cgcaatcacgaatgaataacggtttggttgatgcgagtgattttgatgacgagcgtaatg 2220 gctggcctgttgaacaagtctggaaagaaatgcataaacttttgccattctcaccggatt 2280 cagtcgtcactcatggtgatttctcacttgataaccttatttttgacgaggggaaattaa 2340 taggttgtattgatgttggacgagtcggaatcgcagaccgataccaggatcttgccatcc 2400 tatggaactgcctcggtgagttttctccttcattacagaaacggctttttcaaaaatatg 2460 gtattgataatcctgatatgaataaattgcagtttcatttgatgctcgatgagtttttct 2520 aatcagaattggttaattggttgtaacactggcagagcattacgctgacttgaggggagg 2580 gcgcaagctcatgaccaaaatcccttaacgtgagttacgcgtcgttccactgagcgtcag 2640 accccgtagaaaagatcaaaggatcttcttgagatcctttttttctgcgcgtaatctgct 2700 gcttgcaaacaaaaaaaccaccgctaccagcggtggtttgtttgccggatcaagagctac 2760 caactctttttccgaaggtaactggcttcagcagagcgcagataccaaatactgttcttc 2820 tagtgtagccgtagttaggccaccacttcaagaactctgtagcaccgcctacatacctcg 2880 ctctgctaatcctgttaccagtggctgctgccagtggcgataagtcgtgtcttaccgggt 2940 tggactcaagacgatagttaccggataaggcgcagcggtcgggctgaacggggggttcgt 3000 gcacacagcccagcttggagcgaacgacctacaccgaactgagatacctacagcgtgagc 3060 tatgagaaagcgccacgcttcccgaagggagaaaggcggacaggtatccggtaagcggca 3120 gggtcggaacaggagagcgcacgagggagcttccagggggaaacgcctggtatctttata 3180 gtcctgtcgggtttcgccacctctgacttgagcgtcgatttttgtgatgctcgtcagggg 3240 ggcggagcctatggaaaaacgccagcaacgcggcctttttacggttcctggccttttgct 3300 ggccttttgctcacatgtt 3319 SEQIDNO:23 cgataaccctaattcgatagcatatgcttcccgttgggtaacatatgctattgaattagg 60 (pLV430G gttagtctggatagtatatactactacccgggaagcatatgctacccgtttagggttcac 120 vector) cggtgatgccggccacgatgcgtccggcgtagaggatctaatgtgagttagctcactcat 180 taggcaccccaggctttacactttatgcttccggctcgtatgttgtgtggaattgtgagc 240 ggataacaatttcacacaggaaacagctatgaccatgattacgccaagcgcgcaattaac 300 cctcactaaagggaacaaaagctggagctgcaagcttaatgtagtcttatgcaatactct 360 tgtagtcttgcaacatggtaacgatgagttagcaacatgccttacaaggagagaaaaagc 420 accgtgcatgccgattggtggaagtaaggtggtacgatcgtgccttattaggaaggcaac 480 agacgggtctgacatggattggacgaaccactgaattgccgcattgcagagatattgtat 540 ttaagtgcctagctcgatacataaacgggtctctctggttagaccagatctgagcctggg 600 agctctctggctaactagggaacccactgcttaagcctcaataaagcttgccttgagtgc 660 ttcaagtagtgtgtgcccgtctgttgtgtgactctggtaactagagatccctcagaccct 720 tttagtcagtgtggaaaatctctagcagtggcgcccgaacagggacttgaaagcgaaagg 780 gaaaccagaggagctctctcgacgcaggactcggcttgctgaagcgcgcacggcaagagg 840 cgaggggcggcgactggtgagtacgccaaaaattttgactagcggaggctagaaggagag 900 agatgggtgcgagagcgtcagtattaagcgggggagaattagatcgcgatgggaaaaaat 960 tcggttaaggccagggggaaagaaaaaatataaattaaaacatatagtatgggcaagcag 1020 ggagctagaacgattcgcagttaatcctggcctgttagaaacatcagaaggctgtagaca 1080 aatactgggacagctacaaccatcccttcagacaggatcagaagaacttagatcattata 1140 taatacagtagcaaccctctattgtgtgcatcaaaggatagagataaaagacaccaagga 1200 agctttagacaagatagaggaagagcaaaacaaaagtaagaccaccgcacagcaagcggc 1260 cgctgatcttcagacctggaggaggagatatgagggacaattggagaagtgaattatata 1320 aatataaagtagtaaaaattgaaccattaggagtagcacccaccaaggcaaagagaagag 1380 tggtgcagagagaaaaaagagcagtgggaataggagctttgttccttgggttcttgggag 1440 cagcaggaagcactatgggcgcagcgtcaatgacgctgacggtacaggccagacaattat 1500 tgtctggtatagtgcagcagcagaacaatttgctgagggctattgaggcgcaacagcatc 1560 tgttgcaactcacagtctggggcatcaagcagctccaggcaagaatcctggctgtggaaa 1620 gatacctaaaggatcaacagctcctggggatttggggttgctctggaaaactcatttgca 1680 ccactgctgtgccttggaatgctagttggagtaataaatctctggaacagatttggaatc 1740 acacgacctggatggagtgggacagagaaattaacaattacacaagcttaatacactcct 1800 taattgaagaatcgcaaaaccagcaagaaaagaatgaacaagaattattggaattagata 1860 aatgggcaagtttgtggaattggtttaacataacaaattggctgtggtatataaaattat 1920 tcataatgatagtaggaggcttggtaggtttaagaatagtttttgctgtactttctatag 1980 tgaatagagttaggcagggatattcaccattatcgtttcagacccacctcccaaccccga 2040 ggggacccgacaggcccgaaggaatagaagaagaaggtggagagagagacagagacagat 2100 ccattcgattagtgaacggatctcgacggtatcggttttaaaagaaaaggggggattggg 2160 gggtacagtgcaggggaaagaatagtagacataatagcaacagacatacaaactaaagaa 2220 ttacaaaaacaaattacaaaaattcaaaattttatcgattttatttagtctccagaaaaa 2280 ggggggaatgaaagaccccacctgtaggtttggcaagctagcttaagtaacgccattttg 2340 caaggcatggaaaatacataactgagaatagagaagttcagatcaaggttaggaacagag 2400 agacaggagaatatgggccaaacaggatatctgtggtaagcagttcctgccccggctcag 2460 ggccaagaacagatggtccccagatgcggtcccgccctcagcagtttctagagaaccatc 2520 agatgtttccagggtgccccaaggacctgaaatgaccctgtgccttatttgaactaacca 2580 atcagttcgcttctcgcttctgttcgcgcgcttctgctccccgagctcaataaaagagcc 2640 cacaacccctcactcggcgcgccagtcctccgatagactgcgtcgcccgggtaccgatat 2700 cacaagtttgtacaaaaaagctgaacgagaaacgtaaaatgatataaatatcaatatatt 2760 aaattagattttgcataaaaaacagactacataatactgtaaaacacaacatatccagtc 2820 actatggcggccgcattaggcaccccaggctttacactttatgcttccggctcgtataat 2880 gtgtggattttgagttaggatccgtcgagattttcaggagctaaggaagctaaaatggag 2940 aaaaaaatcactggatataccaccgttgatatatcccaatggcatcgtaaagaacatttt 3000 gaggcatttcagtcagttgctcaatgtacctataaccagaccgttcagctggatattacg 3060 gcctttttaaagaccgtaaagaaaaataagcacaagttttatccggcctttattcacatt 3120 cttgcccgcctgatgaatgctcatccggaattccgtatggcaatgaaagacggtgagctg 3180 gtgatatgggatagtgttcacccttgttacaccgttttccatgagcaaactgaaacgttt 3240 tcatcgctctggagtgaataccacgacgatttccggcagtttctacacatatattcgcaa 3300 gatgtggcgtgttacggtgaaaacctggcctatttccctaaagggtttattgagaatatg 3360 tttttcgtctcagccaatccctgggtgagtttcaccagttttgatttaaacgtggccaat 3420 atggacaacttcttcgcccccgttttcaccatgggcaaatattatacgcaaggcgacaag 3480 gtgctgatgccgctggcgattcaggttcatcatgccgtttgtgatggcttccatgtcggc 3540 agaatgcttaatgaattacaacagtactgcgatgagtggcagggcggggcgtaaacgcgt 3600 ggatccggcttactaaaagccagataacagtatgcgtatttgcgcgctgatttttgcggt 3660 ataagaatatatactgatatgtatacccgaagtatgtcaaaaagaggtatgctatgaagc 3720 agcgtattacagtgacagttgacagcgacagctatcagttgctcaaggcatatatgatgt 3780 caatatctccggtctggtaagcacaaccatgcagaatgaagcccgtcgtctgcgtgccga 3840 acgctggaaagcggaaaatcaggaagggatggctgaggtcgcccggtttattgaaatgaa 3900 cggctcttttgctgacgagaacaggggctggtgaaatgcagtttaaggtttacacctata 3960 aaagagagagccgttatcgtctgtttgtggatgtacagagtgatattattgacacgcccg 4020 ggcgacggatggtgatccccctggccagtgcacgtctgctgtcagataaagtctcccgtg 4080 aactttacccggtggtgcatatcggggatgaaagctggcgcatgatgaccaccgatatgg 4140 ccagtgtgccggtctccgttatcggggaagaagtggctgatctcagccaccgcgaaaatg 4200 acatcaaaaacgccattaacctgatgttctggggaatataaatgtcaggctcccttatac 4260 acagccagtctgcaggtcgaccatagtgactggatatgttgtgttttacagtattatgta 4320 gtctgttttttatgcaaaatctaatttaatatattgatatttatatcattttacgtttct 4380 cgttcagctttcttgtacaaagtggtgattcgagttaattaagctagcctagtgccattt 4440 gttcagtggttcgtagggctttcccccactgtttggctttcagttatatggatgatgtgg 4500 tattgggggccaagtctgtacagcatcttgagtccctttttaccgctgttaccaattttc 4560 ttttgtctttgggtatacatttaaaccctaacaaaacaaagagatggggttactctctaa 4620 attttatgggttatgtcattggatgttatgggtccttgccacaagaacacatcatacaaa 4680 aaatcaaagaatgttttagaaaacttcctattaacaggcctattgattggaaagtatgtc 4740 aacgaattgtgggtcttttgggttttgctgccccttttacacaatgtggttatcctgcgt 4800 tgatgcctttgtatgcatgtattcaatctaagcaggctttcactttctcgccaacttaca 4860 aggcctttctgtgtaaacaatacctgaacctttaccccgttgcccggcaacggccaggtc 4920 tgtgccaagtgtttgctgacgcaacccccactggctggggcttggtcatgggccatcagc 4980 gcatgcgtggaaccttttcggctcctctgccgatccatactgcggaactcctagccgctt 5040 gttttgctcgcagcaggtctggagcaaacattatcgggactgataactctgttgtcctat 5100 cccgcaaatatacatcgtttccatggctgctaggctgtgctgccaactggatcctgcgcg 5160 ggacgtcctttgtttacgtcccgtcggcgctgaatcctgcggacgacccttctcggggtc 5220 gcttgggactctctcgtccccttctccgtctgccgttccgaccgaccacggggcgcacct 5280 ctctttacgcggactccccgtctgtgccttctcatctgccggaccgtgtgcacttcgctt 5340 cacctctgcacgtcgcatggagaccaccgtgaacgcccaccaaatattgcccaaggtctt 5400 acataagaggactcttggactctcagcaatgtcaacgaccgaccttgaggcatacttcaa 5460 agactgtttgtttaaagactgggaggagttgggggaggagattaggttaaaggtctttgt 5520 actaggaggctgtaggcataaattggtctgcgcaccagcaccatggcgcaatcactagag 5580 cggggtacctttaagaccaatgacttacaaggcagctgtagatcttagccactttttaaa 5640 agaaaaggggggactggaagggctaattcactcccaacgaagacaagatctgctttttgc 5700 ttgtactgggtctctctggttagaccagatctgagcctgggagctctctggctaactagg 5760 gaacccactgcttaagcctcaataaagcttgccttgagtgcttcaagtagtgtgtgcccg 5820 tctgttgtgtgactctggtaactagagatccctcagacccttttagtcagtgtggaaaat 5880 ctctagcagtagtagttcatgtcatcttattattcagtatttataacttgcaaagaaatg 5940 aatatcagagagtgagaggaacttgtttattgcagcttataatggttacaaataaagcaa 6000 tagcatcacaaatttcacaaataaagcatttttttcactgcattctagttgtggtttgtc 6060 caaactcatcaatgtatcttatcatgtctggctctagctatcccgcccctaactccgccc 6120 atcccgcccctaactccgcccagttccgcccattctccgccccatggctgactaattttt 6180 tttatttatgcagaggccgaggccggatcccttgagtggctttcatcctggagcagactt 6240 tgcagtctgtggactgcaacacaacattgcctttatgtgtaactcttggctgaagctctt 6300 acaccaatgctgggggacatgtacctcccaggggcccaggaagactacgggaggctacac 6360 caacgtcaatcagaggggcctgtgtagctaccgataagcggaccctcaagagggcattag 6420 caatagtgtttataaggcccccttgttaattcttgaagacgaaagggcctcgtgatacgc 6480 ctatttttataggttaatgtcatgataataatggtttcttagacgtcaggtggcactttt 6540 cggggaaatgtgcgcggaacccctatttgtttatttttctaaatacattcaaatatgtat 6600 ccgctcatgagacaataaccctgataaatgcttcaataatattgaaaaaggaagagtatg 6660 agtattcaacatttccgtgtcgcccttattcccttttttgcggcattttgccttcctgtt 6720 tttgctcacccagaaacgctggtgaaagtaaaagatgctgaagatcagttgggtgcacga 6780 gtgggttacatcgaactggatctcaacagcggtaagatccttgagagttttcgccccgaa 6840 gaacgttttccaatgatgagcacttttaaagttctgctatgtggcgcggtattatcccgt 6900 gttgacgccgggcaagagcaactcggtcgccgcatacactattctcagaatgacttggtt 6960 gagtactcaccagtcacagaaaagcatcttacggatggcatgacagtaagagaattatgc 7020 agtgctgccataaccatgagtgataacactgcggccaacttacttctgacaacgatcgga 7080 ggaccgaaggagctaaccgcttttttgcacaacatgggggatcatgtaactcgccttgat 7140 cgttgggaaccggagctgaatgaagccataccaaacgacgagcgtgacaccacgatgcct 7200 gcagcaatggcaacaacgttgcgcaaactattaactggcgaactacttactctagcttcc 7260 cggcaacaattaatagactggatggaggcggataaagttgcaggaccacttctgcgctcg 7320 gcccttccggctggctggtttattgctgataaatctggagccggtgagcgtgggtctcgc 7380 ggtatcattgcagcactggggccagatggtaagccctcccgtatcgtagttatctacacg 7440 acggggagtcaggcaactatggatgaacgaaatagacagatcgctgagataggtgcctca 7500 ctgattaagcattggtaactgtcagaccaagtttactcatatatactttagattgattta 7560 aaacttcatttttaatttaaaaggatctaggtgaagatcctttttgataatctcatgacc 7620 aaaatcccttaacgtgagttttcgttccactgagcgtcagaccccgtagaaaagatcaaa 7680 ggatcttcttgagatcctttttttctgcgcgtaatctgctgcttgcaaacaaaaaaacca 7740 ccgctaccagcggtggtttgtttgccggatcaagagctaccaactctttttccgaaggta 7800 actggcttcagcagagcgcagataccaaatactgtccttctagtgtagccgtagttaggc 7860 caccacttcaagaactctgtagcaccgcctacatacctcgctctgctaatcctgttacca 7920 gtggctgctgccagtggcgataagtcgtgtcttaccgggttggactcaagacgatagtta 7980 ccggataaggcgcagcggtcgggctgaacggggggttcgtgcacacagcccagcttggag 8040 cgaacgacctacaccgaactgagatacctacagcgtgagcattgagaaagcgccacgctt 8100 cccgaagggagaaaggcggacaggtatccggtaagcggcagggtcggaacaggagagcgc 8160 acgagggagcttccagggggaaacgcctggtatctttatagtcctgtcgggtttcgccac 8220 ctctgacttgagcgtcgatttttgtgatgctcgtcaggggggcggagcctatggaaaaac 8280 gccagcaacgcggcctttttacggttcctggccttttgctggcctttttgaagctgtccc 8340 tgatggtcgtcatctacctgcctggacagcatggcctgcaacgcgggcatcccgatgccg 8400 ccggaagcgagaagaatcataatggggaaggccatccagcctcgcgtcg 8449 SEQIDNO:24 ctttcctgcgttatcccctgattctgtggataaccgtattaccgcctttgagtgagctga 60 (pDONR221 taccgctcgccgcagccgaacgaccgagcgcagcgagtcagtgagcgaggaagcggaaga 120 vector) gcgcccaatacgcaaaccgcctctccccgcgcgttggccgattcattaatgcagctggca 180 cgacaggtttcccgactggaaagcgggcagtgagcgcaacgcaattaatacgcgtaccgc 240 tagccaggaagagtttgtagaaacgcaaaaaggccatccgtcaggatggccttctgctta 300 gtttgatgcctggcagtttatggcgggcgtcctgcccgccaccctccgggccgttgcttc 360 acaacgttcaaatccgctcccggcggatttgtcctactcaggagagcgttcaccgacaaa 420 caacagataaaacgaaaggcccagtcttccgactgagcctttcgttttatttgatgcctg 480 gcagttccctactctcgcgttaacgctagcatggatgttttcccagtcacgacgttgtaa 540 aacgacggccagtcttaagctcgggccccaaataatgattttattttgactgatagtgac 600 ctgttcgttgcaacacattgatgagcaatgcttttttataatgccaactttgtacaaaaa 660 agctgaacgagaaacgtaaaatgatataaatatcaatatattaaattagattttgcataa 720 aaaacagactacataatactgtaaaacacaacatatccagtcactatgaatcaactactt 780 agatggtattagtgacctgtagtcgaccgacagccttccaaatgttcttcgggtgatgct 840 gccaacttagtcgaccgacagccttccaaatgttcttctcaaacggaatcgtcgtatcca 900 gcctactcgctattgtcctcaatgccgtattaaatcataaaaagaaataagaaaaagagg 960 tgcgagcctcttttttgtgtgacaaaataaaaacatctacctattcatatacgctagtgt 1020 catagtcctgaaaatcatctgcatcaagaacaatttcacaactcttatacttttctctta 1080 caagtcgttcggcttcatctggattttcagcctctatacttactaaacgtgataaagttt 1140 ctgtaatttctactgtatcgacctgcagactggctgtgtataagggagcctgacatttat 1200 attccccagaacatcaggttaatggcgtttttgatgtcattttcgcggtggctgagatca 1260 gccacttcttccccgataacggagaccggcacactggccatatcggtggtcatcatgcgc 1320 cagctttcatccccgatatgcaccaccgggtaaagttcacgggagactttatctgacagc 1380 agacgtgcactggccagggggatcaccatccgtcgcccgggcgtgtcaataatatcactc 1440 tgtacatccacaaacagacgataacggctctctcttttataggtgtaaaccttaaactgc 1500 atttcaccagcccctgttctcgtcagcaaaagagccgttcatttcaataaaccgggcgac 1560 ctcagccatcccttcctgattttccgctttccagcgttcggcacgcagacgacgggcttc 1620 attctgcatggttgtgcttaccagaccggagatattgacatcatatatgccttgagcaac 1680 tgatagctgtcgctgtcaactgtcactgtaatacgctgcttcatagcatacctctttttg 1740 acatacttcgggtatacatatcagtatatattcttataccgcaaaaatcagcgcgcaaat 1800 acgcatactgttatctggcttttagtaagccggatccacgcggcgtttacgccccgccct 1860 gccactcatcgcagtactgttgtaattcattaagcattctgccgacatggaagccatcac 1920 agacggcatgatgaacctgaatcgccagcggcatcagcaccttgtcgccttgcgtataat 1980 atttgcccatggtgaaaacgggggcgaagaagttgtccatattggccacgtttaaatcaa 2040 aactggtgaaactcacccagggattggctgagacgaaaaacatattctcaataaaccctt 2100 tagggaaataggccaggttttcaccgtaacacgccacatcttgcgaatatatgtgtagaa 2160 actgccggaaatcgtcgtggtattcactccagagcgatgaaaacgtttcagtttgctcat 2220 ggaaaacggtgtaacaagggtgaacactatcccatatcaccagctcaccgtctttcattg 2280 ccatacggaattccggatgagcattcatcaggcgggcaagaatgtgaataaaggccggat 2340 aaaacttgtgcttatttttctttacggtctttaaaaaggccgtaatatccagctgaacgg 2400 tctggttataggtacattgagcaactgactgaaatgcctcaaaatgttctttacgatgcc 2460 attgggatatatcaacggtggtatatccagtgatttttttctccattttagcttccttag 2520 ctcctgaaaatctcgataactcaaaaaatacgcccggtagtgatcttatttcattatggt 2580 gaaagttggaacctcttacgtgccgatcaacgtctcattttcgccaaaagttggcccagg 2640 gcttcccggtatcaacagggacaccaggatttatttattctgcgaagtgatcttccgtca 2700 caggtatttattcggcgcaaagtgcgtcgggtgatgctgccaacttagtcgactacaggt 2760 cactaataccatctaagtagttgattcatagtgactggatatgttgtgttttacagtatt 2820 atgtagtctgttttttatgcaaaatctaatttaatatattgatatttatatcattttacg 2880 tttctcgttcagctttcttgtacaaagttggcattataagaaagcattgcttatcaattt 2940 gttgcaacgaacaggtcactatcagtcaaaataaaatcattatttgccatccagctgata 3000 tcccctatagtgagtcgtattacatggtcatagctgtttcctggcagctctggcccgtgt 3060 ctcaaaatctctgatgttacattgcacaagataaaataatatcatcatgaacaataaaac 3120 tgtctgcttacataaacagtaatacaaggggtgttatgagccatattcaacgggaaacgt 3180 cgaggccgcgattaaattccaacatggatgctgatttatatgggtataaatgggctcgcg 3240 ataatgtcgggcaatcaggtgcgacaatctatcgcttgtatgggaagcccgatgcgccag 3300 agttgtttctgaaacatggcaaaggtagcgttgccaatgatgttacagatgagatggtca 3360 gactaaactggctgacggaatttatgcctcttccgaccatcaagcattttatccgtactc 3420 ctgatgatgcatggttactcaccactgcgatccccggaaaaacagcattccaggtattag 3480 aagaatatcctgattcaggtgaaaatattgttgatgcgctggcagtgttcctgcgccggt 3540 tgcattcgattcctgtttgtaattgtccttttaacagcgatcgcgtatttcgtctcgctc 3600 aggcgcaatcacgaatgaataacggtttggttgatgcgagtgattttgatgacgagcgta 3660 atggctggcctgttgaacaagtctggaaagaaatgcataaacttttgccattctcaccgg 3720 attcagtcgtcactcatggtgatttctcacttgataaccttatttttgacgaggggaaat 3780 taataggttgtattgatgttggacgagtcggaatcgcagaccgataccaggatcttgcca 3840 tcctatggaactgcctcggtgagttttctccttcattacagaaacggctttttcaaaaat 3900 atggtattgataatcctgatatgaataaattgcagtttcatttgatgctcgatgagtttt 3960 tctaatcagaattggttaattggttgtaacactggcagagcattacgctgacttgacggg 4020 acggcgcaagctcatgaccaaaatcccttaacgtgagttacgcgtcgttccactgagcgt 4080 cagaccccgtagaaaagatcaaaggatcttcttgagatcctttttttctgcgcgtaatct 4140 gctgcttgcaaacaaaaaaaccaccgctaccagcggtggtttgtttgccggatcaagagc 4200 taccaactctttttccgaaggtaactggcttcagcagagcgcagataccaaatactgttc 4260 ttctagtgtagccgtagttaggccaccacttcaagaactctgtagcaccgcctacatacc 4320 tcgctctgctaatcctgttaccagtggctgctgccagtggcgataagtcgtgtcttaccg 4380 ggttggactcaagacgatagttaccggataaggcgcagcggtcgggctgaacggggggtt 4440 cgtgcacacagcccagcttggagcgaacgacctacaccgaactgagatacctacagcgtg 4500 agctatgagaaagcgccacgcttcccgaagggagaaaggcggacaggtatccggtaagcg 4560 gcagggtcggaacaggagagcgcacgagggagcttccagggggaaacgcctggtatcttt 4620 atagtcctgtcgggtttcgccacctctgacttgagcgtcgatttttgtgatgctcgtcag 4680 gggggcggagcctatggaaaaacgccagcaacgcggcctttttacggttcctggcctttt 4740 gctggccttttgctcacatgt 4761 SEQIDNO:25 aaaaggatcttcacctagatccttttaaattaaaaatgaagttttaaatcaatctaaagt 60 (psPAX2 atatatgagtaaacttggtctgacagttaccaatgcttaatcagtgaggcacctatctca 120 plasmid) gcgatctgtctatttcgttcatccatagttgcctgactccccgtcgtgtagataactacg 180 atacgggagggcttaccatctggccccagtgctgcaatgataccgcgagacccacgctca 240 ccggctccagatttatcagcaataaaccagccagccggaagggccgagcgcagaagtggt 300 cctgcaactttatccgcctccatccagtctattaattgttgccgggaagctagagtaagt 360 agttcgccagttaatagtttgcgcaacgttgttgccattgctacaggcatcgtggtgtca 420 cgctcgtcgtttggtatggcttcattcagctccggttcccaacgatcaaggcgagttaca 480 tgatcccccatgttgtgcaaaaaagcggttagctccttcggtcctccgatcgttgtcaga 540 agtaagttggccgcagtgttatcactcatggttatggcagcactgcataattctcttact 600 gtcatgccatccgtaagatgcttttctgtgactggtgagtactcaaccaagtcattctga 660 gaatagtgtatgcggcgaccgagttgctcttgcccggcgtcaatacgggataataccgcg 720 ccacatagcagaactttaaaagtgctcatcattggaaaacgttcttcggggcgaaaactc 780 tcaaggatcttaccgctgttgagatccagttcgatgtaacccactcgtgcacccaactga 840 tcttcagcatcttttactttcaccagcgtttctgggtgagcaaaaacaggaaggcaaaat 900 gccgcaaaaaagggaataagggcgacacggaaatgttgaatactcatactcttccttttt 960 caatattattgaagcatttatcagggttattgtctcatgagcggatacatatttgaatgt 1020 atttagaaaaataaacaaataggggttccgcgcacatttccccgaaaagtgccacctggt 1080 cgacattgattattgactagttattaatagtaatcaattacggggtcattagttcatagc 1140 ccatatatggagttccgcgttacataacttacggtaaatggcccgcctggctgaccgccc 1200 aacgacccccgcccattgacgtcaataatgacgtatgttcccatagtaacgccaataggg 1260 actttccattgacgtcaatgggtggactatttacggtaaactgcccacttggcagtacat 1320 caagtgtatcatatgccaagtacgccccctattgacgtcaatgacggtaaatggcccgcc 1380 tggcattatgcccagtacatgaccttatgggactttcctacttggcagtacatctacgta 1440 ttagtcatcgctattaccatgggtcgaggtgagccccacgttctgcttcactctccccat 1500 ctcccccccctccccacccccaattttgtatttatttattttttaattattttgtgcagc 1560 gatgggggcggggggggggggggcgcgcgccaggcggggcggggcggggcgaggggcggg 1620 gcggggcgaggcggagaggtgcggcggcagccaatcagagcggcgcgctccgaaagtttc 1680 cttttatggcgaggcggcggcggcggcggccctataaaaagcgaagcgcgcggcgggcgg 1740 gagtcgctgcgttgccttcgccccgtgccccgctccgcgccgcctcgcgccgcccgcccc 1800 ggctctgactgaccgcgttactcccacaggtgagcgggcgggacggcccttctcctccgg 1860 gctgtaattagcgcttggtttaatgacggctcgtttcttttctgtggctgcgtgaaagcc 1920 ttaaagggctccgggagggccctttgtgcgggggggagcggctcggggggtgcgtgcgtg 1980 tgtgtgtgcgtggggagcgccgcgtgcggcccgcgctgcccggcggctgtgagcgctgcg 2040 ggcgcggcgcggggctttgtgcgctccgcgtgtgcgcgaggggagcgcggccgggggcgg 2100 tgccccgcggtgcgggggggctgcgaggggaacaaaggctgcgtgcggggtgtgtgcgtg 2160 ggggggtgagcagggggtgtgggcgcggcggtcgggctgtaacccccccctgcaccgccc 2220 tccccgagttgctgagcacggcccggcttcgggtgcggggctccgtgcggggcgtggcgc 2280 ggggctcgccgtgccgggcggggggtggcggcaggtgggggtgccgggcggggcggggcc 2340 gcctcgggccggggagggctcgggggaggggcgcggcggccccggagcgccggcggctgt 2400 cgaggcgcggcgagccgcagccattgccttttatggtaatcgtgcgagagggcgcaggga 2460 cttcctttgtcccaaatctggcggagccgaaatctgggaggcgccgccgcaccccctcta 2520 gcgggcgcgggcgaagcggtgcggcgccggcaggaaggaaatgggcggggagggccttcg 2580 tgcgtcgccgcgccgccgtccccttctccatctccagcctcggggctgccgcagggggac 2640 ggctgccttcgggggggacggggcagggcggggttcggcttctggcgtgtgaccggcggc 2700 tctagagcctctgctaaccatgttcatgccttcttctttttcctacagctcctgggcaac 2760 gtgctggttattgtgctgtctcatcattttggcaaagaattcgggccggccgcgttgacg 2820 cgcacggcaagaggcgaggggcggcgactggtgagagatgggtgcgagagcgtcagtatt 2880 aagcgggggagaattagatcgatgggaaaaaattcggttaaggccagggggaaagaaaaa 2940 atataaattaaaacatatagtatgggcaagcagggagctagaacgattcgcagttaatcc 3000 tggcctgttagaaacatcagaaggctgtagacaaatactgggacagctacaaccatccct 3060 tcagacaggatcagaagaacttagatcattatataatacagtagcaaccctctattgtgt 3120 gcatcaaaggatagagataaaagacaccaaggaagctttagacaagatagaggaagagca 3180 aaacaaaagtaagaaaaaagcacagcaagcagcagctgacacaggacacagcaatcaggt 3240 cagccaaaattaccctatagtgcagaacatccaggggcaaatggtacatcaggccatatc 3300 acctagaactttaaatgcatgggtaaaagtagtagaagagaaggctttcagcccagaagt 3360 gatacccatgttttcagcattatcagaaggagccaccccacaagatttaaacaccatgct 3420 aaacacagtggggggacatcaagcagccatgcaaatgttaaaagagaccatcaatgagga 3480 agctgcagaatgggatagagtgcatccagtgcatgcagggcctattgcaccaggccagat 3540 gagagaaccaaggggaagtgacatagcaggaactactagtacccttcaggaacaaatagg 3600 atggatgacacataatccacctatcccagtaggagaaatctataaaagatggataatcct 3660 gggattaaataaaatagtaagaatgtatagccctaccagcattctggacataagacaagg 3720 accaaaggaaccctttagagactatgtagaccgattctataaaactctaagagccgagca 3780 agcttcacaagaggtaaaaaattggatgacagaaaccttgttggtccaaaatgcgaaccc 3840 agattgtaagactattttaaaagcattgggaccaggagcgacactagaagaaatgatgac 3900 agcatgtcagggagtggggggacccggccataaagcaagagttttggctgaagcaatgag 3960 ccaagtaacaaatccagctaccataatgatacagaaaggcaattttaggaaccaaagaaa 4020 gactgttaagtgtttcaattgtggcaaagaagggcacatagccaaaaattgcagggcccc 4080 taggaaaaagggctgttggaaatgtggaaaggaaggacaccaaatgaaagattgtactga 4140 gagacaggctaattttttagggaagatctggccttcccacaagggaaggccagggaattt 4200 tcttcagagcagaccagagccaacagccccaccagaagagagcttcaggtttggggaaga 4260 gacaacaactccctctcagaaggaggagccgatagacaaggaactgtatcctttagcttc 4320 cctcagatcactctttggcagcgacccctcgtcacaataaagataggggggcaattaaag 4380 gaagctctattagatacaggagcagatgatacagtattagaagaaatgaatttgccagga 4440 agatggaaaccaaaaatgatagggggaattggaggttttatcaaagtaggacagtatgat 4500 cagatactcatagaaatctgcggacataaagctataggtacagtattagtaggacctaca 4560 cctgtcaacataattggaagaaatctgttgactcagattggctgcactttaaattttccc 4620 attagtcctattgagactgtaccagtaaaattaaagccaggaatggatggcccaaaagtt 4680 aaacaatggccattgacagaagaaaaaataaaagcattagtagaaatttgtacagaaatg 4740 gaaaaggaaggaaaaatttcaaaaattgggcctgaaaatccatacaatactccagtattt 4800 gccataaagaaaaaagacagtactaaatggagaaaattagtagatttcagagaacttaat 4860 aagagaactcaagatttctgggaagttcaattaggaataccacatcctgcagggttaaaa 4920 cagaaaaaatcagtaacagtactggatgtgggcgatgcatatttttcagttcccttagat 4980 aaagacttcaggaagtatactgcatttaccatacctagtataaacaatgagacaccaggg 5040 attagatatcagtacaatgtgcttccacagggatggaaaggatcaccagcaatattccag 5100 tgtagcatgacaaaaatcttagagccttttagaaaacaaaatccagacatagtcatctat 5160 caatacatggatgatttgtatgtaggatctgacttagaaatagggcagcatagaacaaaa 5220 atagaggaactgagacaacatctgttgaggtggggatttaccacaccagacaaaaaacat 5280 cagaaagaacctccattcctttggatgggttatgaactccatcctgataaatggacagta 5340 cagcctatagtgctgccagaaaaggacagctggactgtcaatgacatacagaaattagtg 5400 ggaaaattgaattgggcaagtcagatttatgcagggattaaagtaaggcaattatgtaaa 5460 cttcttaggggaaccaaagcactaacagaagtagtaccactaacagaagaagcagagcta 5520 gaactggcagaaaacagggagattctaaaagaaccggtacatggagtgtattatgaccca 5580 tcaaaagacttaatagcagaaatacagaagcaggggcaaggccaatggacatatcaaatt 5640 tatcaagagccatttaaaaatctgaaaacaggaaaatatgcaagaatgaagggtgcccac 5700 actaatgatgtgaaacaattaacagaggcagtacaaaaaatagccacagaaagcatagta 5760 atatggggaaagactcctaaatttaaattacccatacaaaaggaaacatgggaagcatgg 5820 tggacagagtattggcaagccacctggattcctgagtgggagtttgtcaatacccctccc 5880 ttagtgaagttatggtaccagttagagaaagaacccataataggagcagaaactttctat 5940 gtagatggggcagccaatagggaaactaaattaggaaaagcaggatatgtaactgacaga 6000 ggaagacaaaaagttgtccccctaacggacacaacaaatcagaagactgagttacaagca 6060 attcatctagctttgcaggattcgggattagaagtaaacatagtgacagactcacaatat 6120 gcattgggaatcattcaagcacaaccagataagagtgaatcagagttagtcagtcaaata 6180 atagagcagttaataaaaaaggaaaaagtctacctggcatgggtaccagcacacaaagga 6240 attggaggaaatgaacaagtagatgggttggtcagtgctggaatcaggaaagtactattt 6300 ttagatggaatagataaggcccaagaagaacatgagaaatatcacagtaattggagagca 6360 atggctagtgattttaacctaccacctgtagtagcaaaagaaatagtagccagctgtgat 6420 aaatgtcagctaaaaggggaagccatgcatggacaagtagactgtagcccaggaatatgg 6480 cagctagattgtacacatttagaaggaaaagttatcttggtagcagttcatgtagccagt 6540 ggatatatagaagcagaagtaattccagcagagacagggcaagaaacagcatacttcctc 6600 ttaaaattagcaggaagatggccagtaaaaacagtacatacagacaatggcagcaatttc 6660 accagtactacagttaaggccgcctgttggtgggcggggatcaagcaggaatttggcatt 6720 ccctacaatccccaaagtcaaggagtaatagaatctatgaataaagaattaaagaaaatt 6780 ataggacaggtaagagatcaggctgaacatcttaagacagcagtacaaatggcagtattc 6840 atccacaattttaaaagaaaaggggggattggggggtacagtgcaggggaaagaatagta 6900 gacataatagcaacagacatacaaactaaagaattacaaaaacaaattacaaaaattcaa 6960 aattttcgggtttattacagggacaggagagatccagtttggaaaggaccagcaaagctc 7020 ctctggaaaggtgaaggggcagtagtaatacaagataatagtgacataaaagtagtgcca 7080 agaagaaaagcaaagatcatcagggattatggaaaacagatggcaggtgatgattgtgtg 7140 gcaagtagacaggatgaggattaacacatggaattctgcaacaactgctgtttatccatt 7200 tcagaattgggtgtcgacatagcagaataggcgttactcgacagaggagagcaagaaatg 7260 gagccagtagatcctagactagagccctggaagcatccaggaagtcagcctaaaactgct 7320 tgtaccaattgctattgtaaaaagtgttgctttcattgccaagtttgtttcatgacaaaa 7380 gccttaggcatctcctatggcaggaagaagcggagacagcgacgaagagctcatcagaac 7440 agtcagactcatcaagcttctctatcaaagcagtaagtagtacatgtaatgcaacctata 7500 atagtagcaatagtagcattagtagtagcaataataatagcaatagttgtgtggtccata 7560 gtaatcatagaatataggaaaatggccgctgatcttcagacctggaggaggagatatgag 7620 ggacaattggagaagtgaattatataaatataaagtagtaaaaattgaaccattaggagt 7680 agcacccaccaaggcaaagagaagagtggtgcagagagaaaaaagagcagtgggaatagg 7740 agctttgttccttgggttcttgggagcagcaggaagcactatgggcgcagcctcaatgac 7800 gctgacggtacaggccagacaattattgtctggtatagtgcaggaggagaacaatttgct 7860 gagggctattgaggcgcaacagcatctgttgcaactcacagtctggggcatcaagcagct 7920 ccaagcaagaatcctagctgtggaaagatacctaaaggatcaacagctcctagggatttg 7980 gggttgctctggaaaactcatttgcaccactgctgtgccttggaatgctagttggagtaa 8040 taaatctctggaacagatctggaatcacacgacctggatggagtgggacagagaaattaa 8100 caattacacaagcttaatacactccttaattgaagaatcgcaaaaccagcaagaaaagaa 8160 tgaacaagaattattggaattagataaatgggcaagtttgtggaattggtttaacataac 8220 aaattggctgtggtatataaaattattcataatgatagtaggaggcttggtaggtttaag 8280 aatagtttttgctgtactttctatagtgaatagagttaggcagggatattcaccattatc 8340 gtttcagacccacctcccaatcccgaggggacccgacaggcccgaaggaatagaagaaga 8400 aggtggagagagagacagagacagatccattcgattagtgaacggatccttggcacttat 8460 ctgggacgatctgcggagcctgtgcctcttcagctaccaccgcttgagagacttactctt 8520 gattgtaacgaggattgtggaacttctgggacgcagggggtgggaagccctcaaatattg 8580 gtggaatctcctacaatattggagtcaggagctaaagaatagtgctgttagcttgctcaa 8640 tgccacagccatagcagtagctgaggggacagatagggttatagaagtagtacaaggagc 8700 ttgtagagctattcgccacatacctagaagaataagacagggcttggaaaggattttgct 8760 ataagctcgaaacaaccggtacctctagaactatagctagcagatctttttccctctgcc 8820 aaaaattatggggacatcatgaagccccttgagcatctgacttctggctaataaaggaaa 8880 tttattttcattgcaatagtgtgttggaattttttgtgtctctcactcggaaggacatat 8940 gggagggcaaatcatttaaaacatcagaatgagtatttggtttagagtttggcaacatat 9000 gccatatgctggctgccatgaacaaaggtggctataaagaggtcatcagtatatgaaaca 9060 gccccctgctgtccattccttattccatagaaaagccttgacttgaggttagattttttt 9120 tatattttgttttgtgttatttttttctttaacatccctaaaattttccttacatgtttt 9180 actagccagatttttcctcctctcctgactactcccagtcatagctgtccctcttctctt 9240 atgaagatccctcgacctgcagcccaagcttggcgtaatcatggtcatagctgtttcctg 9300 tgtgaaattgttatccgctcacaattccacacaacatacgagccggaagcataaagtgta 9360 aagcctggggtgcctaatgagtgagctaactcacattaattgcgttgcgctcactgcccg 9420 ctttccagtcgggaaacctgtcgtgccagcggatccgcatctcaattagtcagcaaccat 9480 agtcccgcccctaactccgcccatcccgcccctaactccgcccagttccgcccattctcc 9540 gccccatggctgactaattttttttatttatgcagaggccgaggccgcctcggcctctga 9600 gctattccagaagtagtgaggaggcttttttggaggcctaggcttttgcaaaaagctaac 9660 ttgtttattgcagcttataatggttacaaataaagcaatagcatcacaaatttcacaaat 9720 aaagcatttttttcactgcattctagttgtggtttgtccaaactcatcaatgtatcttat 9780 catgtctggatccgctgcattaatgaatcggccaacgcgcggggagaggcggtttgcgta 9840 ttgggcgctcttccgcttcctcgctcactgactcgctgcgctcggtcgttcggctgcggc 9900 gagcggtatcagctcactcaaaggcggtaatacggttatccacagaatcaggggataacg 9960 caggaaagaacatgtgagcaaaaggccagcaaaaggccaggaaccgtaaaaaggccgcgt 10020 tgctggcgtttttccataggctccgcccccctgacgagcatcacaaaaatcgacgctcaa 10080 gtcagaggtggcgaaacccgacaggactataaagataccaggcgtttccccctggaagct 10140 ccctcgtgcgctctcctgttccgaccctgccgcttaccggatacctgtccgcctttctcc 10200 cttcgggaagcgtggcgctttctcaatgctcacgctgtaggtatctcagttcggtgtagg 10260 tcgttcgctccaagctgggctgtgtgcacgaaccccccgttcagcccgaccgctgcgcct 10320 tatccggtaactatcgtcttgagtccaacccggtaagacacgacttatcgccactggcag 10380 cagccactggtaacaggattagcagagcgaggtatgtaggcggtgctacagagttcttga 10440 agtggtggcctaactacggctacactagaaggacagtatttggtatctgcgctctgctga 10500 agccagttaccttcggaaaaagagttggtagctcttgatccggcaaacaaaccaccgctg 10560 gtagcggtggtttttttgtttgcaagcagcagattacgcgcagaaaaaaaggatctcaag 10620 aagatcctttgatcttttctacggggtctgacgctcagtggaacgaaaactcacgttaag 10680 ggattttggtcatgagattatca 10703 SEQIDNO:26 gtcgacggatcgggagatcaattccggcacctgtcctacgagttgcatgataaagaagac 60 (pCIGO-VSV.G agtcataagtgcggcgacgatagtcatgccccgcgcccaccggaaggagctgactgggtt 120 plasmid) gaaggctctcaagggcatcggtcgatgcaggaaaaggacaagcagcgaaaattcacgccc 180 ccttgggaggtggcggcatatgcaaaggatagcactcccactctactactgggtatcata 240 tgctgactgtatatgcatgaggatagcatatgctacccggatacagattaggatagcata 300 tactacccagatatagattaggatagcatatgctacccagatatagattaggatagccta 360 tgctacccagatataaattaggatagcatatactacccagatatagattaggatagcata 420 tgctacccagatatagattaggatagcctatgctacccagatatagattaggatagcata 480 tgctacccagatatagattaggatagcatatgctatccagatatttgggtagtatatgct 540 acccagatataaattaggatagcatatactaccctaatctctattaggatagcatatgct 600 acccggatacagattaggatagcatatactacccagatatagattaggatagcatatgct 660 acccagatatagattaggatagcctatgctacccagatataaattaggatagcatatact 720 acccagatatagattaggatagcatatgctacccagatatagattaggatagcctatgct 780 acccagatatagattaggatagcatatgctatccagatatttgggtagtatatgctaccc 840 atggcaacattagcccaccgtgctctcagcgacctcgtgaatatgaggaccaacaaccct 900 gtgcttggcgctcaggcgcaagtgtgtgtaatttgtcctccagatcgcagcaatcgcgcc 960 cctatcttggcccgcccacctacttatgcaggtattccccggggtgccattagtggtttt 1020 gtgggcaagtggtttgaccgcagtggttagcggggttacaatcagccaagttattacacc 1080 cttattttacagtccaaaaccgcagggcggcgtgtgggggctgacgcgtgcccccactcc 1140 acaatttcaaaaaaaagagtggccacttgtctttgtttatgggccccattggcgtggagc 1200 cccgtttaattttcgggggtgttagagacaaccagtggagtccgctgctgtcggcgtcca 1260 ctctctttccccttgttacaaatagagtgtaacaacatggttcacctgtcttggtccctg 1320 cctgggacacatcttaataaccccagtatcatattgcactaggattatgtgttgcccata 1380 gccataaattcgtgtgagatggacatccagtctttacggcttgtccccaccccatggatt 1440 tctattgttaaagatattcagaatgtttcattcctacactagtatttattgcccaagggg 1500 tttgtgagggttatattggtgtcatagcacaatgccaccactgaaccccccgtccaaatt 1560 ttattctgggggcgtcacctgaaaccttgttttcgagcacctcacatacaccttactgtt 1620 cacaactcagcagttattctattagctaaacgaaggagaatgaagaagcaggcgaagatt 1680 caggagagttcactgcccgctccttgatcttcagccactgcccttgtgactaaaatggtt 1740 cactaccctcgtggaatcctgaccccatgtaaataaaaccgtgacagctcatggggtggg 1800 agatatcgctgttccttaggacccttttactaaccctaattcgatagcatatgcttcccg 1860 ttgggtaacatatgctattgaattagggttagtctggatagtatatactactacccggga 1920 agcatatgctacccgtttagggttaacaagggggccttataaacactattgctaatgccc 1980 tcttgagggtccgcttatcggtagctacacaggcccctctgattgacgttggtgtagcct 2040 cccgtagtcttcctgggcccctgggaggtacatgtcccccagcattggtgtaagagcttc 2100 agccaagagttacacataaaggcaatgttgtgttgcagtccacagactgcaaagtctgct 2160 ccaggatgaaagccactcaagggatcttcaatattggccattagccatattattcattgg 2220 ttatatagcataaatcaatattggctattggccattgcatacgttgtatctatatcataa 2280 tatgtacatttatattggctcatgtccaatatgaccgccatgttggcattgattattgac 2340 tagttattaatagtaatcaattacggggtcattagttcatagcccatatatggagttccg 2400 cgttacataacttacggtaaatggcccgcctggctgaccgcccaacgacccccgcccatt 2460 gacgtcaataatgacgtatgttcccatagtaacgccaatagggactttccattgacgtca 2520 atgggtggagtatttacggtaaactgcccacttggcagtacatcaagtgtatcatatgcc 2580 aagtccgccccctattgacgtcaatgacggtaaatggcccgcctggcattatgcccagta 2640 catgaccttacgggactttcctacttggcagtacatctacgtattagtcatcgctattac 2700 catggtgatgcggttttggcagtacaccaatgggcgtggatagcggtttgactcacgggg 2760 atttccaagtctccaccccattgacgtcaatgggagtttgttttggcaccaaaatcaacg 2820 ggactttccaaaatgtcgtaataaccccgccccgttgacgcaaatgggcggtaggcgtgt 2880 acggtgggaggtctatataagcagagctcgtttagtgaaccgtcagatcactagaagctt 2940 tattgcggtagtttatcacagttaaattgctaacgcagtcagtgcttctgacacaacagt 3000 ctcgaacttaagctgcagaagttggtcgtgaggcactgggcaggtaagtatcaaggttac 3060 aagacaggtttaaggagaccaatagaaactgggcttgtcgagacagagaagactcttgcg 3120 tttctgataggcacctattggtcttactgacatccactttgcctttctctccacaggtgt 3180 ccactcccagttcaattacagctcttaaggctagagtacttaatacgactcactataggc 3240 tagcggtaccgagctcggatccactagtaacggccgccagtgtgctggaattcaacagag 3300 atcgatctgtttccttgacactatgaagtgccttttgtacttagcctttttattcattgg 3360 ggtgaattgcaagttcaccatagtttttccacacaaccaaaaaggaaactggaaaaatgt 3420 tccttctaattaccattattgcccgtcaagctcagatttaaattggcataatgacttaat 3480 aggcacagccatacaagtcaaaatgcccaagagtcacaaggctattcaagcagacggttg 3540 gatgtgtcatgcttccaaatgggtcactacttgtgatttccgctggtatggaccgaagta 3600 tataacacagtccatccgatccttcactccatctgtagaacaatgcaaggaaagcattga 3660 acaaacgaaacaaggaacttggctgaatccaggcttccctcctcaaagttgtggatatgc 3720 aactgtgacggatgccgaagcagtgattgtccaggtgactcctcaccatgtgctggttga 3780 tgaatacacaggagaatgggttgattcacagttcatcaacggaaaatgcagcaattacat 3840 atgccccactgtccataactctacaacctggcattctgactataaggtcaaagggctatg 3900 tgattctaacctcatttccatggacatcaccttcttctcagaggacggagagctatcatc 3960 cctgggaaaggagggcacagggttcagaagtaactactttgcttatgaaactggaggcaa 4020 ggcctgcaaaatgcaatactgcaagcattggggagtcagactcccatcaggtgtctggtt 4080 cgagatggctgataaggatctctttgctgcagccagattccctgaatgcccagaagggtc 4140 aagtatctctgctccatctcagacctcagtggatgtaagtctaattcaggacgttgagag 4200 gatcttggattattccctctgccaagaaacctggagcaaaatcagagcgggtcttccaat 4260 ctctccagtggatctcagctatcttgctcctaaaaacccaggaaccggtcctgctttcac 4320 cataatcaatggtaccctaaaatactttgagaccagatacatcagagtcgatattgctgc 4380 tccaatcctctcaagaatggtcggaatgatcagtggaactaccacagaaagggaactgtg 4440 ggatgactgggcaccatatgaagacgtggaaattggacccaatggagttctgaggaccag 4500 ttcaggatataagtttcctttatacatgattggacatggtatgttggactccgatcttca 4560 tcttagctcaaaggctcaggtgttcgaacatcctcacattcaagacgctgcttcgcaact 4620 tcctgatgatgagagtttattttttggtgatactgggctatccaaaaatccaatcgagct 4680 tgtagaaggttggttcagtagttggaaaagctctattgcctcttttttctttatcatagg 4740 gttaatcattggactattcttggttctccgagttggtatccatctttgcattaaattaaa 4800 gcacaccaagaaaagacagatttatacagacatagagatgaaccgacttggaaagtaact 4860 caaatcctgcacaacagattcttcatgtttggaccaaatcaacttgtgataccatgctca 4920 aagaggcctcaattatatttgagtttttaatttttatggaattctgcagatatccatcac 4980 actggcggccgctcgagcatgcatctagagggccctattctatagtgtcacctaaatgct 5040 agagctcgctgatcagcctcgactgtgccttctagttgccagccatctgttgtttgcccc 5100 tcccccgtgccttccttgaccctggaaggtgccactcccactgtcctttcctaataaaat 5160 gaggaaattgcatcgcattgtctgagtaggtgtcattctattctggggggtggggtgggg 5220 caggacagcaagggggaggattgggaagacaatagcaggcatgctggggatgcggtgggc 5280 tctatggcttctgaggcggaaagaaccagctgcattaatgaatcggccaacgcgcgggga 5340 gaggcggtttgcgtattgggcgctcttccgcttcctcgctcactgactcgctgcgctcgg 5400 tcgttcggctgcggcgagcggtatcagctcactcaaaggcggtaatacggttatccacag 5460 aatcaggggataacgcaggaaagaacatgtgagcaaaaggccagcaaaaggccaggaacc 5520 gtaaaaaggccgcgttgctggcgtttttccataggctccgcccccctgacgagcatcaca 5580 aaaatcgacgctcaagtcagaggtggcgaaacccgacaggactataaagataccaggcgt 5640 ttccccctggaagctccctcgtgcgctctcctgttccgaccctgccgcttaccggatacc 5700 tgtccgcctttctcccttcgggaagcgtggcgctttctcaatgctcacgctgtaggtatc 5760 tcagttcggtgtaggtcgttcgctccaagctgggctgtgtgcacgaaccccccgttcagc 5820 ccgaccgctgcgccttatccggtaactatcgtcttgagtccaacccggtaagacacgact 5880 tatcgccactggcagcagccactggtaacaggattagcagagcgaggtatgtaggcggtg 5940 ctacagagttcttgaagtggtggcctaactacggctacactagaaggacagtatttggta 6000 tctgcgctctgctgaagccagttaccttcggaaaaagagttggtagctcttgatccggca 6060 aacaaaccaccgctggtagcggtggtttttttgtttgcaagcagcagattacgcgcagaa 6120 aaaaaggatctcaagaagatcctttgatcttttctacggggtctgacgctcagtggaacg 6180 aaaactcacgttaagggattttggtcatgagattatcaaaaaggatcttcacctagatcc 6240 ttttaaattaaaaatgaagttttaaatcaatctaaagtatatatgagtaaacttggtctg 6300 acagttaccaatgcttaatcagtgaggcacctatctcagcgatctgtctatttcgttcat 6360 ccatagttgcctgactccccgtcgtgtagataactacgatacgggagggcttaccatctg 6420 gccccagtgctgcaatgataccgcgagacccacgctcaccggctccagatttatcagcaa 6480 taaaccagccagccggaagggccgagcgcagaagtggtcctgcaactttatccgcctcca 6540 tccagtctattaattgttgccgggaagctagagtaagtagttcgccagttaatagtttgc 6600 gcaacgttgttgccattgctacaggcatcgtggtgtcacgctcgtcgtttggtatggctt 6660 cattcagctccggttcccaacgatcaaggcgagttacatgatcccccatgttgtgcaaaa 6720 aagcggttagctccttcggtcctccgatcgttgtcagaagtaagttggccgcagtgttat 6780 cactcatggttatggcagcactgcataattctcttactgtcatgccatccgtaagatgct 6840 tttctgtgactggtgagtactcaaccaagtcattctgagaatagtgtatgcggcgaccga 6900 gttgctcttgcccggcgtcaatacgggataataccgcgccacatagcagaactttaaaag 6960 tgctcatcattggaaaacgttcttcggggcgaaaactctcaaggatcttaccgctgttga 7020 gatccagttcgatgtaacccactcgtgcacccaactgatcttcagcatcttttactttca 7080 ccagcgtttctgggtgagcaaaaacaggaaggcaaaatgccgcaaaaaagggaataaggg 7140 cgacacggaaatgttgaatactcatactcttcctttttcaatattattgaagcatttatc 7200 agggttattgtctcatgagcggatacatatttgaatgtatttagaaaaataaacaaatag 7260 gggttccgcgcacatttccccgaaaagtgccacctgac 7298
[0590] Expression of CD86 and 4-1BBL on engineered MOLM-14 aAPCs (also referred to herein as aMOLM14 aAPCs) was confirmed using flow cytometry (Canto II flow cytometer, Becton, Dickinson, and Co., Franklin Lakes, N.J., USA), with results shown in
Example 4
Expansion of Tumor Infiltrating Lymphocytes Using MOLM-14 Artificial Antigen Presenting Cells
[0591] Engineered MOLM-14 cells were gamma-irradiated at 100 Gy before co-culturing with TILs. REPs were initiated by culturing TILs with irradiated, engineered MOLM-14 cells at 1:100 ratios in CM2 media containing OKT-3 (30 ng/mL) and IL-2 (3000 IU/mL) for 14 days. At REP harvest, the TIL expansion rates, phenotype for activation and differentiation stage markers, metabolism rate, cytotoxicity and re-rapid expansion protocol (re-REP) assay were measured.
[0592] The results are shown in
[0593] The results at day 14 are compared in
[0594] In addition, TILs expanded against MOLM-14 maintained a TIL phenotype and showed potency to kill P815 cells as measured using BRLA, which is described in detail in Example 9. Briefly, luciferin-transduced P815 target cells and TILs of interest were co-cultured with and without anti-CD3 to determine whether tumor reactivity of TILs is through TCR activation (specific killing) or non-specific killing. Following 4 hours of incubation, luciferin was added to the wells and incubated for 5 minutes. After the incubation, bioluminescence intensity was read using a luminometer. The percentage cytotoxicity and percentage survival were calculated using the following formula: % Survival=(experimental survival-minimum)/(maximum signal-minimum signal)?100 or % Cytotoxicity=100?(% Survival).
[0595] In
[0596] In
[0597] In
[0598] The CD4 and CD8 SPADE tree of TILs expanded with aMOLM14 aAPCs or PBMC feeders using CD3+ cells is shown in
[0599] TILs expanded against aMOLM14 or PBMC were also analyzed for metabolic profiles. Oxygen consumption rate (OCR) and extracellular acidification rate (ECAR) of TILs after expansion with irradiated PBMC feeders or aMOLM14 aAPCs were measured using a dual mitochondrial-glycolytic stress test. Briefly, cells were washed in assay medium (XF Assay Medium, Agilent Technologies, Santa Clara, Calif., USA), supplemented with 10 mM glucose, 1 mM sodium pyruvate, and 2 mM L-glutamine, at pH 7.4, and then 1?10.sup.5 viable cells were plated onto an adhesive-coated (Cell-Tak?, Corning) XFp cell culture microplate. Plates were spun to adhere the cells to the plate, then equilibrated at 37? C. in a humidified, non-CO.sub.2 incubator prior to analysis of cellular metabolism. Mitochondrial and glycolytic stress test experiments were performed using a Seahorse XFp Analyzer (Agilent Technologies, Santa Clara, Calif., USA), sequentially injecting the following compounds at specified intervals for simultaneous analysis of mitochondrial and glycolytic respiration of the cells: 1 ?M oligomycin; 0.5 ?M FCCP; 50 mM 2-deoxyglucose; and 0.5 ?M each of rotenone and antimycin A. Results were analyzed using WAVE v2.3.0 software (Agilent Technologies, Santa Clara, Calif., USA) and GraphPad Prism v6.07 graphing software and are shown in
Example 5
Preparation of EM-3 Artificial Antigen Presenting Cells (aEM3 aAPCs)
[0600] EM-3 cells were obtained from Creative Bioarray, Inc. (Shirley, N.Y., USA). To develop an EM-3 based artificial APC, EM-3 cell lines were engineered with CD86, 4-1BBL, and antibody against IgG Fc region (Clone 7C12 or Clone 8B3). Human CD86 and human 4-1BBL/CD137 genes were cloned into commercially-available PLV430G and co-transfected with PDONR221 vectors (Invitrogen) using a lentiviral transduction method. The gateway cloning method was used as described in Katzen, Expert Opin. Drug Disc. 2007, 4, 571-589, to clone hCD86 and hCD137L genes onto the PLV430G and PDONR221 vectors. The 293T cell line was used for lentiviral production, and transduced to EM-3 cell lines. The transfected cells were sorted (S3e Cell Sorter, BioRad, Hercules, Calif., USA) using APC-conjugated CD86 and PE-conjugated CD137L to isolate and enrich the cells. The enriched cells were checked for purity by flow cytometry. Single-chain Fv (scFv) antibody clones designated 7C12 and 8B3 were generated against Fc of mouse IgG1, IgG2a and IgG2b (Viva Biotech Ltd., Chicago, IL, USA). The amino acid sequences of these scFv clones are given in Table 7 (SEQ ID NO:27 and SEQ ID NO:28). The generated scFv clones were screened for Fc binding efficiency against OKT-3, engineered towards pLV4301G containing eGFP as co-reporter to produce lentivirus. The 293T cell line was used for packaging and lentiviral production. Engineered EM-3 (CD86/CD137L) cells were transduced using the lentiviral system and sorted using eGFP. EM37C12CD86CD137L and EM38B3CD86CD137L were regularly assessed for the consistent expression of each transduced molecule by flow cytometry.
TABLE-US-00007 TABLE7 AminoacidsequencesofscFv clones7C12and8B3. Identifier (Description) Sequence(One-LetterAminoAcidSymbols) SEQIDNO:27 QVQLVQSGGGLVKPGGSLRLSCAASGFNFNDQYMSWIRQAPGKGLEWVSFISGSGGTTYY 60 (mFC-7C12 TDSVKGRFTISRDNTKDSLYLQMNSLTVEDTAVYYCARGGNYYTSVGRGTLVTVSAGGGG 120 scFv) SGAPDIQMTQSPGTLSLSPGERAILSCRASQSVSGYLAWYQQKPGQAPRLLIYGASSRAT 180 GIPDRFSGSGSGTDFTLTISSLRPEDIGTYYCKQYINAPFTFGGGTKVEIK 231 SEQIDNO:28 QVQLQQSGAEVKKPGSSVKVSCHASGGTFSSYAISWVRQAPGQGLEWMGWISPYNGNTDY 60 (mFC-8B3scFv) AQKVQGRVTLTTDTSTSTAYMELRSLRSDDTAVYYCATGGGTWYSDLWGRGTLVTVSAGG 120 GGSGGGGSGGGGSGAPEIVLTQSPSTLSASVGDRVSITCRASQSIGGSLAWYQQKPGKAP 180 KLLISEASTLERGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQKYNSVPLTFGPGTKV 240 EIK 243
[0601] A non-limiting protocol for preparation of aEM3 aAPCs, which may also be adapted for use with aMOLM14 aAPCs, is described in the following paragraphs.
[0602] Molecular cloning of plasmids of interest may be performed as follows. To generate DONR vector the following cocktail may be used: B site flanked PCR product or destination vector (e.g., Gateway-adapted lentivector) 50-100 ?g; DONR vector (e.g., pDONR222) 50-100 ?g; BR Clonase II (Life Technologies) 1 ?L; and TE buffer ((1 mM Tris, 0.1 mM EDTA, pH 8.0, q.s. to bring volume to 5 ?L). Incubate at room temperature for at least 1 hour. After incubation perform bacterial transformation either by heat shock method or electroporation. To generate destination vector, the following cocktail may be used: recombined pDONR vector (e.g., pDON222-geneX) 50-100 ?g, destination vector (e.g., Gateway adapted lentivector) 50-100 ?g, LR Clonase II (Life Technologies) 1 ?L, and TE buffer ((1 mM Tris, 0.1 mM EDTA, pH 8.0, q.s. to bring volume to 5 ?L). Incubate at room temperature for at least 1 hour. After incubation, perform bacterial transformation either by chemical competent transformation/heat shock method.
[0603] Transformation and selection of the cloned plasmid may be performed as follows. The chemical competent transformation method may be performed as follows. Prepare nutrient agar plates (LB-Lennox or YT) with antibiotic for selection. Ensure that Recovery Medium (supplied by Lucigen, Middleton, Wis., USA) is readily available at room temperature. Optionally, sterile culture tubes may be chilled on ice (e.g., 17 mm?100 mm tubes (14 mL tube)), one tube for each transformation reaction). Remove E. cloni cells (Lucigen) from an ?80? C. freezer and thaw completely on wet ice (5-15 minutes). Optionally add 40 ?L of E. cloni cells to the chilled culture tube. Add 1-4 ?L of DNA sample to the 40 ?L of cells. Flick with finger (do not pipet up and down to mix, which can introduce air bubbles and warm the cells). Incubate the cell/DNA mixture on ice for 30 minutes. Heat shock cells by placing the culture tubes in a 42? C. water bath for 45 seconds. Return the 1.7 mL tube or culture tubes to ice for 2 minutes. Add 350 ?L room temperature Recovery Medium to the cells or 960 ?L of room temperature Recovery Medium to the cells in the culture tube. Place the tubes in a shaking incubator at 250 rpm for 1 hour at 37? C. Plate up to 100% of the transformation mixture on LB-Lennox or YT agar plates containing the appropriate antibiotic. The plating volume may need to be optimized depending on DNA. Incubate the plates overnight at 37? C. Transformed clones can be further grown in any rich culture medium (e.g., LB or TB).
[0604] Colonies for Miniprep (Qiagen, Inc., Valencia, Calif., USA) may be grown as follows. After colonies have formed from plating recovered transformation reaction of DNA manipulation (e.g. LR reaction), add 1 mL desired TB/antibiotics into desired number of 2 mL Eppendorf microtubes with punctured caps. Pick desired number of colonies using ART LTS 20 ?L soft pipette tip (VWR 89031-352) or 10 ?L Denville tip. Place tip in 2 mL Eppendorf microtube with punctured cap. Cut the tip so that it fits in tube, close cap, and place tubes on shaker (purple 15 mL tube holder with VWR brand 15 mL tubes). Shake overnight (for no more than 16 hours) at 225 rpm/37? C. After overnight incubation, place each tip in a 1 mL tube in a ClavePak 96 plate from Denville with sterile water in it (to save the tip for making bacterial stock production after the plasmids are screened and selected). Perform Miniprep according to the Qiagen Mini prep kit protocol (Qiagen, Inc., Valencia, Calif., USA). Once the plasmids are eluted, restriction digestion is performed to select the right clones. After selecting the plasmids, use the tips saved from the same plasmids clone to grow the E. coli with the plasmid to make bacterial stock.
[0605] Lentiviral production may be performed as follows. The following media composition is prepared: 500 mL DMEM/F12 (Sigma); 25 mL FBS Heat Inactivated (HI) (Hyclone); 10 mM HEPES (Life Technologies); 1X Primocin (Invivogen); 1X Plasmocin (Invivogen); and 1X 2-mermactoethanol (Life Technologies). Harvest T75 flasks (Thermo Fisher Scientific) containing 90% confluent 293T cells. Aspirate media. Add 10 ml PBS, rinse gently and aspirate off. Add 2 mL TrypLE Express (Life Technologies) and evenly distribute it over the cell layer, let sit for 3-5 minutes at 37? C. (cell culture incubator). Add 10 mL media and disperse cells by pipetting up and down. Combine if there are multiple flasks. Count cells. If using a hemacytometer to determine concentration, cells/mL=(# counted cells?dilution factor?10.sup.4). To split back into T75 flasks, determine the time at which the cells will need to be fully confluent and dilute accordingly. (Cells double every 16-18 hours, so 3 days=1/27 dilution). Generally, a multiplication factor of 2.5 per day may be used where confluence is 2?10.sup.5 cells/cm.sup.2. Bring volume up to 25 mL of media. To plate for titration of stocks, each well of the assay requires 5?10.sup.4 cells in 0.4 mL of media. Adjust 293T cells to 2?10.sup.4/mL in media. Plate 1 mL per well in a 24 well plate. For example, cells plated Monday may be infected on Tuesday and run on the flow cytometer on Friday, and cells plated Thursday are infected Friday and run on the flow cytometer on Monday. To plate for packaging transfections, seed T75 flasks with 6.8?10.sup.6 cells one day before transfection or 1.7?10.sup.6 cells on the morning of transfection. (Seeding on the day of transfection may reduce the variation in transfection efficiency). Bring volume in flask up to 25 mL with media. For example, flasks set up Monday are transfected Tuesday, and virus is collected on Thursday and Friday. In some cases (e.g., high titering constructs), the second collection can be omitted. To package lentiviral vectors, each T75 flask transfection requires 2 ?g Baculo p35 plasmid (optional; only necessary if packaging a death gene), 2 ?g VSV.G env plasmid (e.g., pMD2.G or PCIGO VSV-G); 4.7 ?g Gag/polymerase plasmid (e.g., psPAX2 or pCMV-deltaR8.91), and 2.3 ?g of the lentiviral vector described above. Determine the amount of VSV and R8.2/9.1 (+/?Baculo) plasmids needed for all samples (make a mixture of these DNAs if preparing many samples). Each T75 transfection requires 90 ?L LipofectAmine 2000 (Thermo Fisher Scientific) in 2 mL Opti-MEM medium (Thermo Fisher Scientific). Make a mix containing enough Opti-Mem and LipofectAmine 2000 for all samples. Mix gently and let sit for 5 minutes at room temp, and label as tube A. For each transfection, add packaging DNA and specific lentiviral vector DNA to 500 ?L room temperature Opti-MEM medium to a microtube and mix, and label as tube B. Add the 500 ?L of DNA from tube B to the 2 mL of the LipofectAmine 2000 mix in tube A and mix gently, and incubate for 20-30 minutes at room temperature. Aspirate media from packaging flasks. Add the 2.5 mL of DNA/Lipofectamine complexes to 5 mL Opti-MEM medium and add to cells (do not pipet directly on cells since 293T cells are only semi adherent). Process plates in small groups to avoid drying. Incubate overnight and change media the next day in the morning. Collect the supernatant after 24 hours of media change. Supernatants can be harvested in a single collection, 48 hours after transfection or as 2 collections, 48 and 72 hours after transfection (in which case, harvests are pooled). If double collection is desired, collect supernatants by pipet on the first day, and replace with 20 mL of fresh media. To avoid flasks drying, work with only 5 flasks at a time. Keep collected supernatants at 4? C. until pooling the next day. Cool supernatants again on the following day and pool as appropriate. Spin the supernatants at 2000 rpm for 5 minutes to sediment any contaminating 293T cells. Filter harvested supernatants through a 0.45 ?m or 0.8 ?m filter unit containing a pre-filter disc. Use a large enough filtration unit so that the filtration speed is relatively fast. Store at 4? C. until ready to concentrate.
[0606] Virus may be concentrated using the PEG-it method (System Biosciences, Inc., Palo Alto, Calif. 94303) for longer-term storage at ?80? C. Collect the supernatant from the transfection plates. Spin down the cell debris in the supernatant. The supernatant may also be filtered to completely remove any packaging cells. Add an amount of PEG-it solution equal to a quarter of the volume of supernatant to the supernatant. Incubate the suspension at 4? C. for overnight. Centrifuge at 3500 rpm (1500 g) at 4? C. for 30 minutes. Remove supernatant and centrifuge at 3500 rpm at 4? C. for 5 minutes. Remove remaining supernatant. Resuspend virus in desired amount of phosphate-buffered saline (PBS) and freeze aliquots at ?80? C.
[0607] Transduction of cell line using lentivirus may be performed as follows. Adjust cells to be transduced to either: 1?10.sup.6 suspension cells per well in 24 well plate (1 well per transduction) or 50% confluence for adherent cells (1 well per transduction) in 24 well plate. For suspended cells, adjust concentration of cells to 1?10.sup.7/mL and plate 100 ?L per well in 24 well plate (1 well per transduction). For adherent cells, plate to achieve 50% confluence on day of transduction based on cells/cm.sup.2 (e.g., for 293T cells, confluence=2?10.sup.5/cm.sup.2). Total volume of transduction per well should be approximately 500 ?L with 3-10 ?g/mL Polybrene (Hexadimethrine bromide, Sigma-Aldrich Co., St. Louis, Miss., USA). The amount of concentrated virus added will depend on the MOI (multiplicity of infection) desired. A typical MOI is 10:1 but this may vary depending on cell type. The transfection well should contain 100 ?L of standard media containing either 1?10.sup.6 suspension cells or 50% confluent cells. For a MOI of 10:1 (e.g., virus activity is 1?10.sup.8 IU/mL and the target is to infect 1?10.sup.6 cells, then 1?10.sup.7 virions or 100 ?L of virus is needed). Add standard media to 500 ?L. Add Polybrene to 3 ?g/mL (primary cells) to 10 ?g/mL (tumor cell lines). Spin plate(s) at 1800 rpm for 1.5 to 2 hours at 30? C. Incubate plate(s) at 37? C./5% CO.sub.2 using a Tissue Culture incubator for 5 hours to overnight. Change media. After 72 hours of transduction, if enough cells are available, perform flow cytometric analysis to test the transduction efficiency.
[0608] Sorting of aAPCs may be performed as follows. Culture the cells in the media described above until the cell count reaches a minimum of 10-20 million. Take 1?10.sup.6 cells for each condition and stain with the antibodies for the proteins transduced. Wash the cells and analyze by flow cytometry to test the stability of transduction. Once the expression of protein of interest has been analyzed and confirmed, prepare the rest of the cells for sorting. Sort the cells in an S3 sorter by gating on markers of interest. Culture the sorted cells using the media mentioned above. Before freezing the vial, test the stability of the protein expression of interest. Use Recovery cell culture Freezing media (Invitrogen), to make the cell bank of the same cells. Cells may be banked after each transduction and sorting procedure.
[0609] Nucleotide sequence information for the 7C12 and 8B3 scFv clones (SEQ ID NO:29 and SEQ ID NO:30) and their lentiviral vectors are given in Table 8. Sequences used for generation of the pLV4301G 7C12 scFv mIgG hCD8 flag vector are provided as SED IQ NO:31 to SEQ ID NO:34 and are depicted in
TABLE-US-00008 TABLE8 Nucleotidesequencesforpreparationof lentivirusfortransductionofaAPCs. Identifier (Description) Sequence SEQIDNO:29 caggtgcagctggtgcagtctgggggaggcttggtcaagcctggagggtccctgagactc 60 (mFC-7C12 tcctgtgcagcctctggattcaatttcaatgaccagtacatgagttggatccgccaggct 120 scFv) ccagggaaggggctggagtgggtttcattcattagtggtagtggtggtaccacatactac 180 acagactctgtgaagggccggttcaccatctccagggacaacaccaaggactcattgtat 240 ttgcaaatgaacagcctgacagtcgaggacacggccgtgtactactgtgcgagaggaggg 300 aattattatacttcggtgggccggggcaccctggtcaccgtctcggccggtggcggcgga 360 tctggcgcgccagacatccagatgacccagtctccaggcaccctgtctttgtctccaggg 420 gaaagagccatcctctcctgcagggccagtcagagtgttagcggctacctagcctggtat 480 caacagaaacctggccaggctcccaggctcctcatctatggtgcatccagcagggccact 540 ggcatcccagacaggttcagtggcagtgggtctgggacagacttcactctcaccatcagc 600 agcctgcggcctgaagatattggaacatattactgtaaacagtacattaatgccccattc 660 actttcggcggcgggaccaaggtggagatcaaa 693 SEQIDNO:30 caggtacagctgcagcagtcaggggctgaggtgaagaagcctgggtcctcggtgaaggtc 60 (mFC-8B3scFv) tcctgcaaggcttctggaggcaccttcagcagctatgctatcagctgggtgcgacaggcc 120 cctggacaagggcttgagtggatgggatggatcagcccttacaatggtaacacagattat 180 gcacagaaggtccagggcagagtcaccttgaccacagacacatccacgagcacagcctac 240 atggagctgaggagcctgagatccgacgacacggccgtgtattactgtgcgacaggtggc 300 gggacctggtactccgatctctggggccgtggcaccctggtcaccgtctcggccggtggc 360 ggtggcagcggcggtggtgggtccggtggcggcggatctggcgcgccagaaattgtgctg 420 actcagtctccctccaccctgtctgcatctgtaggagacagagtcagcatcacttgccgg 480 gccagtcagagtattggtgggtcgttggcctggtatcaacaaaagccagggaaagcccct 540 aagctcctgatctctgaggcgtctactttagagaggggcgtcccatcaagattcagcggc 600 agtggatctgggacagatttcactctcaccatcaggagcctgcagcctgaagatgttgca 660 acttattactgtcaaaaatataacagtgtcccgctcactttcggccctgggaccaaggtg 720 gagatcaaa 729 SEQIDNO:31 cgataaccctaattcgatagcatatgcttcccgttgggtaacatatgctattgaattagg 60 (destination gttagtctggatagtatatactactacccgggaagcatatgctacccgtttagggttcac 120 vector cggtgatgccggccacgatgcgtccggcgtagaggatctaatgtgagttagctcactcat 180 pLV4301G) taggcaccccaggctttacactttatgcttccggctcgtatgttgtgtggaattgtgagc 240 ggataacaatttcacacaggaaacagctatgaccatgattacgccaagcgcgcaattaac 300 cctcactaaagggaacaaaagctggagctgcaagcttaatgtagtcttatgcaatactct 360 tgtagtcttgcaacatggtaacgatgagttagcaacatgccttacaaggagagaaaaagc 420 accgtgcatgccgattggtggaagtaaggtggtacgatcgtgccttattaggaaggcaac 480 agacgggtctgacatggattggacgaaccactgaattgccgcattgcagagatattgtat 540 ttaagtgcctagctcgatacataaacgggtctctctggttagaccagatctgagcctggg 600 agctctctggctaactagggaacccactgcttaagcctcaataaagcttgccttgagtgc 660 ttcaagtagtgtgtgcccgtctgttgtgtgactctggtaactagagatccctcagaccct 720 tttagtcagtgtggaaaatctctagcagtggcgcccgaacagggacttgaaagcgaaagg 780 gaaaccagaggagctctctcgacgcaggactcggcttgctgaagcgcgcacggcaagagg 840 cgaggggcggcgactggtgagtacgccaaaaattttgactagcggaggctagaaggagag 900 agatgggtgcgagagcgtcagtattaagcgggggagaattagatcgcgatgggaaaaaat 960 tcggttaaggccagggggaaagaaaaaatataaattaaaacatatagtatgggcaagcag 1020 ggagctagaacgattcgcagttaatcctggcctgttagaaacatcagaaggctgtagaca 1080 aatactgggacagctacaaccatcccttcagacaggatcagaagaacttagatcattata 1140 taatacagtagcaaccctctattgtgtgcatcaaaggatagagataaaagacaccaagga 1200 agctttagacaagatagaggaagagcaaaacaaaagtaagaccaccgcacagcaagcggc 1260 cgctgatcttcagacctggaggaggagatatgagggacaattggagaagtgaattatata 1320 aatataaagtagtaaaaattgaaccattaggagtagcacccaccaaggcaaagagaagag 1380 tggtgcagagagaaaaaagagcagtgggaataggagctttgttccttgggttcttgggag 1440 cagcaggaagcactatgggcgcagcgtcaatgacgctgacggtacaggccagacaattat 1500 tgtctggtatagtgcagcagcagaacaatttgctgagggctattgaggcgcaacagcatc 1560 tgttgcaactcacagtctggggcatcaagcagctccaggcaagaatcctggctgtggaaa 1620 gatacctaaaggatcaacagctcctggggatttggggttgctctggaaaactcatttgca 1680 ccactgctgtgccttggaatgctagttggagtaataaatctctggaacagatttggaatc 1740 acacgacctggatggagtgggacagagaaattaacaattacacaagcttaatacactcct 1800 taattgaagaatcgcaaaaccagcaagaaaagaatgaacaagaattattggaattagata 1860 aatgggcaagtttgtggaattggtttaacataacaaattggctgtggtatataaaattat 1920 tcataatgatagtaggaggcttggtaggtttaagaatagtttttgctgtactttctatag 1980 tgaatagagttaggcagggatattcaccattatcgtttcagacccacctcccaaccccga 2040 ggggacccgacaggcccgaaggaatagaagaagaaggtggagagagagacagagacagat 2100 ccattcgattagtgaacggatctcgacggtatcggttttaaaagaaaaggggggattggg 2160 gggtacagtgcaggggaaagaatagtagacataatagcaacagacatacaaactaaagaa 2220 ttacaaaaacaaattacaaaaattcaaaattttatcgattttatttagtctccagaaaaa 2280 ggggggaatgaaagaccccacctgtaggtttggcaagctagcttaagtaacgccattttg 2340 caaggcatggaaaatacataactgagaatagagaagttcagatcaaggttaggaacagag 2400 agacaggagaatatgggccaaacaggatatctgtggtaagcagttcctgccccggctcag 2460 ggccaagaacagatggtccccagatgcggtcccgccctcagcagtttctagagaaccatc 2520 agatgtttccagggtgccccaaggacctgaaatgaccctgtgccttatttgaactaacca 2580 atcagttcgcttctcgcttctgttcgcgcgcttctgctccccgagctcaataaaagagcc 2640 cacaacccctcactcggcgcgccagtcctccgatagactgcgtcgcccgggtaccgatat 2700 cacaagtttgtacaaaaaagctgaacgagaaacgtaaaatgatataaatatcaatatatt 2760 aaattagattttgcataaaaaacagactacataatactgtaaaacacaacatatccagtc 2820 actatggcggccgcattaggcaccccaggctttacactttatgcttccggctcgtataat 2880 gtgtggattttgagttaggatccgtcgagattttcaggagctaaggaagctaaaatggag 2940 aaaaaaatcactggatataccaccgttgatatatcccaatggcatcgtaaagaacatttt 3000 gaggcatttcagtcagttgctcaatgtacctataaccagaccgttcagctggatattacg 3060 gcctttttaaagaccgtaaagaaaaataagcacaagttttatccggcctttattcacatt 3120 cttgcccgcctgatgaatgctcatccggaattccgtatggcaatgaaagacggtgagctg 3180 gtgatatgggatagtgttcacccttgttacaccgttttccatgagcaaactgaaacgttt 3240 tcatcgctctggagtgaataccacgacgatttccggcagtttctacacatatattcgcaa 3300 gatgtggcgtgttacggtgaaaacctggcctatttccctaaagggtttattgagaatatg 3360 tttttcgtctcagccaatccctgggtgagtttcaccagttttgatttaaacgtggccaat 3420 atggacaacttcttcgcccccgttttcaccatgggcaaatattatacgcaaggcgacaag 3480 gtgctgatgccgctggcgattcaggttcatcatgccgtttgtgatggcttccatgtcggc 3540 agaatgcttaatgaattacaacagtactgcgatgagtggcagggcggggcgtaaatggat 3600 ccggcttactaaaagccagataacagtatgcgtatttgcgcgctgatttttgcggtataa 3660 gaatatatactgatatgtatacccgaagtatgtcaaaaagaggtatgctatgaagcagcg 3720 tattacagtgacagttgacagcgacagctatcagttgctcaaggcatatatgatgtcaat 3780 atctccggtctggtaagcacaaccatgcagaatgaagcccgtcgtctgcgtgccgaacgc 3840 tggaaagcggaaaatcaggaagggatggctgaggtcgcccggtttattgaaatgaacggc 3900 tcttttgctgacgagaacaggggctggtgaaatgcagtttaaggtttacacctataaaag 3960 agagagccgttatcgtctgtttgtggatgtacagagtgatattattgacacgcccgggcg 4020 acggatggtgatccccctggccagtgcacgtctgctgtcagataaagtctcccgtgaact 4080 ttacccggtggtgcatatcggggatgaaagctggcgcatgatgaccaccgatatggccag 4140 tgtgccggtctccgttatcggggaagaagtggctgatctcagccaccgcgaaaatgacat 4200 caaaaacgccattaacctgatgttctggggaatataaatgtcaggctcccttatacacag 4260 ccagtctgcaggtcgaccatagtgactggatatgttgtgttttacagtattatgtagtct 4320 gttttttatgcaaaatctaatttaatatattgatatttatatcattttacgtttctcgtt 4380 cagctttcttgtacaaagtggtgattcgagttaattaagttaacgaattccccccctctc 4440 cctcccccccccctaacgttactggccgaagccgcttggaataaggccggtgtgcgtttg 4500 tctatatgttattttccaccatattgccgtcttttggcaatgtgagggcccggaaacctg 4560 gccctgtcttcttgacgagcattcctaggggtctttcccctctcgccaaaggaatgcaag 4620 gtctgttgaatgtcgtgaaggaagcagttcctctggaagcttcttgaagacaaacaacgt 4680 ctgtagcgaccctttgcaggcagcggaaccccccacctggcgacaggtgcctctgcggcc 4740 aaaagccacgtgtataagatacacctgcaaaggcggcacaaccccagtgccacgttgtga 4800 gttggatagttgtggaaagagtcaaatggctctcctcaagcgtattcaacaaggggctga 4860 aggatgcccagaaggtaccccattgtatgggatctgatctggggcctcggtgcacatgct 4920 ttacatgtgtttagtcgaggttaaaaaacgtctaggccccccgaaccacggggacgtggt 4980 tttcctttgaaaaacacgatgataatatggccacaaccatgggaggcggaagcggcggag 5040 gctcccctcgaggcaccatggtgagcaagggcgaggagctgttcaccggggtggtgccca 5100 tcctggtcgagctggacggcgacgtaaacggccacaagttcagcgtgtccggcgagggcg 5160 agggcgatgccacctacggcaagctgaccctgaagttcatctgcaccaccggcaagctgc 5220 ccgtgccctggcccaccctcgtgaccaccctgacctacggcgtgcagtgcttcagccgct 5280 accccgaccacatgaagcagcacgacttcttcaagtccgccatgcccgaaggctacgtcc 5340 aggagcgcaccatcttcttcaaggacgacggcaactacaagacccgcgccgaggtgaagt 5400 tcgagggcgacaccctggtgaaccgcatcgagctgaagggcatcgacttcaaggaggacg 5460 gcaacatcctggggcacaagctggagtacaactacaacagccacaacgtctatatcatgg 5520 ccgacaagcagaagaacggcatcaaggtgaacttcaagatccgccacaacatcgaggacg 5580 gcagcgtgcagctcgccgaccactaccagcagaacacccccatcggcgacggccccgtgc 5640 tgctgcccgacaaccactacctgagcacccagtccgccctgagcaaagaccccaacgaga 5700 agcgcgatcacatggtcctgctggagttcgtgaccgccgccgggatcactctcggcatgg 5760 acgagctgtacaagtaacgcgtcccgggtctagagctagcggtaccatgcattacgtagt 5820 cgacgacttaattaagctagcctagtgccatttgttcagtggttcgtagggctttccccc 5880 actgtttggctttcagttatatggatgatgtggtattgggggccaagtctgtacagcatc 5940 ttgagtccctttttaccgctgttaccaattttcttttgtctttgggtatacatttaaacc 6000 ctaacaaaacaaagagatggggttactctctaaattttatgggttatgtcattggatgtt 6060 atgggtccttgccacaagaacacatcatacaaaaaatcaaagaatgttttagaaaacttc 6120 ctattaacaggcctattgattggaaagtatgtcaacgaattgtgggtcttttgggttttg 6180 ctgccccttttacacaatgtggttatcctgcgttgatgcctttgtatgcatgtattcaat 6240 ctaagcaggctttcactttctcgccaacttacaaggcctttctgtgtaaacaatacctga 6300 acctttaccccgttgcccggcaacggccaggtctgtgccaagtgtttgctgacgcaaccc 6360 ccactggctggggcttggtcatgggccatcagcgcatgcgtggaaccttttcggctcctc 6420 tgccgatccatactgcggaactcctagccgcttgttttgctcgcagcaggtctggagcaa 6480 acattatcgggactgataactctgttgtcctatcccgcaaatatacatcgtttccatggc 6540 tgctaggctgtgctgccaactggatcctgcgcgggacgtcctttgtttacgtcccgtcgg 6600 cgctgaatcctgcggacgacccttctcggggtcgcttgggactctctcgtccccttctcc 6660 gtctgccgttccgaccgaccacggggcgcacctctctttacgcggactccccgtctgtgc 6720 cttctcatctgccggaccgtgtgcacttcgcttcacctctgcacgtcgcatggagaccac 6780 cgtgaacgcccaccaaatattgcccaaggtcttacataagaggactcttggactctcagc 6840 aatgtcaacgaccgaccttgaggcatacttcaaagactgtttgtttaaagactgggagga 6900 gttgggggaggagattaggttaaaggtctttgtactaggaggctgtaggcataaattggt 6960 ctgcgcaccagcaccatggcgcaatcactagagcggggtacctttaagaccaatgactta 7020 caaggcagctgtagatcttagccactttttaaaagaaaaggggggactggaagggctaat 7080 tcactcccaacgaagacaagatctgctttttgcttgtactgggtctctctggttagacca 7140 gatctgagcctgggagctctctggctaactagggaacccactgcttaagcctcaataaag 7200 cttgccttgagtgcttcaagtagtgtgtgcccgtctgttgtgtgactctggtaactagag 7260 atccctcagacccttttagtcagtgtggaaaatctctagcagtagtagttcatgtcatct 7320 tattattcagtatttataacttgcaaagaaatgaatatcagagagtgagaggaacttgtt 7380 tattgcagcttataatggttacaaataaagcaatagcatcacaaatttcacaaataaagc 7440 atttttttcactgcattctagttgtggtttgtccaaactcatcaatgtatcttatcatgt 7500 ctggctctagctatcccgcccctaactccgcccatcccgcccctaactccgcccagttcc 7560 gcccattctccgccccatggctgactaattttttttatttatgcagaggccgaggccgga 7620 tcccttgagtggctttcatcctggagcagactttgcagtctgtggactgcaacacaacat 7680 tgcctttatgtgtaactcttggctgaagctcttacaccaatgctgggggacatgtacctc 7740 ccaggggcccaggaagactacgggaggctacaccaacgtcaatcagaggggcctgtgtag 7800 ctaccgataagcggaccctcaagagggcattagcaatagtgtttataaggcccccttgtt 7860 aattcttgaagacgaaagggcctcgtgatacgcctatttttataggttaatgtcatgata 7920 ataatggtttcttagacgtcaggtggcacttttcggggaaatgtgcgcggaacccctatt 7980 tgtttatttttctaaatacattcaaatatgtatccgctcatgagacaataaccctgataa 8040 atgcttcaataatattgaaaaaggaagagtatgagtattcaacatttccgtgtcgccctt 8100 attcccttttttgcggcattttgccttcctgtttttgctcacccagaaacgctggtgaaa 8160 gtaaaagatgctgaagatcagttgggtgcacgagtgggttacatcgaactggatctcaac 8220 agcggtaagatccttgagagttttcgccccgaagaacgttttccaatgatgagcactttt 8280 aaagttctgctatgtggcgcggtattatcccgtgttgacgccgggcaagagcaactcggt 8340 cgccgcatacactattctcagaatgacttggttgagtactcaccagtcacagaaaagcat 8400 cttacggatggcatgacagtaagagaattatgcagtgctgccataaccatgagtgataac 8460 actgcggccaacttacttctgacaacgatcggaggaccgaaggagctaaccgcttttttg 8520 cacaacatgggggatcatgtaactcgccttgatcgttgggaaccggagctgaatgaagcc 8580 ataccaaacgacgagcgtgacaccacgatgcctgcagcaatggcaacaacgttgcgcaaa 8640 ctattaactggcgaactacttactctagcttcccggcaacaattaatagactggatggag 8700 gcggataaagttgcaggaccacttctgcgctcggcccttccggctggctggtttattgct 8760 gataaatctggagccggtgagcgtgggtctcgcggtatcattgcagcactggggccagat 8820 ggtaagccctcccgtatcgtagttatctacacgacggggagtcaggcaactatggatgaa 8880 cgaaatagacagatcgctgagataggtgcctcactgattaagcattggtaactgtcagac 8940 caagtttactcatatatactttagattgatttaaaacttcatttttaatttaaaaggatc 9000 taggtgaagatcctttttgataatctcatgaccaaaatcccttaacgtgagttttcgttc 9060 cactgagcgtcagaccccgtagaaaagatcaaaggatcttcttgagatcctttttttctg 9120 cgcgtaatctgctgcttgcaaacaaaaaaaccaccgctaccagcggtggtttgtttgccg 9180 gatcaagagctaccaactctttttccgaaggtaactggcttcagcagagcgcagatacca 9240 aatactgtccttctagtgtagccgtagttaggccaccacttcaagaactctgtagcaccg 9300 cctacatacctcgctctgctaatcctgttaccagtggctgctgccagtggcgataagtcg 9360 tgtcttaccgggttggactcaagacgatagttaccggataaggcgcagcggtcgggctga 9420 acggggggttcgtgcacacagcccagcttggagcgaacgacctacaccgaactgagatac 9480 ctacagcgtgagcattgagaaagcgccacgcttcccgaagggagaaaggcggacaggtat 9540 ccggtaagcggcagggtcggaacaggagagcgcacgagggagcttccagggggaaacgcc 9600 tggtatctttatagtcctgtcgggtttcgccacctctgacttgagcgtcgatttttgtga 9660 tgctcgtcaggggggcggagcctatggaaaaacgccagcaacgcggcctttttacggttc 9720 ctggccttttgctggcctttttgaagctgtccctgatggtcgtcatctacctgcctggac 9780 agcatggcctgcaacgcgggcatcccgatgccgccggaagcgagaagaatcataatgggg 9840 aaggccatccagcctcgcgtcg 9862 SEQIDNO:32 ctaaattgtaagcgttaatattttgttaaaattcgcgttaaatttttgttaaatcagctc 60 (donorvector attttttaaccaataggccgaaatcggcaaaatcccttataaatcaaaagaatagaccga 120 1,pMK7c12 gatagggttgagtggccgctacagggcgctcccattcgccattcaggctgcgcaactgtt 180 antimFCscFV gggaagggcgtttcggtgcgggcctcttcgctattacgccagctggcgaaagggggatgt 240 CoOpECORV gctgcaaggcgattaagttgggtaacgccagggttttcccagtcacgacgttgtaaaacg 300 SacIIL1R5) acggccagtgagcgcgacgtaatacgactcactatagggcgaattgaaggaaggccgtca 360 aggccgcataaataatgattttattttgactgatagtgacctgttcgttgcaacaaattg 420 atgagcaatgcttttttataatgccaactttgtacaaaaaagctgaacgatatcgccacc 480 atgggcagcacagccattctggccctgctgctggcagtgctgcagggcgtgtcagctcag 540 gtgcagctggtgcagtctggcggcggactcgtgaaacctggcggcagcctgagactgagc 600 tgtgccgccagcggcttcaacttcaacgaccagtacatgagctggatccggcaggcccct 660 ggcaagggactggaatgggtgtccttcatcagcggcagcggcggcaccacctactacacc 720 gatagcgtgaagggccggttcaccatcagccgggacaacaccaaggacagcctgtacctg 780 cagatgaacagcctgaccgtggaagataccgccgtgtactactgcgccagaggcggcaat 840 tactacaccagcgtgggcagaggcaccctcgtgacagtgtctgctggcggaggcggatca 900 ggcggcggaggatcagggggaggcggaagcggagcacccgatatccagatgacacagagc 960 cccggcaccctgtctctgagccctggcgaaagagccatcctgagctgcagagccagccag 1020 agcgtgtccggatacctggcttggtatcagcagaagcccggccaggcccccagactgctg 1080 atctatggcgccaggaggagagccacaggcatccccgatagattcagcggctctggcagc 1140 ggcaccgacttcaccctgacaatcagctccctgcggcccgaggacatcggcacctactat 1200 tgcaagcagtacatcaacgcccccttcaccttcggcggaggcaccaaggtggaaatcaag 1260 ccgcgggccaactttgtatacaaaagtggaacgagaaacgtaaaatgatataaatatcaa 1320 tatattaaattagattttgcataaaaaacagactacataatactgtaaaacacaacatat 1380 ccagtcactatgaatcaactacttagatggtattagtgacctgtactgggcctcatgggc 1440 cttcctttcactgcccgctttccagtcgggaaacctgtcgtgccagctgcattaacatgg 1500 tcatagctgtttccttgcgtattgggcgctctccgcttcctcgctcactgactcgctgcg 1560 ctcggtcgttcgggtaaagcctggggtgcctaatgagcaaaaggccagcaaaaggccagg 1620 aaccgtaaaaaggccgcgttgctggcgtttttccataggctccgccgccctgacgagcat 1680 cacaaaaatcgacgctcaagtcagaggtggcgaaacccgacaggactataaagataccag 1740 gcgtttccccctggaagctccctcgtgcgctctcctgttccgaccctgccgcttaccgga 1800 tacctgtccgcctttctcccttcgggaagcgtggcgctttctcatagctcacgctgtagg 1860 tatctcagttcggtgtaggtcgttcgctccaagctgggctgtgtgcacgaaccccccgtt 1920 cagcccgaccgctgcgccttatccggtaactatcgtcttgagtccaacccggtaagacac 1980 gacttatcgccactggcagcagccactggtaacaggattagcagagcgaggtatgtaggc 2040 ggtgctacagagttcttgaagtggtggcctaactacggctacactagaagaacagtattt 2100 ggtatctgcgctctgctgaagccagttaccttcggaaaaagagttggtagctcttgatcc 2160 ggcaaacaaaccaccgctggtagcggtggtttttttgtttgcaagcagcagattacgcgc 2220 agaaaaaaaggatctcaagaagatcctttgatcttttctacggggtctgacgctcagtgg 2280 aacgaaaactcacgttaagggattttggtcatgagattatcaaaaaggatcttcacctag 2340 atccttttaaattaaaaatgaagttttaaatcaatctaaagtatatatgagtaaacttgg 2400 tctgacagttattagaaaaattcatccagcagacgataaaacgcaatacgctggctatcc 2460 ggtgccgcaatgccatacagcaccagaaaacgatccgcccattcgccgcccagttcttcc 2520 gcaatatcacgggtggccagcgcaatatcctgataacgatccgccacgcccagacggccg 2580 caatcaataaagccgctaaaacggccattttccaccataatgttcggcaggcacgcatca 2640 ccatgggtcaccaccagatcttcgccatccggcatgctcgctttcagacgcgcaaacagc 2700 tctgccggtgccaggccctgatgttcttcatccagatcatcctgatccaccaggcccgct 2760 tccatacgggtacgcgcacgttcaatacgatgtttcgcctgatgatcaaacggacaggtc 2820 gccgggtccagggtatgcagacgacgcatggcatccgccataatgctcactttttctgcc 2880 ggcgccagatggctagacagcagatcctgacccggcacttcgcccagcagcagccaatca 2940 cggcccgcttcggtcaccacatccagcaccgccgcacacggaacaccggtggtggccagc 3000 cagctcagacgcgccgcttcatcctgcagctcgttcagcgcaccgctcagatcggttttc 3060 acaaacagcaccggacgaccctgcgcgctcagacgaaacaccgccgcatcagagcagcca 3120 atggtctgctgcgcccaatcatagccaaacagacgttccacccacgctgccgggctaccc 3180 gcatgcaggccatcctgttcaatcatactcttcctttttcaatattattgaagcatttat 3240 cagggttattgtctcatgagcggatacatatttgaatgtatttagaaaaataaacaaata 3300 ggggttccgcgcacatttccccgaaaagtgccac 3334 SEQIDNO:33 ctaaattgtaagcgttaatattttgttaaaattcgcgttaaatttttgttaaatcagctc 60 (donorvector attttttaaccaataggccgaaatcggcaaaatcccttataaatcaaaagaatagaccga 120 2,pMKhCD8a gatagggttgagtggccgctacagggcgctcccattcgccattcaggctgcgcaactgtt 180 scaffoldTNL5 gggaagggcgtttcggtgcgggcctcttcgctattacgccagctggcgaaagggggatgt 240 L2) gctgcaaggcgattaagttgggtaacgccagggttttcccagtcacgacgttgtaaaacg 300 acggccagtgagcgcgacgtaatacgactcactatagggcgaattgaaggaaggccgtca 360 aggccgcataaataatgattttattttgactgatagtgacctgttcgttgcaacaaattg 420 atgagcaatgcttttttataatgcccaactttgtatacaaaagtggcccgcggacaacaa 480 cccctgcccccagacctcctaccccagcccctacaattgccagccagcctctgagcctga 540 ggcccgaggcttgtagacctgctgctggcggagccgtgcacaccagaggactggatttcg 600 cctgcgacatctacatctgggcccctctggccggcacatgtggcgtgctgctgctgagcc 660 tcgtgatcaccctgtactgcggctccaccagcggctccggcaagcccggctctggcgagg 720 gctccaccagcggcgactacaaggacgacgatgacaagtaataggatatcggttcagctt 780 tcttgtacaaagttggcattataagaaagcattgcttatcaatttgttgcaacgaacagg 840 tcactatcagtcaaaataaaatcattatttctgggcctcatgggccttcctttcactgcc 900 cgctttccagtcgggaaacctgtcgtgccagctgcattaacatggtcatagctgtttcct 960 tgcgtattgggcgctctccgcttcctcgctcactgactcgctgcgctcggtcgttcgggt 1020 aaagcctggggtgcctaatgagcaaaaggccagcaaaaggccaggaaccgtaaaaaggcc 1080 gcgttgctggcgtttttccataggctccgcccccctgacgagcatcacaaaaatcgacgc 1140 tcaagtcagaggtggcgaaacccgacaggactataaagataccaggcgtttccccctgga 1200 agctccctcgtgcgctctcctgttccgaccctgccgcttaccggatacctgtccgccttt 1260 ctcccttcgggaagcgtggcgctttctcatagctcacgctgtaggtatctcagttcggtg 1320 taggtcgttcgctccaagctgggctgtgtgcacgaaccccccgttcagcccgaccgctgc 1380 gccttatccggtaactatcgtcttgagtccaacccggtaagacacgacttatcgccactg 1440 gcagcagccactggtaacaggattagcagagcgaggtatgtaggcggtgctacagagttc 1500 ttgaagtggtggcctaactacggctacactagaagaacagtatttggtatctgcgctctg 1560 ctgaagccagttaccttcggaaaaagagttggtagctcttgatccggcaaacaaaccacc 1620 gctggtagcggtggtttttttgtttgcaagcagcagattacgcgcagaaaaaaaggatct 1680 caagaagatcctttgatcttttctacggggtctgacgctcagtggaacgaaaactcacgt 1740 taagggattttggtcatgagattatcaaaaaggatcttcacctagatccttttaaattaa 1800 aaatgaagttttaaatcaatctaaagtatatatgagtaaacttggtctgacagttattag 1860 aaaaattcatccagcagacgataaaacgcaatacgctggctatccggtgccgcaatgcca 1920 tacagcaccagaaaacgatccgcccattcgccgcccagttcttccgcaatatcacgggtg 1980 gccagcgcaatatcctgataacgatccgccacgcccagacggccgcaatcaataaagccg 2040 ctaaaacggccattttccaccataatgttcggcaggcacgcatcaccatgggtcaccacc 2100 agatcttcgccatccggcatgctcgctttcagacgcgcaaacagctctgccggtgccagg 2160 ccctgatgttcttcatccagatcatcctgatccaccaggcccgcttccatacgggtacgc 2220 gcacgttcaatacgatgtttcgcctgatgatcaaacggacaggtcgccgggtccagggta 2280 tgcagacgacgcatggcatccgccataatgctcactttttctgccggcgccagatggcta 2340 gacagcagatcctgacccggcacttcgcccagcagcagccaatcacggcccgcttcggtc 2400 accacatccagcaccgccgcacacggaacaccggtggtggccagccagctcagacgcgcc 2460 gcttcatcctgcagctcgttcagcgcaccgctcagatcggttttcacaaacagcaccgga 2520 cgaccctgcgcgctcagacgaaacaccgccgcatcagagcagccaatggtctgctgcgcc 2580 caatcatagccaaacagacgttccacccacgctgccgggctacccgcatgcaggccatcc 2640 tgttcaatcatactcttcctttttcaatattattgaagcatttatcagggttattgtctc 2700 atgagcggatacatatttgaatgtatttagaaaaataaacaaataggggttccgcgcaca 2760 tttccccgaaaagtgccac 2779 SEQIDNO:34 cgataaccctaattcgatagcatatgcttcccgttgggtaacatatgctattgaattagg 60 (Finalvector gttagtctggatagtatatactactacccgggaagcatatgctacccgtttagggttcac 120 usedfor cggtgatgccggccacgatgcgtccggcgtagaggatctaatgtgagttagctcactcat 180 lentiviral taggcaccccaggctttacactttatgcttccggctcgtatgttgtgtggaattgtgagc 240 production, ggataacaatttcacacaggaaacagctatgaccatgattacgccaagcgcgcaattaac 300 pLV4301G7C12 cctcactaaagggaacaaaagctggagctgcaagcttaatgtagtcttatgcaatactct 360 scFVmIgGhCD8 tgtagtcttgcaacatggtaacgatgagttagcaacatgccttacaaggagagaaaaagc 420 flag) accgtgcatgccgattggtggaagtaaggtggtacgatcgtgccttattaggaaggcaac 480 agacgggtctgacatggattggacgaaccactgaattgccgcattgcagagatattgtat 540 ttaagtgcctagctcgatacataaacgggtctctctggttagaccagatctgagcctggg 600 agctctctggctaactagggaacccactgcttaagcctcaataaagcttgccttgagtgc 660 ttcaagtagtgtgtgcccgtctgttgtgtgactctggtaactagagatccctcagaccct 720 tttagtcagtgtggaaaatctctagcagtggcgcccgaacagggacttgaaagcgaaagg 780 gaaaccagaggagctctctcgacgcaggactcggcttgctgaagcgcgcacggcaagagg 840 cgaggggcggcgactggtgagtacgccaaaaattttgactagcggaggctagaaggagag 900 agatgggtgcgagagcgtcagtattaagcgggggagaattagatcgcgatgggaaaaaat 960 tcggttaaggccagggggaaagaaaaaatataaattaaaacatatagtatgggcaagcag 1020 ggagctagaacgattcgcagttaatcctggcctgttagaaacatcagaaggctgtagaca 1080 aatactgggacagctacaaccatcccttcagacaggatcagaagaacttagatcattata 1140 taatacagtagcaaccctctattgtgtgcatcaaaggatagagataaaagacaccaagga 1200 agctttagacaagatagaggaagagcaaaacaaaagtaagaccaccgcacagcaagcggc 1260 cgctgatcttcagacctggaggaggagatatgagggacaattggagaagtgaattatata 1320 aatataaagtagtaaaaattgaaccattaggagtagcacccaccaaggcaaagagaagag 1380 tggtgcagagagaaaaaagagcagtgggaataggagctttgttccttgggttcttgggag 1440 cagcaggaagcactatgggcgcagcgtcaatgacgctgacggtacaggccagacaattat 1500 tgtctggtatagtgcagcagcagaacaatttgctgagggctattgaggcgcaacagcatc 1560 tgttgcaactcacagtctggggcatcaagcagctccaggcaagaatcctggctgtggaaa 1620 gatacctaaaggatcaacagctcctggggatttggggttgctctggaaaactcatttgca 1680 ccactgctgtgccttggaatgctagttggagtaataaatctctggaacagatttggaatc 1740 acacgacctggatggagtgggacagagaaattaacaattacacaagcttaatacactcct 1800 taattgaagaatcgcaaaaccagcaagaaaagaatgaacaagaattattggaattagata 1860 aatgggcaagtttgtggaattggtttaacataacaaattggctgtggtatataaaattat 1920 tcataatgatagtaggaggcttggtaggtttaagaatagtttttgctgtactttctatag 1980 tgaatagagttaggcagggatattcaccattatcgtttcagacccacctcccaaccccga 2040 ggggacccgacaggcccgaaggaatagaagaagaaggtggagagagagacagagacagat 2100 ccattcgattagtgaacggatctcgacggtatcggttttaaaagaaaaggggggattggg 2160 gggtacagtgcaggggaaagaatagtagacataatagcaacagacatacaaactaaagaa 2220 ttacaaaaacaaattacaaaaattcaaaattttatcgattttatttagtctccagaaaaa 2280 ggggggaatgaaagaccccacctgtaggtttggcaagctagcttaagtaacgccattttg 2340 caaggcatggaaaatacataactgagaatagagaagttcagatcaaggttaggaacagag 2400 agacaggagaatatgggccaaacaggatatctgtggtaagcagttcctgccccggctcag 2460 ggccaagaacagatggtccccagatgcggtcccgccctcagcagtttctagagaaccatc 2520 agatgtttccagggtgccccaaggacctgaaatgaccctgtgccttatttgaactaacca 2580 atcagttcgcttctcgcttctgttcgcgcgcttctgctccccgagctcaataaaagagcc 2640 cacaacccctcactcggcgcgccagtcctccgatagactgcgtcgcccgggtaccgatat 2700 caccaactttgtacaaaaaagctgaacgatatcgccaccatgggcagcacagccattctg 2760 gccctgctgctggcagtgctgcagggcgtgtcagctcaggtgcagctggtgcagtctggc 2820 ggcggactcgtgaaacctggcggcagcctgagactgagctgtgccgccagcggcttcaac 2880 ttcaacgaccagtacatgagctggatccggcaggcccctggcaagggactggaatgggtg 2940 tccttcatcagcggcagcggcggcaccacctactacaccgatagcgtgaagggccggttc 3000 accatcagccgggacaacaccaaggacagcctgtacctgcagatgaacagcctgaccgtg 3060 gaagataccgccgtgtactactgcgccagaggcggcaattactacaccagcgtgggcaga 3120 ggcaccctcgtgacagtgtctgctggcggaggcggatcaggcggcggaggatcaggggga 3180 ggcggaagcggagcacccgatatccagatgacacagagccccggcaccctgtctctgagc 3240 cctggcgaaagagccatcctgagctgcagagccagccagagcgtgtccggatacctggct 3300 tggtatcagcagaagcccggccaggcccccagactgctgatctatggcgccaggaggaga 3360 gccacaggcatccccgatagattcagcggctctggcagcggcaccgacttcaccctgaca 3420 atcagctccctgcggcccgaggacatcggcacctactattgcaagcagtacatcaacgcc 3480 cccttcaccttcggcggaggcaccaaggtggaaatcaagccgcgggccaactttgtatac 3540 aaaagtggcccgcggacaacaacccctgcccccagacctcctaccccagcccctacaatt 3600 gccagccagcctctgagcctgaggcccgaggcttgtagacctgctgctggcggagccgtg 3660 cacaccagaggactggatttcgcctgcgacatctacatctgggcccctctggccggcaca 3720 tgtggcgtgctgctgctgagcctcgtgatcaccctgtactgcggctccaccagcggctcc 3780 ggcaagcccggctctggcgagggctccaccagcggcgactacaaggacgacgatgacaag 3840 taataggatatcggttcagctttcttgtacaaagttgggattcgagttaattaagttaac 3900 gaattccccccctctccctcccccccccctaacgttactggccgaagccgcttggaataa 3960 ggccggtgtgcgtttgtctatatgttattttccaccatattgccgtcttttggcaatgtg 4020 agggcccggaaacctggccctgtcttcttgacgagcattcctaggggtctttcccctctc 4080 gccaaaggaatgcaaggtctgttgaatgtcgtgaaggaagcagttcctctggaagcttct 4140 tgaagacaaacaacgtctgtagcgaccctttgcaggcagcggaaccccccacctggcgac 4200 aggtgcctctgcggccaaaagccacgtgtataagatacacctgcaaaggcggcacaaccc 4260 cagtgccacgttgtgagttggatagttgtggaaagagtcaaatggctctcctcaagcgta 4320 ttcaacaaggggctgaaggatgcccagaaggtaccccattgtatgggatctgatctgggg 4380 cctcggtgcacatgctttacatgtgtttagtcgaggttaaaaaacgtctaggccccccga 4440 accacggggacgtggttttcctttgaaaaacacgatgataatatggccacaaccatggga 4500 ggcggaagcggcggaggctcccctcgaggcaccatggtgagcaagggcgaggagctgttc 4560 accggggtggtgcccatcctggtcgagctggacggcgacgtaaacggccacaagttcagc 4620 gtgtccggcgagggcgagggcgatgccacctacggcaagctgaccctgaagttcatctgc 4680 accaccggcaagctgcccgtgccctggcccaccctcgtgaccaccctgacctacggcgtg 4740 cagtgcttcagccgctaccccgaccacatgaagcagcacgacttcttcaagtccgccatg 4800 cccgaaggctacgtccaggagcgcaccatcttcttcaaggacgacggcaactacaagacc 4860 cgcgccgaggtgaagttcgagggcgacaccctggtgaaccgcatcgagctgaagggcatc 4920 gacttcaaggaggacggcaacatcctggggcacaagctggagtacaactacaacagccac 4980 aacgtctatatcatggccgacaagcagaagaacggcatcaaggtgaacttcaagatccgc 5040 cacaacatcgaggacggcagcgtgcagctcgccgaccactaccagcagaacacccccatc 5100 ggcgacggccccgtgctgctgcccgacaaccactacctgagcacccagtccgccctgagc 5160 aaagaccccaacgagaagcgcgatcacatggtcctgctggagttcgtgaccgccgccggg 5220 atcactctcggcatggacgagctgtacaagtaacgcgtcccgggtctagagctagcggta 5280 ccatgcattacgtagtcgacgacttaattaagctagcctagtgccatttgttcagtggtt 5340 cgtagggctttcccccactgtttggctttcagttatatggatgatgtggtattgggggcc 5400 aagtctgtacagcatcttgagtccctttttaccgctgttaccaattttcttttgtctttg 5460 ggtatacatttaaaccctaacaaaacaaagagatggggttactctctaaattttatgggt 5520 tatgtcattggatgttatgggtccttgccacaagaacacatcatacaaaaaatcaaagaa 5580 tgttttagaaaacttcctattaacaggcctattgattggaaagtatgtcaacgaattgtg 5640 ggtcttttgggttttgctgccccttttacacaatgtggttatcctgcgttgatgcctttg 5700 tatgcatgtattcaatctaagcaggctttcactttctcgccaacttacaaggcctttctg 5760 tgtaaacaatacctgaacctttaccccgttgcccggcaacggccaggtctgtgccaagtg 5820 tttgctgacgcaacccccactggctggggcttggtcatgggccatcagcgcatgcgtgga 5880 accttttcggctcctctgccgatccatactgcggaactcctagccgcttgttttgctcgc 5940 agcaggtctggagcaaacattatcgggactgataactctgttgtcctatcccgcaaatat 6000 acatcgtttccatggctgctaggctgtgctgccaactggatcctgcgcgggacgtccttt 6060 gtttacgtcccgtcggcgctgaatcctgcggacgacccttctcggggtcgcttgggactc 6120 tctcgtccccttctccgtctgccgttccgaccgaccacggggcgcacctctctttacgcg 6180 gactccccgtctgtgccttctcatctgccggaccgtgtgcacttcgcttcacctctgcac 6240 gtcgcatggagaccaccgtgaacgcccaccaaatattgcccaaggtcttacataagagga 6300 ctcttggactctcagcaatgtcaacgaccgaccttgaggcatacttcaaagactgtttgt 6360 ttaaagactgggaggagttgggggaggagattaggttaaaggtctttgtactaggaggct 6420 gtaggcataaattggtctgcgcaccagcaccatggcgcaatcactagagcggggtacctt 6480 taagaccaatgacttacaaggcagctgtagatcttagccactttttaaaagaaaaggggg 6540 gactggaagggctaattcactcccaacgaagacaagatctgctttttgcttgtactgggt 6600 ctctctggttagaccagatctgagcctgggagctctctggctaactagggaacccactgc 6660 ttaagcctcaataaagcttgccttgagtgcttcaagtagtgtgtgcccgtctgttgtgtg 6720 actctggtaactagagatccctcagacccttttagtcagtgtggaaaatctctagcagta 6780 gtagttcatgtcatcttattattcagtatttataacttgcaaagaaatgaatatcagaga 6840 gtgagaggaacttgtttattgcagcttataatggttacaaataaagcaatagcatcacaa 6900 atttcacaaataaagcatttttttcactgcattctagttgtggtttgtccaaactcatca 6960 atgtatcttatcatgtctggctctagctatcccgcccctaactccgcccatcccgcccct 7020 aactccgcccagttccgcccattctccgccccatggctgactaattttttttatttatgc 7080 agaggccgaggccggatcccttgagtggctttcatcctggagcagactttgcagtctgtg 7140 gactgcaacacaacattgcctttatgtgtaactcttggctgaagctcttacaccaatgct 7200 gggggacatgtacctcccaggggcccaggaagactacgggaggctacaccaacgtcaatc 7260 agaggggcctgtgtagctaccgataagcggaccctcaagagggcattagcaatagtgttt 7320 ataaggcccccttgttaattcttgaagacgaaagggcctcgtgatacgcctatttttata 7380 ggttaatgtcatgataataatggtttcttagacgtcaggtggcacttttcggggaaatgt 7440 gcgcggaacccctatttgtttatttttctaaatacattcaaatatgtatccgctcatgag 7500 acaataaccctgataaatgcttcaataatattgaaaaaggaagagtatgagtattcaaca 7560 tttccgtgtcgcccttattcccttttttgcggcattttgccttcctgtttttgctcaccc 7620 agaaacgctggtgaaagtaaaagatgctgaagatcagttgggtgcacgagtgggttacat 7680 cgaactggatctcaacagcggtaagatccttgagagttttcgccccgaagaacgttttcc 7740 aatgatgagcacttttaaagttctgctatgtggcgcggtattatcccgtgttgacgccgg 7800 gcaagagcaactcggtcgccgcatacactattctcagaatgacttggttgagtactcacc 7860 agtcacagaaaagcatcttacggatggcatgacagtaagagaattatgcagtgctgccat 7920 aaccatgagtgataacactgcggccaacttacttctgacaacgatcggaggaccgaagga 7980 gctaaccgcttttttgcacaacatgggggatcatgtaactcgccttgatcgttgggaacc 8040 ggagctgaatgaagccataccaaacgacgagcgtgacaccacgatgcctgcagcaatggc 8100 aacaacgttgcgcaaactattaactggcgaactacttactctagcttcccggcaacaatt 8160 aatagactggatggaggcggataaagttgcaggaccacttctgcgctcggcccttccggc 8220 tggctggtttattgctgataaatctggagccggtgagcgtgggtctcgcggtatcattgc 8280 agcactggggccagatggtaagccctcccgtatcgtagttatctacacgacggggagtca 8340 ggcaactatggatgaacgaaatagacagatcgctgagataggtgcctcactgattaagca 8400 ttggtaactgtcagaccaagtttactcatatatactttagattgatttaaaacttcattt 8460 ttaatttaaaaggatctaggtgaagatcctttttgataatctcatgaccaaaatccctta 8520 acgtgagttttcgttccactgagcgtcagaccccgtagaaaagatcaaaggatcttcttg 8580 agatcctttttttctgcgcgtaatctgctgcttgcaaacaaaaaaaccaccgctaccagc 8640 ggtggtttgtttgccggatcaagagctaccaactctttttccgaaggtaactggcttcag 8700 cagagcgcagataccaaatactgtccttctagtgtagccgtagttaggccaccacttcaa 8760 gaactctgtagcaccgcctacatacctcgctctgctaatcctgttaccagtggctgctgc 8820 cagtggcgataagtcgtgtcttaccgggttggactcaagacgatagttaccggataaggc 8880 gcagcggtcgggctgaacggggggttcgtgcacacagcccagcttggagcgaacgaccta 8940 caccgaactgagatacctacagcgtgagcattgagaaagcgccacgcttcccgaagggag 9000 aaaggcggacaggtatccggtaagcggcagggtcggaacaggagagcgcacgagggagct 9060 tccagggggaaacgcctggtatctttatagtcctgtcgggtttcgccacctctgacttga 9120 gcgtcgatttttgtgatgctcgtcaggggggcggagcctatggaaaaacgccagcaacgc 9180 ggcctttttacggttcctggccttttgctggcctttttgaagctgtccctgatggtcgtc 9240 atctacctgcctggacagcatggcctgcaacgcgggcatcccgatgccgccggaagcgag 9300 aagaatcataatggggaaggccatccagcctcgcgtcg 9338 SEQIDNO:35 cgataaccctaattcgatagcatatgcttcccgttgggtaacatatgctattgaattagg 60 (destination gttagtctggatagtatatactactacccgggaagcatatgctacccgtttagggttcac 120 vector, cggtgatgccggccacgatgcgtccggcgtagaggatctaatgtgagttagctcactcat 180 pLV4301G) taggcaccccaggctttacactttatgcttccggctcgtatgttgtgtggaattgtgagc 240 ggataacaatttcacacaggaaacagctatgaccatgattacgccaagcgcgcaattaac 300 cctcactaaagggaacaaaagctggagctgcaagcttaatgtagtcttatgcaatactct 360 tgtagtcttgcaacatggtaacgatgagttagcaacatgccttacaaggagagaaaaagc 420 accgtgcatgccgattggtggaagtaaggtggtacgatcgtgccttattaggaaggcaac 480 agacgggtctgacatggattggacgaaccactgaattgccgcattgcagagatattgtat 540 ttaagtgcctagctcgatacataaacgggtctctctggttagaccagatctgagcctggg 600 agctctctggctaactagggaacccactgcttaagcctcaataaagcttgccttgagtgc 660 ttcaagtagtgtgtgcccgtctgttgtgtgactctggtaactagagatccctcagaccct 720 tttagtcagtgtggaaaatctctagcagtggcgcccgaacagggacttgaaagcgaaagg 780 gaaaccagaggagctctctcgacgcaggactcggcttgctgaagcgcgcacggcaagagg 840 cgaggggcggcgactggtgagtacgccaaaaattttgactagcggaggctagaaggagag 900 agatgggtgcgagagcgtcagtattaagcgggggagaattagatcgcgatgggaaaaaat 960 tcggttaaggccagggggaaagaaaaaatataaattaaaacatatagtatgggcaagcag 1020 ggagctagaacgattcgcagttaatcctggcctgttagaaacatcagaaggctgtagaca 1080 aatactgggacagctacaaccatcccttcagacaggatcagaagaacttagatcattata 1140 taatacagtagcaaccctctattgtgtgcatcaaaggatagagataaaagacaccaagga 1200 agctttagacaagatagaggaagagcaaaacaaaagtaagaccaccgcacagcaagcggc 1260 cgctgatcttcagacctggaggaggagatatgagggacaattggagaagtgaattatata 1320 aatataaagtagtaaaaattgaaccattaggagtagcacccaccaaggcaaagagaagag 1380 tggtgcagagagaaaaaagagcagtgggaataggagctttgttccttgggttcttgggag 1440 cagcaggaagcactatgggcgcagcgtcaatgacgctgacggtacaggccagacaattat 1500 tgtctggtatagtgcagcagcagaacaatttgctgagggctattgaggcgcaacagcatc 1560 tgttgcaactcacagtctggggcatcaagcagctccaggcaagaatcctggctgtggaaa 1620 gatacctaaaggatcaacagctcctggggatttggggttgctctggaaaactcatttgca 1680 ccactgctgtgccttggaatgctagttggagtaataaatctctggaacagatttggaatc 1740 acacgacctggatggagtgggacagagaaattaacaattacacaagcttaatacactcct 1800 taattgaagaatcgcaaaaccagcaagaaaagaatgaacaagaattattggaattagata 1860 aatgggcaagtttgtggaattggtttaacataacaaattggctgtggtatataaaattat 1920 tcataatgatagtaggaggcttggtaggtttaagaatagtttttgctgtactttctatag 1980 tgaatagagttaggcagggatattcaccattatcgtttcagacccacctcccaaccccga 2040 ggggacccgacaggcccgaaggaatagaagaagaaggtggagagagagacagagacagat 2100 ccattcgattagtgaacggatctcgacggtatcggttttaaaagaaaaggggggattggg 2160 gggtacagtgcaggggaaagaatagtagacataatagcaacagacatacaaactaaagaa 2220 ttacaaaaacaaattacaaaaattcaaaattttatcgattttatttagtctccagaaaaa 2280 ggggggaatgaaagaccccacctgtaggtttggcaagctagcttaagtaacgccattttg 2340 caaggcatggaaaatacataactgagaatagagaagttcagatcaaggttaggaacagag 2400 agacaggagaatatgggccaaacaggatatctgtggtaagcagttcctgccccggctcag 2460 ggccaagaacagatggtccccagatgcggtcccgccctcagcagtttctagagaaccatc 2520 agatgtttccagggtgccccaaggacctgaaatgaccctgtgccttatttgaactaacca 2580 atcagttcgcttctcgcttctgttcgcgcgcttctgctccccgagctcaataaaagagcc 2640 cacaacccctcactcggcgcgccagtcctccgatagactgcgtcgcccgggtaccgatat 2700 cacaagtttgtacaaaaaagctgaacgagaaacgtaaaatgatataaatatcaatatatt 2760 aaattagattttgcataaaaaacagactacataatactgtaaaacacaacatatccagtc 2820 actatggcggccgcattaggcaccccaggctttacactttatgcttccggctcgtataat 2880 gtgtggattttgagttaggatccgtcgagattttcaggagctaaggaagctaaaatggag 2940 aaaaaaatcactggatataccaccgttgatatatcccaatggcatcgtaaagaacatttt 3000 gaggcatttcagtcagttgctcaatgtacctataaccagaccgttcagctggatattacg 3060 gcctttttaaagaccgtaaagaaaaataagcacaagttttatccggcctttattcacatt 3120 cttgcccgcctgatgaatgctcatccggaattccgtatggcaatgaaagacggtgagctg 3180 gtgatatgggatagtgttcacccttgttacaccgttttccatgagcaaactgaaacgttt 3240 tcatcgctctggagtgaataccacgacgatttccggcagtttctacacatatattcgcaa 3300 gatgtggcgtgttacggtgaaaacctggcctatttccctaaagggtttattgagaatatg 3360 tttttcgtctcagccaatccctgggtgagtttcaccagttttgatttaaacgtggccaat 3420 atggacaacttcttcgcccccgttttcaccatgggcaaatattatacgcaaggcgacaag 3480 gtgctgatgccgctggcgattcaggttcatcatgccgtttgtgatggcttccatgtcggc 3540 agaatgcttaatgaattacaacagtactgcgatgagtggcagggcggggcgtaaatggat 3600 ccggcttactaaaagccagataacagtatgcgtatttgcgcgctgatttttgcggtataa 3660 gaatatatactgatatgtatacccgaagtatgtcaaaaagaggtatgctatgaagcagcg 3720 tattacagtgacagttgacagcgacagctatcagttgctcaaggcatatatgatgtcaat 3780 atctccggtctggtaagcacaaccatgcagaatgaagcccgtcgtctgcgtgccgaacgc 3840 tggaaagcggaaaatcaggaagggatggctgaggtcgcccggtttattgaaatgaacggc 3900 tcttttgctgacgagaacaggggctggtgaaatgcagtttaaggtttacacctataaaag 3960 agagagccgttatcgtctgtttgtggatgtacagagtgatattattgacacgcccgggcg 4020 acggatggtgatccccctggccagtgcacgtctgctgtcagataaagtctcccgtgaact 4080 ttacccggtggtgcatatcggggatgaaagctggcgcatgatgaccaccgatatggccag 4140 tgtgccggtctccgttatcggggaagaagtggctgatctcagccaccgcgaaaatgacat 4200 caaaaacgccattaacctgatgttctggggaatataaatgtcaggctcccttatacacag 4260 ccagtctgcaggtcgaccatagtgactggatatgttgtgttttacagtattatgtagtct 4320 gttttttatgcaaaatctaatttaatatattgatatttatatcattttacgtttctcgtt 4380 cagctttcttgtacaaagtggtgattcgagttaattaagttaacgaattccccccctctc 4440 cctcccccccccctaacgttactggccgaagccgcttggaataaggccggtgtgcgtttg 4500 tctatatgttattttccaccatattgccgtcttttggcaatgtgagggcccggaaacctg 4560 gccctgtcttcttgacgagcattcctaggggtctttcccctctcgccaaaggaatgcaag 4620 gtctgttgaatgtcgtgaaggaagcagttcctctggaagcttcttgaagacaaacaacgt 4680 ctgtagcgaccctttgcaggcagcggaaccccccacctggcgacaggtgcctctgcggcc 4740 aaaagccacgtgtataagatacacctgcaaaggcggcacaaccccagtgccacgttgtga 4800 gttggatagttgtggaaagagtcaaatggctctcctcaagcgtattcaacaaggggctga 4860 aggatgcccagaaggtaccccattgtatgggatctgatctggggcctcggtgcacatgct 4920 ttacatgtgtttagtcgaggttaaaaaacgtctaggccccccgaaccacggggacgtggt 4980 tttcctttgaaaaacacgatgataatatggccacaaccatgggaggcggaagcggcggag 5040 gctcccctcgaggcaccatggtgagcaagggcgaggagctgttcaccggggtggtgccca 5100 tcctggtcgagctggacggcgacgtaaacggccacaagttcagcgtgtccggcgagggcg 5160 agggcgatgccacctacggcaagctgaccctgaagttcatctgcaccaccggcaagctgc 5220 ccgtgccctggcccaccctcgtgaccaccctgacctacggcgtgcagtgcttcagccgct 5280 accccgaccacatgaagcagcacgacttcttcaagtccgccatgcccgaaggctacgtcc 5340 aggagcgcaccatcttcttcaaggacgacggcaactacaagacccgcgccgaggtgaagt 5400 tcgagggcgacaccctggtgaaccgcatcgagctgaagggcatcgacttcaaggaggacg 5460 gcaacatcctggggcacaagctggagtacaactacaacagccacaacgtctatatcatgg 5520 ccgacaagcagaagaacggcatcaaggtgaacttcaagatccgccacaacatcgaggacg 5580 gcagcgtgcagctcgccgaccactaccagcagaacacccccatcggcgacggccccgtgc 5640 tgctgcccgacaaccactacctgagcacccagtccgccctgagcaaagaccccaacgaga 5700 agcgcgatcacatggtcctgctggagttcgtgaccgccgccgggatcactctcggcatgg 5760 acgagctgtacaagtaacgcgtcccgggtctagagctagcggtaccatgcattacgtagt 5820 cgacgacttaattaagctagcctagtgccatttgttcagtggttcgtagggctttccccc 5880 actgtttggctttcagttatatggatgatgtggtattgggggccaagtctgtacagcatc 5940 ttgagtccctttttaccgctgttaccaattttcttttgtctttgggtatacatttaaacc 6000 ctaacaaaacaaagagatggggttactctctaaattttatgggttatgtcattggatgtt 6060 atgggtccttgccacaagaacacatcatacaaaaaatcaaagaatgttttagaaaacttc 6120 ctattaacaggcctattgattggaaagtatgtcaacgaattgtgggtcttttgggttttg 6180 ctgccccttttacacaatgtggttatcctgcgttgatgcctttgtatgcatgtattcaat 6240 ctaagcaggctttcactttctcgccaacttacaaggcctttctgtgtaaacaatacctga 6300 acctttaccccgttgcccggcaacggccaggtctgtgccaagtgtttgctgacgcaaccc 6360 ccactggctggggcttggtcatgggccatcagcgcatgcgtggaaccttttcggctcctc 6420 tgccgatccatactgcggaactcctagccgcttgttttgctcgcagcaggtctggagcaa 6480 acattatcgggactgataactctgttgtcctatcccgcaaatatacatcgtttccatggc 6540 tgctaggctgtgctgccaactggatcctgcgcgggacgtcctttgtttacgtcccgtcgg 6600 cgctgaatcctgcggacgacccttctcggggtcgcttgggactctctcgtccccttctcc 6660 gtctgccgttccgaccgaccacggggcgcacctctctttacgcggactccccgtctgtgc 6720 cttctcatctgccggaccgtgtgcacttcgcttcacctctgcacgtcgcatggagaccac 6780 cgtgaacgcccaccaaatattgcccaaggtcttacataagaggactcttggactctcagc 6840 aatgtcaacgaccgaccttgaggcatacttcaaagactgtttgtttaaagactgggagga 6900 gttgggggaggagattaggttaaaggtctttgtactaggaggctgtaggcataaattggt 6960 ctgcgcaccagcaccatggcgcaatcactagagcggggtacctttaagaccaatgactta 7020 caaggcagctgtagatcttagccactttttaaaagaaaaggggggactggaagggctaat 7080 tcactcccaacgaagacaagatctgctttttgcttgtactgggtctctctggttagacca 7140 gatctgagcctgggagctctctggctaactagggaacccactgcttaagcctcaataaag 7200 cttgccttgagtgcttcaagtagtgtgtgcccgtctgttgtgtgactctggtaactagag 7260 atccctcagacccttttagtcagtgtggaaaatctctagcagtagtagttcatgtcatct 7320 tattattcagtatttataacttgcaaagaaatgaatatcagagagtgagaggaacttgtt 7380 tattgcagcttataatggttacaaataaagcaatagcatcacaaatttcacaaataaagc 7440 atttttttcactgcattctagttgtggtttgtccaaactcatcaatgtatcttatcatgt 7500 ctggctctagctatcccgcccctaactccgcccatcccgcccctaactccgcccagttcc 7560 gcccattctccgccccatggctgactaattttttttatttatgcagaggccgaggccgga 7620 tcccttgagtggctttcatcctggagcagactttgcagtctgtggactgcaacacaacat 7680 tgcctttatgtgtaactcttggctgaagctcttacaccaatgctgggggacatgtacctc 7740 ccaggggcccaggaagactacgggaggctacaccaacgtcaatcagaggggcctgtgtag 7800 ctaccgataagcggaccctcaagagggcattagcaatagtgtttataaggcccccttgtt 7860 aattcttgaagacgaaagggcctcgtgatacgcctatttttataggttaatgtcatgata 7920 ataatggtttcttagacgtcaggtggcacttttcggggaaatgtgcgcggaacccctatt 7980 tgtttatttttctaaatacattcaaatatgtatccgctcatgagacaataaccctgataa 8040 atgcttcaataatattgaaaaaggaagagtatgagtattcaacatttccgtgtcgccctt 8100 attcccttttttgcggcattttgccttcctgtttttgctcacccagaaacgctggtgaaa 8160 gtaaaagatgctgaagatcagttgggtgcacgagtgggttacatcgaactggatctcaac 8220 agcggtaagatccttgagagttttcgccccgaagaacgttttccaatgatgagcactttt 8280 aaagttctgctatgtggcgcggtattatcccgtgttgacgccgggcaagagcaactcggt 8340 cgccgcatacactattctcagaatgacttggttgagtactcaccagtcacagaaaagcat 8400 cttacggatggcatgacagtaagagaattatgcagtgctgccataaccatgagtgataac 8460 actgcggccaacttacttctgacaacgatcggaggaccgaaggagctaaccgcttttttg 8520 cacaacatgggggatcatgtaactcgccttgatcgttgggaaccggagctgaatgaagcc 8580 ataccaaacgacgagcgtgacaccacgatgcctgcagcaatggcaacaacgttgcgcaaa 8640 ctattaactggcgaactacttactctagcttcccggcaacaattaatagactggatggag 8700 gcggataaagttgcaggaccacttctgcgctcggcccttccggctggctggtttattgct 8760 gataaatctggagccggtgagcgtgggtctcgcggtatcattgcagcactggggccagat 8820 ggtaagccctcccgtatcgtagttatctacacgacggggagtcaggcaactatggatgaa 8880 cgaaatagacagatcgctgagataggtgcctcactgattaagcattggtaactgtcagac 8940 caagtttactcatatatactttagattgatttaaaacttcatttttaatttaaaaggatc 9000 taggtgaagatcctttttgataatctcatgaccaaaatcccttaacgtgagttttcgttc 9060 cactgagcgtcagaccccgtagaaaagatcaaaggatcttcttgagatcctttttttctg 9120 cgcgtaatctgctgcttgcaaacaaaaaaaccaccgctaccagcggtggtttgtttgccg 9180 gatcaagagctaccaactctttttccgaaggtaactggcttcagcagagcgcagatacca 9240 aatactgtccttctagtgtagccgtagttaggccaccacttcaagaactctgtagcaccg 9300 cctacatacctcgctctgctaatcctgttaccagtggctgctgccagtggcgataagtcg 9360 tgtcttaccgggttggactcaagacgatagttaccggataaggcgcagcggtcgggctga 9420 acggggggttcgtgcacacagcccagcttggagcgaacgacctacaccgaactgagatac 9480 ctacagcgtgagcattgagaaagcgccacgcttcccgaagggagaaaggcggacaggtat 9540 ccggtaagcggcagggtcggaacaggagagcgcacgagggagcttccagggggaaacgcc 9600 tggtatctttatagtcctgtcgggtttcgccacctctgacttgagcgtcgatttttgtga 9660 tgctcgtcaggggggcggagcctatggaaaaacgccagcaacgcggcctttttacggttc 9720 ctggccttttgctggcctttttgaagctgtccctgatggtcgtcatctacctgcctggac 9780 agcatggcctgcaacgcgggcatcccgatgccgccggaagcgagaagaatcataatgggg 9840 aaggccatccagcctcgcgtcg 9862 SEQIDNO:36 ctaaattgtaagcgttaatattttgttaaaattcgcgttaaatttttgttaaatcagctc 60 (donorvector attttttaaccaataggccgaaatcggcaaaatcccttataaatcaaaagaatagaccga 120 1,pMK8B3 gatagggttgagtggccgctacagggcgctcccattcgccattcaggctgcgcaactgtt 180 antimFCscFV gggaagggcgtttcggtgcgggcctcttcgctattacgccagctggcgaaagggggatgt 240 CoOpECORV gctgcaaggcgattaagttgggtaacgccagggttttcccagtcacgacgttgtaaaacg 300 SacIIL1R5) acggccagtgagcgcgacgtaatacgactcactatagggcgaattgaaggaaggccgtca 360 aggccgcataaataatgattttattttgactgatagtgacctgttcgttgcaacaaattg 420 atgagcaatgcttttttataatgccaactttgtacaaaaaagctgaacgatatcgccacc 480 atgggcagcacagccattctggccctgctgctggcagtgctgcagggcgtgtcagctcag 540 gtgcagctgcagcagtctggcgccgaagtgaagaaacccggcagcagcgtgaaggtgtcc 600 tgcaaggctagcggcggcaccttcaggagctacgccatttcttgggtgcgccaggcccct 660 ggacagggcctggaatggatgggctggatcagcccctacaacggcaacaccgactacgcc 720 cagaaagtgcagggcagagtgaccctgaccaccgacaccagcacctccaccgcctacatg 780 gaactgcggagcctgagaagcgacgacaccgccgtgtactactgtgccacaggcggcgga 840 acctggtacagcgatctgtggggcagaggcaccctcgtgacagtgtctgctggcggcgga 900 ggatctggcggaggcggaagtggcgggggaggaagcggagcacctgagatcgtgctgacc 960 cagagccctagcacactgagcgccagcgtgggcgacagagtgtccatcacctgtagagcc 1020 agccagagcatcggaggcagcctggcctggtatcagcagaagcctggcaaggcccccaag 1080 ctgctgatctctgaggccagcaccctggaaagaggcgtgcccagcagattttccggcagc 1140 ggctctggcaccgacttcaccctgacaatcagcagcctgcagcccgaggacgtggccacc 1200 tactactgccagaagtacaacagcgtgcccctgaccttcggccctggcaccaaggtggaa 1260 atcaagccgcgggccaactttgtatacaaaagtggaacgagaaacgtaaaatgatataaa 1320 tatcaatatattaaattagattttgcataaaaaacagactacataatactgtaaaacaca 1380 acatatccagtcactatgaatcaactacttagatggtattagtgacctgtactgggcctc 1440 atgggccttcctttcactgcccgctttccagtcgggaaacctgtcgtgccagctgcatta 1500 acatggtcatagctgtttccttgcgtattgggcgctctccgcttcctcgctcactgactc 1560 gctgcgctcggtcgttcgggtaaagcctggggtgcctaatgagcaaaaggccagcaaaag 1620 gccaggaaccgtaaaaaggccgcgttgctggcgtttttccataggctccgcccccctgac 1680 gagcatcacaaaaatcgacgctcaagtcagaggtggcgaaacccgacaggactataaaga 1740 taccaggcgtttccccctggaagctccctcgtgcgctctcctgttccgaccctgccgctt 1800 accggatacctgtccgcctttctcccttcgggaagcgtggcgctttctcatagctcacgc 1860 tgtaggtatctcagttcggtgtaggtcgttcgctccaagctgggctgtgtgcacgaaccc 1920 cccgttcagcccgaccgctgcgccttatccggtaactatcgtcttgagtccaacccggta 1980 agacacgacttatcgccactggcagcagccactggtaacaggattagcagagcgaggtat 2040 gtaggcggtgctacagagttcttgaagtggtggcctaactacggctacactagaagaaca 2100 gtatttggtatctgcgctctgctgaagccagttaccttcggaaaaagagttggtagctct 2160 tgatccggcaaacaaaccaccgctggtagcggtggtttttttgtttgcaagcagcagatt 2220 acgcgcagaaaaaaaggatctcaagaagatcctttgatcttttctacggggtctgacgct 2280 cagtggaacgaaaactcacgttaagggattttggtcatgagattatcaaaaaggatcttc 2340 acctagatccttttaaattaaaaatgaagttttaaatcaatctaaagtatatatgagtaa 2400 acttggtctgacagttattagaaaaattcatccagcagacgataaaacgcaatacgctgg 2460 ctatccggtgccgcaatgccatacagcaccagaaaacgatccgcccattcgccgcccagt 2520 tcttccgcaatatcacgggtggccagcgcaatatcctgataacgatccgccacgcccaga 2580 cggccgcaatcaataaagccgctaaaacggccattttccaccataatgttcggcaggcac 2640 gcatcaccatgggtcaccaccagatcttcgccatccggcatgctcgctttcagacgcgca 2700 aacagctctgccggtgccaggccctgatgttcttcatccagatcatcctgatccaccagg 2760 cccgcttccatacgggtacgcgcacgttcaatacgatgtttcgcctgatgatcaaacgga 2820 caggtcgccgggtccagggtatgcagacgacgcatggcatccgccataatgctcactttt 2880 tctgccggcgccagatggctagacagcagatcctgacccggcacttcgcccagcagcagc 2940 caatcacggcccgcttcggtcaccacatccagcaccgccgcacacggaacaccggtggtg 3000 gccagccagctcagacgcgccgcttcatcctgcagctcgttcagcgcaccgctcagatcg 3060 gttttcacaaacagcaccggacgaccctgcgcgctcagacgaaacaccgccgcatcagag 3120 cagccaatggtctgctgcgcccaatcatagccaaacagacgttccacccacgctgccggg 3180 ctacccgcatgcaggccatcctgttcaatcatactcttcctttttcaatattattgaagc 3240 atttatcagggttattgtctcatgagcggatacatatttgaatgtatttagaaaaataaa 3300 caaataggggttccgcgcacatttccccgaaaagtgccac 3340 SEQIDNO:37 ctaaattgtaagcgttaatattttgttaaaattcgcgttaaatttttgttaaatcagctc 60 (donorvector attttttaaccaataggccgaaatcggcaaaatcccttataaatcaaaagaatagaccga 120 2,pMKhCD8a gatagggttgagtggccgctacagggcgctcccattcgccattcaggctgcgcaactgtt 180 scaffoldTNL5 gggaagggcgtttcggtgcgggcctcttcgctattacgccagctggcgaaagggggatgt 240 L2) gctgcaaggcgattaagttgggtaacgccagggttttcccagtcacgacgttgtaaaacg 300 acggccagtgagcgcgacgtaatacgactcactatagggcgaattgaaggaaggccgtca 360 aggccgcataaataatgattttattttgactgatagtgacctgttcgttgcaacaaattg 420 atgagcaatgcttttttataatgcccaactttgtatacaaaagtggcccgcggacaacaa 480 cccctgcccccagacctcctaccccagcccctacaattgccagccagcctctgagcctga 540 ggcccgaggcttgtagacctgctgctggcggagccgtgcacaccagaggactggatttcg 600 cctgcgacatctacatctgggcccctctggccggcacatgtggcgtgctgctgctgagcc 660 tcgtgatcaccctgtactgcggctccaccagcggctccggcaagcccggctctggcgagg 720 gctccaccagcggcgactacaaggacgacgatgacaagtaataggatatcggttcagctt 780 tcttgtacaaagttggcattataagaaagcattgcttatcaatttgttgcaacgaacagg 840 tcactatcagtcaaaataaaatcattatttctgggcctcatgggccttcctttcactgcc 900 cgctttccagtcgggaaacctgtcgtgccagctgcattaacatggtcatagctgtttcct 960 tgcgtattgggcgctctccgcttcctcgctcactgactcgctgcgctcggtcgttcgggt 1020 aaagcctggggtgcctaatgagcaaaaggccagcaaaaggccaggaaccgtaaaaaggcc 1080 gcgttgctggcgtttttccataggctccgcccccctgacgagcatcacaaaaatcgacgc 1140 tcaagtcagaggtggcgaaacccgacaggactataaagataccaggcgtttccccctgga 1200 agctccctcgtgcgctctcctgttccgaccctgccgcttaccggatacctgtccgccttt 1260 ctcccttcgggaagcgtggcgctttctcatagctcacgctgtaggtatctcagttcggtg 1320 taggtcgttcgctccaagctgggctgtgtgcacgaaccccccgttcagcccgaccgctgc 1380 gccttatccggtaactatcgtcttgagtccaacccggtaagacacgacttatcgccactg 1440 gcagcagccactggtaacaggattagcagagcgaggtatgtaggcggtgctacagagttc 1500 ttgaagtggtggcctaactacggctacactagaagaacagtatttggtatctgcgctctg 1560 ctgaagccagttaccttcggaaaaagagttggtagctcttgatccggcaaacaaaccacc 1620 gctggtagcggtggtttttttgtttgcaagcagcagattacgcgcagaaaaaaaggatct 1680 caagaagatcctttgatcttttctacggggtctgacgctcagtggaacgaaaactcacgt 1740 taagggattttggtcatgagattatcaaaaaggatcttcacctagatccttttaaattaa 1800 aaatgaagttttaaatcaatctaaagtatatatgagtaaacttggtctgacagttattag 1860 aaaaattcatccagcagacgataaaacgcaatacgctggctatccggtgccgcaatgcca 1920 tacagcaccagaaaacgatccgcccattcgccgcccagttcttccgcaatatcacgggtg 1980 gccagcgcaatatcctgataacgatccgccacgcccagacggccgcaatcaataaagccg 2040 ctaaaacggccattttccaccataatgttcggcaggcacgcatcaccatgggtcaccacc 2100 agatcttcgccatccggcatgctcgctttcagacgcgcaaacagctctgccggtgccagg 2160 ccctgatgttcttcatccagatcatcctgatccaccaggcccgcttccatacgggtacgc 2220 gcacgttcaatacgatgtttcgcctgatgatcaaacggacaggtcgccgggtccagggta 2280 tgcagacgacgcatggcatccgccataatgctcactttttctgccggcgccagatggcta 2340 gacaggagatcctgacccggcacttcgcccaggaggagccaatcacggcccgcttcggtc 2400 accacatccagcaccgccgcacacggaacaccggtggtggccagccagctcagacgcgcc 2460 gcttcatcctgcagctcgttcagcgcaccgctcagatcggttttcacaaacagcaccgga 2520 cgaccctgcgcgctcagacgaaacaccgccgcatcagagcagccaatggtctgctgcgcc 2580 caatcatagccaaacagacgttccacccacgctgccgggctacccgcatgcaggccatcc 2640 tgttcaatcatactcttcctttttcaatattattgaagcatttatcagggttattgtctc 2700 atgagcggatacatatttgaatgtatttagaaaaataaacaaataggggttccgcgcaca 2760 tttccccgaaaagtgccac 2779 SEQIDNO:38 cgataaccctaattcgatagcatatgcttcccgttgggtaacatatgctattgaattagg 60 (Finalvector gttagtctggatagtatatactactacccgggaagcatatgctacccgtttagggttcac 120 usedfor cggtgatgccggccacgatgcgtccggcgtagaggatctaatgtgagttagctcactcat 180 lentiviral taggcaccccaggctttacactttatgcttccggctcgtatgttgtgtggaattgtgagc 240 production, ggataacaatttcacacaggaaacagctatgaccatgattacgccaagcgcgcaattaac 300 pLV4301G8B3 cctcactaaagggaacaaaagctggagctgcaagcttaatgtagtcttatgcaatactct 360 scFVmIgGhCD8 tgtagtcttgcaacatggtaacgatgagttagcaacatgccttacaaggagagaaaaagc 420 flag) accgtgcatgccgattggtggaagtaaggtggtacgatcgtgccttattaggaaggcaac 480 agacgggtctgacatggattggacgaaccactgaattgccgcattgcagagatattgtat 540 ttaagtgcctagctcgatacataaacgggtctctctggttagaccagatctgagcctggg 600 agctctctggctaactagggaacccactgcttaagcctcaataaagcttgccttgagtgc 660 ttcaagtagtgtgtgcccgtctgttgtgtgactctggtaactagagatccctcagaccct 720 tttagtcagtgtggaaaatctctagcagtggcgcccgaacagggacttgaaagcgaaagg 780 gaaaccagaggagctctctcgacgcaggactcggcttgctgaagcgcgcacggcaagagg 840 cgaggggcggcgactggtgagtacgccaaaaattttgactagcggaggctagaaggagag 900 agatgggtgcgagagcgtcagtattaagcgggggagaattagatcgcgatgggaaaaaat 960 tcggttaaggccagggggaaagaaaaaatataaattaaaacatatagtatgggcaagcag 1020 ggagctagaacgattcgcagttaatcctggcctgttagaaacatcagaaggctgtagaca 1080 aatactgggacagctacaaccatcccttcagacaggatcagaagaacttagatcattata 1140 taatacagtagcaaccctctattgtgtgcatcaaaggatagagataaaagacaccaagga 1200 agctttagacaagatagaggaagagcaaaacaaaagtaagaccaccgcacagcaagcggc 1260 cgctgatcttcagacctggaggaggagatatgagggacaattggagaagtgaattatata 1320 aatataaagtagtaaaaattgaaccattaggagtagcacccaccaaggcaaagagaagag 1380 tggtgcagagagaaaaaagagcagtgggaataggagctttgttccttgggttcttgggag 1440 cagcaggaagcactatgggcgcagcgtcaatgacgctgacggtacaggccagacaattat 1500 tgtctggtatagtgcagcagcagaacaatttgctgagggctattgaggcgcaacagcatc 1560 tgttgcaactcacagtctggggcatcaagcagctccaggcaagaatcctggctgtggaaa 1620 gatacctaaaggatcaacagctcctggggatttggggttgctctggaaaactcatttgca 1680 ccactgctgtgccttggaatgctagttggagtaataaatctctggaacagatttggaatc 1740 acacgacctggatggagtgggacagagaaattaacaattacacaagcttaatacactcct 1800 taattgaagaatcgcaaaaccagcaagaaaagaatgaacaagaattattggaattagata 1860 aatgggcaagtttgtggaattggtttaacataacaaattggctgtggtatataaaattat 1920 tcataatgatagtaggaggcttggtaggtttaagaatagtttttgctgtactttctatag 1980 tgaatagagttaggcagggatattcaccattatcgtttcagacccacctcccaaccccga 2040 ggggacccgacaggcccgaaggaatagaagaagaaggtggagagagagacagagacagat 2100 ccattcgattagtgaacggatctcgacggtatcggttttaaaagaaaaggggggattggg 2160 gggtacagtgcaggggaaagaatagtagacataatagcaacagacatacaaactaaagaa 2220 ttacaaaaacaaattacaaaaattcaaaattttatcgattttatttagtctccagaaaaa 2280 ggggggaatgaaagaccccacctgtaggtttggcaagctagcttaagtaacgccattttg 2340 caaggcatggaaaatacataactgagaatagagaagttcagatcaaggttaggaacagag 2400 agacaggagaatatgggccaaacaggatatctgtggtaagcagttcctgccccggctcag 2460 ggccaagaacagatggtccccagatgcggtcccgccctcagcagtttctagagaaccatc 2520 agatgtttccagggtgccccaaggacctgaaatgaccctgtgccttatttgaactaacca 2580 atcagttcgcttctcgcttctgttcgcgcgcttctgctccccgagctcaataaaagagcc 2640 cacaacccctcactcggcgcgccagtcctccgatagactgcgtcgcccgggtaccgatat 2700 caccaactttgtacaaaaaagctgaacgatatcgccaccatgggcagcacagccattctg 2760 gccctgctgctggcagtgctgcagggcgtgtcagctcaggtgcagctgcagcagtctggc 2820 gccgaagtgaagaaacccggcagcagcgtgaaggtgtcctgcaaggctagcggcggcacc 2880 ttcaggagctacgccatttcttgggtgcgccaggcccctggacagggcctggaatggatg 2940 ggctggatcagcccctacaacggcaacaccgactacgcccagaaagtgcagggcagagtg 3000 accctgaccaccgacaccagcacctccaccgcctacatggaactgcggagcctgagaagc 3060 gacgacaccgccgtgtactactgtgccacaggcggcggaacctggtacagcgatctgtgg 3120 ggcagaggcaccctcgtgacagtgtctgctggcggcggaggatctggcggaggcggaagt 3180 ggcgggggaggaagcggagcacctgagatcgtgctgacccagagccctagcacactgagc 3240 gccagcgtgggcgacagagtgtccatcacctgtagagccagccagagcatcggaggcagc 3300 ctggcctggtatcagcagaagcctggcaaggcccccaagctgctgatctctgaggccagc 3360 accctggaaagaggcgtgcccagcagattttccggcagcggctctggcaccgacttcacc 3420 ctgacaatcagcagcctgcagcccgaggacgtggccacctactactgccagaagtacaac 3480 agcgtgcccctgaccttcggccctggcaccaaggtggaaatcaagccgcgggccaacttt 3540 gtatacaaaagtggcccgcggacaacaacccctgcccccagacctcctaccccagcccct 3600 acaattgccagccagcctctgagcctgaggcccgaggcttgtagacctgctgctggcgga 3660 gccgtgcacaccagaggactggatttcgcctgcgacatctacatctgggcccctctggcc 3720 ggcacatgtggcgtgctgctgctgagcctcgtgatcaccctgtactgcggctccaccagc 3780 ggctccggcaagcccggctctggcgagggctccaccagcggcgactacaaggacgacgat 3840 gacaagtaataggatatcggttcagctttcttgtacaaagttgggattcgagttaattaa 3900 gttaacgaattccccccctctccctcccccccccctaacgttactggccgaagccgcttg 3960 gaataaggccggtgtgcgtttgtctatatgttattttccaccatattgccgtcttttggc 4020 aatgtgagggcccggaaacctggccctgtcttcttgacgagcattcctaggggtctttcc 4080 cctctcgccaaaggaatgcaaggtctgttgaatgtcgtgaaggaagcagttcctctggaa 4140 gcttcttgaagacaaacaacgtctgtagcgaccctttgcaggcagcggaaccccccacct 4200 ggcgacaggtgcctctgcggccaaaagccacgtgtataagatacacctgcaaaggcggca 4260 caaccccagtgccacgttgtgagttggatagttgtggaaagagtcaaatggctctcctca 4320 agcgtattcaacaaggggctgaaggatgcccagaaggtaccccattgtatgggatctgat 4380 ctggggcctcggtgcacatgctttacatgtgtttagtcgaggttaaaaaacgtctaggcc 4440 ccccgaaccacggggacgtggttttcctttgaaaaacacgatgataatatggccacaacc 4500 atgggaggcggaagcggcggaggctcccctcgaggcaccatggtgagcaagggcgaggag 4560 ctgttcaccggggtggtgcccatcctggtcgagctggacggcgacgtaaacggccacaag 4620 ttcagcgtgtccggcgagggcgagggcgatgccacctacggcaagctgaccctgaagttc 4680 atctgcaccaccggcaagctgcccgtgccctggcccaccctcgtgaccaccctgacctac 4740 ggcgtgcagtgcttcagccgctaccccgaccacatgaagcagcacgacttcttcaagtcc 4800 gccatgcccgaaggctacgtccaggagcgcaccatcttcttcaaggacgacggcaactac 4860 aagacccgcgccgaggtgaagttcgagggcgacaccctggtgaaccgcatcgagctgaag 4920 ggcatcgacttcaaggaggacggcaacatcctggggcacaagctggagtacaactacaac 4980 agccacaacgtctatatcatggccgacaagcagaagaacggcatcaaggtgaacttcaag 5040 atccgccacaacatcgaggacggcagcgtgcagctcgccgaccactaccagcagaacacc 5100 cccatcggcgacggccccgtgctgctgcccgacaaccactacctgagcacccagtccgcc 5160 ctgagcaaagaccccaacgagaagcgcgatcacatggtcctgctggagttcgtgaccgcc 5220 gccgggatcactctcggcatggacgagctgtacaagtaacgcgtcccgggtctagagcta 5280 gcggtaccatgcattacgtagtcgacgacttaattaagctagcctagtgccatttgttca 5340 gtggttcgtagggctttcccccactgtttggctttcagttatatggatgatgtggtattg 5400 ggggccaagtctgtacagcatcttgagtccctttttaccgctgttaccaattttcttttg 5460 tctttgggtatacatttaaaccctaacaaaacaaagagatggggttactctctaaatttt 5520 atgggttatgtcattggatgttatgggtccttgccacaagaacacatcatacaaaaaatc 5580 aaagaatgttttagaaaacttcctattaacaggcctattgattggaaagtatgtcaacga 5640 attgtgggtcttttgggttttgctgccccttttacacaatgtggttatcctgcgttgatg 5700 cctttgtatgcatgtattcaatctaagcaggctttcactttctcgccaacttacaaggcc 5760 tttctgtgtaaacaatacctgaacctttaccccgttgcccggcaacggccaggtctgtgc 5820 caagtgtttgctgacgcaacccccactggctggggcttggtcatgggccatcagcgcatg 5880 cgtggaaccttttcggctcctctgccgatccatactgcggaactcctagccgcttgtttt 5940 gctcgcagcaggtctggagcaaacattatcgggactgataactctgttgtcctatcccgc 6000 aaatatacatcgtttccatggctgctaggctgtgctgccaactggatcctgcgcgggacg 6060 tcctttgtttacgtcccgtcggcgctgaatcctgcggacgacccttctcggggtcgcttg 6120 ggactctctcgtccccttctccgtctgccgttccgaccgaccacggggcgcacctctctt 6180 tacgcggactccccgtctgtgccttctcatctgccggaccgtgtgcacttcgcttcacct 6240 ctgcacgtcgcatggagaccaccgtgaacgcccaccaaatattgcccaaggtcttacata 6300 agaggactcttggactctcagcaatgtcaacgaccgaccttgaggcatacttcaaagact 6360 gtttgtttaaagactgggaggagttgggggaggagattaggttaaaggtctttgtactag 6420 gaggctgtaggcataaattggtctgcgcaccagcaccatggcgcaatcactagagcgggg 6480 tacctttaagaccaatgacttacaaggcagctgtagatcttagccactttttaaaagaaa 6540 aggggggactggaagggctaattcactcccaacgaagacaagatctgctttttgcttgta 6600 ctgggtctctctggttagaccagatctgagcctgggagctctctggctaactagggaacc 6660 cactgcttaagcctcaataaagcttgccttgagtgcttcaagtagtgtgtgcccgtctgt 6720 tgtgtgactctggtaactagagatccctcagacccttttagtcagtgtggaaaatctcta 6780 gcagtagtagttcatgtcatcttattattcagtatttataacttgcaaagaaatgaatat 6840 cagagagtgagaggaacttgtttattgcagcttataatggttacaaataaagcaatagca 6900 tcacaaatttcacaaataaagcatttttttcactgcattctagttgtggtttgtccaaac 6960 tcatcaatgtatcttatcatgtctggctctagctatcccgcccctaactccgcccatccc 7020 gcccctaactccgcccagttccgcccattctccgccccatggctgactaattttttttat 7080 ttatgcagaggccgaggccggatcccttgagtggctttcatcctggagcagactttgcag 7140 tctgtggactgcaacacaacattgcctttatgtgtaactcttggctgaagctcttacacc 7200 aatgctgggggacatgtacctcccaggggcccaggaagactacgggaggctacaccaacg 7260 tcaatcagaggggcctgtgtagctaccgataagcggaccctcaagagggcattagcaata 7320 gtgtttataaggcccccttgttaattcttgaagacgaaagggcctcgtgatacgcctatt 7380 tttataggttaatgtcatgataataatggtttcttagacgtcaggtggcacttttcgggg 7440 aaatgtgcgcggaacccctatttgtttatttttctaaatacattcaaatatgtatccgct 7500 catgagacaataaccctgataaatgcttcaataatattgaaaaaggaagagtatgagtat 7560 tcaacatttccgtgtcgcccttattcccttttttgcggcattttgccttcctgtttttgc 7620 tcacccagaaacgctggtgaaagtaaaagatgctgaagatcagttgggtgcacgagtggg 7680 ttacatcgaactggatctcaacagcggtaagatccttgagagttttcgccccgaagaacg 7740 ttttccaatgatgagcacttttaaagttctgctatgtggcgcggtattatcccgtgttga 7800 cgccgggcaagagcaactcggtcgccgcatacactattctcagaatgacttggttgagta 7860 ctcaccagtcacagaaaagcatcttacggatggcatgacagtaagagaattatgcagtgc 7920 tgccataaccatgagtgataacactgcggccaacttacttctgacaacgatcggaggacc 7980 gaaggagctaaccgcttttttgcacaacatgggggatcatgtaactcgccttgatcgttg 8040 ggaaccggagctgaatgaagccataccaaacgacgagcgtgacaccacgatgcctgcagc 8100 aatggcaacaacgttgcgcaaactattaactggcgaactacttactctagcttcccggca 8160 acaattaatagactggatggaggcggataaagttgcaggaccacttctgcgctcggccct 8220 tccggctggctggtttattgctgataaatctggagccggtgagcgtgggtctcgcggtat 8280 cattgcagcactggggccagatggtaagccctcccgtatcgtagttatctacacgacggg 8340 gagtcaggcaactatggatgaacgaaatagacagatcgctgagataggtgcctcactgat 8400 taagcattggtaactgtcagaccaagtttactcatatatactttagattgatttaaaact 8460 tcatttttaatttaaaaggatctaggtgaagatcctttttgataatctcatgaccaaaat 8520 cccttaacgtgagttttcgttccactgagcgtcagaccccgtagaaaagatcaaaggatc 8580 ttcttgagatcctttttttctgcgcgtaatctgctgcttgcaaacaaaaaaaccaccgct 8640 accagcggtggtttgtttgccggatcaagagctaccaactctttttccgaaggtaactgg 8700 cttcaggagagcgcagataccaaatactgtccttctagtgtagccgtagttaggccacca 8760 cttcaagaactctgtagcaccgcctacatacctcgctctgctaatcctgttaccagtggc 8820 tgctgccagtggcgataagtcgtgtcttaccgggttggactcaagacgatagttaccgga 8880 taaggcgcagcggtcgggctgaacggggggttcgtgcacacagcccagcttggagcgaac 8940 gacctacaccgaactgagatacctacagcgtgagcattgagaaagcgccacgcttcccga 9000 agggagaaaggcggacaggtatccggtaagcggcagggtcggaacaggagagcgcacgag 9060 ggagcttccagggggaaacgcctggtatctttatagtcctgtcgggtttcgccacctctg 9120 acttgagcgtcgatttttgtgatgctcgtcaggggggcggagcctatggaaaaacgccag 9180 caacgcggcctttttacggttcctggccttttgctggcctttttgaagctgtccctgatg 9240 gtcgtcatctacctgcctggacagcatggcctgcaacgcgggcatcccgatgccgccgga 9300 agcgagaagaatcataatggggaaggccatccagcctcgcgtcg 9344 SEQIDNO:39 gtcgacggatcgggagatctcccgatcccctatggtgcactctcagtacaatctgctctg 60 (pLenti-C-Myc- atgccgcatagttaagccagtatctgctccctgcttgtgtgttggaggtcgctgagtagt 120 DDKOX40L) gcgcgagcaaaatttaagctacaacaaggcaaggcttgaccgacaattgcatgaagaatc 180 tgcttagggttaggcgttttgcgctgcttcgcgatgtacgggccagatatcgcgttgaca 240 ttgattattgactagttattaatagtaatcaattacggggtcattagttcatagcccata 300 tatggagttccgcgttacataacttacggtaaatggcccgcctggctgaccgcccaacga 360 cccccgcccattgacgtcaataatgacgtatgttcccatagtaacgccaatagggacttt 420 ccattgacgtcaatgggtggagtatttacggtaaactgcccacttggcagtacatcaagt 480 gtatcatatgccaagtacgccccctattgacgtcaatgacggtaaatggcccgcctggca 540 ttatgcccagtacatgaccttatgggactttcctacttggcagtacatctacgtattagt 600 catcgctattaccatggtgatgcggttttggcagtacatcaatgggcgtggatagcggtt 660 tgactcacggggatttccaagtctccaccccattgacgtcaatgggagtttgttttggca 720 ccaaaatcaacgggactttccaaaatgtcgtaacaactccgccccattgacgcaaatggg 780 cggtaggcgtgtacggtgggaggtctatataagcagcgcgttttgcctgtactgggtctc 840 tctggttagaccagatctgagcctgggagctctctggctaactagggaacccactgctta 900 agcctcaataaagcttgccttgagtgcttcaagtagtgtgtgcccgtctgttgtgtgact 960 ctggtaactagagatccctcagacccttttagtcagtgtggaaaatctctagcagtggcg 1020 cccgaacagggacttgaaagcgaaagggaaaccagaggagctctctcgacgcaggactcg 1080 gcttgctgaagcgcgcacggcaagaggcgaggggcggcgactggtgagtacgccaaaaat 1140 tttgactagcggaggctagaaggagagagatgggtgcgagagcgtcagtattaagcgggg 1200 gagaattagatcgcgatgggaaaaaattcggttaaggccagggggaaagaaaaaatataa 1260 attaaaacatatagtatgggcaagcagggagctagaacgattcgcagttaatcctggcct 1320 gttagaaacatcagaaggctgtagacaaatactgggacagctacaaccatcccttcagac 1380 aggatcagaagaacttagatcattatataatacagtagcaaccctctattgtgtgcatca 1440 aaggatagagataaaagacaccaaggaagctttagacaagatagaggaagagcaaaacaa 1500 aagtaagaccaccgcacagcaagcggccggccgctgatcttcagacctggaggaggagat 1560 atgagggacaattggagaagtgaattatataaatataaagtagtaaaaattgaaccatta 1620 ggagtagcacccaccaaggcaaagagaagagtggtgcagagagaaaaaagagcagtggga 1680 ataggagctttgttccttgggttcttgggagcagcaggaagcactatgggcgcagcgtca 1740 atgacgctgacggtacaggccagacaattattgtctggtatagtgcagcagcagaacaat 1800 ttgctgagggctattgaggcgcaacagcatctgttgcaactcacagtctggggcatcaag 1860 cagctccaggcaagaatcctggctgtggaaagatacctaaaggatcaacagctcctgggg 1920 atttggggttgctctggaaaactcatttgcaccactgctgtgccttggaatgctagttgg 1980 agtaataaatctctggaacagatttggaatcacacgacctggatggagtgggacagagaa 2040 attaacaattacacaagcttaatacactccttaattgaagaatcgcaaaaccagcaagaa 2100 aagaatgaacaagaattattggaattagataaatgggcaagtttgtggaattggtttaac 2160 ataacaaattggctgtggtatataaaattattcataatgatagtaggaggcttggtaggt 2220 ttaagaatagtttttgctgtactttctatagtgaatagagttaggcagggatattcacca 2280 ttatcgtttcagacccacctcccaaccccgaggggacccgacaggcccgaaggaatagaa 2340 gaagaaggtggagagagagacagagacagatccattcgattagtgaacggatcggcactg 2400 cgtgcgccaattctgcagacaaatggcagtattcatccacaattttaaaagaaaaggggg 2460 gattggggggtacagtgcaggggaaagaatagtagacataatagcaacagacatacaaac 2520 taaagaattacaaaaacaaattacaaaaattcaaaattttcgggtttattacagggacag 2580 cagagatccagtttggttagtaccgggcccgctctagacatgtccaatatgaccgccatg 2640 ttgacattgattattgactagttattaatagtaatcaattacggggtcattagttcatag 2700 cccatatatggagttccgcgttacataacttacggtaaatggcccgcctggctgaccgcc 2760 caacgacccccgcccattgacgtcaataatgacgtatgttcccatagtaacgccaatagg 2820 gactttccattgacgtcaatgggtggagtatttacggtaaactgcccacttggcagtaca 2880 tcaagtgtatcatatgccaagtccgccccctattgacgtcaatgacggtaaatggcccgc 2940 ctggcattatgcccagtacatgaccttacgggactttcctacttggcagtacatctacgt 3000 attagtcatcgctattaccatggtgatgcggttttggcagtacaccaatgggcgtggata 3060 gcggtttgactcacggggatttccaagtctccaccccattgacgtcaatgggagtttgtt 3120 ttggcaccaaaatcaacgggactttccaaaatgtcgtaataaccccgccccgttgacgca 3180 aatgggcggtaggcgtgtacggtgggaggtctatataagcagagctcgtttagtgaaccg 3240 tcagaattttgtaatacgactcactatagggcggccgggaattcgtcgactggatccggt 3300 accgaggagatctgccgccgcgatcgccatggaaagggtccaacccctggaagagaatgt 3360 gggaaatgcagccaggccaagattcgagaggaacaagctattgctggtggcctctgtaat 3420 tcagggactggggctgctcctgtgcttcacctacatctgcctgcacttctctgctcttca 3480 ggtatcacatcggtatcctcgaattcaaagtatcaaagtacaatttaccgaatataagaa 3540 ggagaaaggtttcatcctcacttcccaaaaggaggatgaaatcatgaaggtgcagaacaa 3600 ctcagtcatcatcaactgtgatgggttttatctcatctccctgaagggctacttctccca 3660 ggaagtcaacattagccttcattaccagaaggatgaggagcccctcttccaactgaagaa 3720 ggtcaggtctgtcaactccttgatggtggcctctctgacttacaaagacaaagtctactt 3780 gaatgtgaccactgacaatacctccctggatgacttccatgtgaatggcggagaactgat 3840 tcttatccatcaaaatcctggtgaattctgtgtccttacgcgtacgcggccgctcgagca 3900 gaaactcatctcagaagaggatctggcagcaaatgatatcctggattacaaggatgacga 3960 cgataaggtttaaacggccggccgcggtctgtacaagtaggattcgtcgagggacctaat 4020 aacttcgtatagcatacattatacgaagttatacatgtttaagggttccggttccactag 4080 gtacaattcgatatcaagcttatcgataatcaacctctggattacaaaatttgtgaaaga 4140 ttgactggtattcttaactatgttgctccttttacgctatgtggatacgctgctttaatg 4200 cctttgtatcatgctattgcttcccgtatggctttcattttctcctccttgtataaatcc 4260 tggttgctgtctctttatgaggagttgtggcccgttgtcaggcaacgtggcgtggtgtgc 4320 actgtgtttgctgacgcaacccccactggttggggcattgccaccacctgtcagctcctt 4380 tccgggactttcgctttccccctccctattgccacggcggaactcatcgccgcctgcctt 4440 gcccgctgctggacaggggctcggctgttgggcactgacaattccgtggtgttgtcgggg 4500 aaatcatcgtcctttccttggctgctcgcctgtgttgccacctggattctgcgcgggacg 4560 tccttctgctacgtcccttcggccctcaatccagcggaccttccttcccgcggcctgctg 4620 ccggctctgcggcctcttccgcgtcttcgccttcgccctcagacgagtcggatctccctt 4680 tgggccgcctccccgcatcgataccgtcgacctcgatcgagacctagaaaaacatggagc 4740 aatcacaagtagcaatacagcagctaccaatgctgattgtgcctggctagaagcacaaga 4800 ggaggaggaggtgggttttccagtcacacctcaggtacctttaagaccaatgacttacaa 4860 ggcagctgtagatcttagccactttttaaaagaaaaggggggactggaagggctaattca 4920 ctcccaacgaagacaagatatccttgatctgtggatctaccacacacaaggctacttccc 4980 tgattggcagaactacacaccagggccagggatcagatatccactgacctttggatggtg 5040 ctacaagctagtaccagttgagcaagagaaggtagaagaagccaatgaaggagagaacac 5100 ccgcttgttacaccctgtgagcctgcatgggatggatgacccggagagagaagtattaga 5160 gtggaggtttgacagccgcctagcatttcatcacatggcccgagagctgcatccggactg 5220 tactgggtctctctggttagaccagatctgagcctgggagctctctggctaactagggaa 5280 cccactgcttaagcctcaataaagcttgccttgagtgcttcaagtagtgtgtgcccgtct 5340 gttgtgtgactctggtaactagagatccctcagacccttttagtcagtgtggaaaatctc 5400 tagcagcatgtgagcaaaaggccagcaaaaggccaggaaccgtaaaaaggccgcgttgct 5460 ggcgtttttccataggctccgcccccctgacgagcatcacaaaaatcgacgctcaagtca 5520 gaggtggcgaaacccgacaggactataaagataccaggcgtttccccctggaagctccct 5580 cgtgcgctctcctgttccgaccctgccgcttaccggatacctgtccgcctttctcccttc 5640 gggaagcgtggcgctttctcatagctcacgctgtaggtatctcagttcggtgtaggtcgt 5700 tcgctccaagctgggctgtgtgcacgaaccccccgttcagcccgaccgctgcgccttatc 5760 cggtaactatcgtcttgagtccaacccggtaagacacgacttatcgccactggcagcagc 5820 cactggtaacaggattagcagagcgaggtatgtaggcggtgctacagagttcttgaagtg 5880 gtggcctaactacggctacactagaagaacagtatttggtatctgcgctctgctgaagcc 5940 agttaccttcggaaaaagagttggtagctcttgatccggcaaacaaaccaccgctggtag 6000 cggtggtttttttgtttgcaagcagcagattacgcgcagaaaaaaaggatctcaagaaga 6060 tcctttgatcttttctacggggtctgacgctcagtggaacgaaaactcacgttaagggat 6120 tttggtcatgattacgccccgccctgccactcatcgcagtactgttgtaattcattaagc 6180 attctgccgacatggaagccatcacaaacggcatgatgaacctgaatcgccagcggcatc 6240 agcaccttgtcgccttgcgtataatatttgcccatggtgaaaacgggggcgaagaagttg 6300 tccatattggccacgtttaaatcaaaactggtgaaactcacccagggattggctgagacg 6360 aaaaacatattctcaataaaccctttagggaaataggccaggttttcaccgtaacacgcc 6420 acatcttgcgaatatatgtgtagaaactgccggaaatcgtcgtggtattcactccagagc 6480 gatgaaaacgtttcagtttgctcatggaaaacggtgtaacaagggtgaacactatcccat 6540 atcaccagctcaccgtctttcattgccatacggaactccggatgagcattcatcaggcgg 6600 gcaagaatgtgaataaaggccggataaaacttgtgcttatttttctttacggtctttaaa 6660 aaggccgtaatatccagctgaacggtctggttataggtacattgagcaactgactgaaat 6720 gcctcaaaatgttctttacgatgccattgggatatatcaacggtggtatatccagtgatt 6780 tttttctccatactcttcctttttcaatattattgaagcatttatcagggttattgtctc 6840 atgagcggatacatatttgaatgtatttagaaaaataaacaaataggggtcccgcgcaca 6900 tttccccgaaaagtgccacctgac 6924
[0610] In the preparations of engineered EM-3 aAPCs (also referred to herein as aEM3 aAPCs) used for the experiments described herein, expression of CD86 and 4-1BBL was confirmed using flow cytometry (Canto II flow cytometer, Becton, Dickinson, and Co., Franklin Lakes, N.J., USA), with results shown in
[0611] aEM-3 cells previously transduced to express CD86, antibody against IgG Fc region, and 4-1BBL (or optionally without 4-1BBL), as described above, were genetically engineered with a co-stimulatory human OX-40L using a similar lentiviral transduction approach. To generate lentivirus containing human OX-40L, pLenti-C-Myc-DDK OX40L (PS100064, Origene, SEQ ID NO:39,
Example 6
Expansion of Tumor Infiltrating Lymphocytes Using EM-3 Artificial Antigen Presenting Cells
[0612] Experiments were performed to test the ability of EM-3 aAPCs (aEM3) to expand TILs. TIL were co-cultured with aEM3 (7C12 or 8B3) at a ratio of 1:100 ratio plus OKT-3 (30 mg/mL) and IL-2 (3000 IU/mL). Cells were counted on Day 11 and 14. The results are plotted for two batches of TILs in
[0613]
[0614]
[0615] TILs expanded against aEM3 or PBMC feeders were used for flow cytometry analysis using 4 different panels (differentiation panels 1 and 2, T cell activation panels 1 and 2). Briefly, TILs were first stained with L/D Aqua to determine viability. Next, cells were surface stained with TCR ?/? PE-Cy7, CD4 FITC, CD8 PB, CD56 APC, CD28 PE, CD27 APC-Cy7, and CD57-PerCP-Cy5.5 for differentiation panel 1; CD45RA PE-Cy7, CD8a PerCP/Cy5, CCR7 PE, CD4 FITC, CD3 APC-Cy7, CD38 APC, and HLA-DR PB, for differentiation panel 2; CD137 PE-Cy7, CD8a PerCP-Cy5.5, Lag3 PE, CD4 FITC, CD3 APC-Cy7, PD1 APC, and Tim-3 BV421 for T cell activation panel 1; or CD69 PE-Cy7, CD8a PerCP/Cy5.5, TIGIT PE, CD4 FITC, CD3 APC-Cy7, KLRG1 ALEXA 647, and CD154 BV421 for T cell activation panel 2. Phenotype analysis was done by gating 10,000 to 100,000 cells according to FSC/SSC using the Canto II flow cytometer. Data was analyzed using Cytobank software (Cytobank, Inc., Santa Clara, Calif., USA) to create sunburst diagrams and SPADE (Spanning-tree Progression Analysis of Density-normalized Events) plots. Gates were set based on fluorescence minus one (FMO) controls. SPADE plots were generated with the group of cells, characterized in a form of related nodes based on the expression level of surface markers. CD4.sup.+ and CD8.sup.+ TIL subsets were determined based on CD3.sup.? gating, and trees were generated. Sunburst visualizations are shown in
[0616] The CD4 and CD8 SPADE tree of TILs expanded with aEM3 aAPCs or PBMC feeders using CD3.sup.+ cells is shown in
[0617] Spare respiratory capacity (SRC) and glycolytic reserve were also evaluated for TILs expanded with aEM3 aAPCs in comparison to PBMC feeders, with results shown in
[0618]
Example 7
Comparison of Engineered MOLM-14 (aMOLM14) and EM-3 (aEM3) aAPCs
[0619] TILs expanded with PBMC feeders and aMOLM14 and aEM3 aAPCs, as described in the previous examples, were assessed for functional activity using the BRLA for cytotoxic potency. The P815 BRLA is described in detail in Example 9. The results are shown in
[0620] IFN-? release and Granzyme B release from TILs expanded with PBMC feeders and aMOLM14 and aEM3 aAPCs as described above was also assessed following overnight stimulation with microbeads coated with anti-CD3/CD28/4-1BB. The IFN-? release results are shown in
[0621] The results of TIL expansions with aEM3 and aMOLM14 aAPCs are summarized in Table 9.
TABLE-US-00009 TABLE 9 Summary of TIL expansion results with aAPCs. Fold Expansion Relative CD8 (%) CD4 (%) Relative Relative aAPC TIL# PBMC aAPC expansion PBMC aAPC PBMC aAPC CD8 CD4 aMOLM14 M1032-T2 2112 1936 0.92 53 65 44 27 1.226 0.614 M1033-T6 1761 1598 0.91 50 57 36 40 1.140 1.111 M1021T-5 2053 2024 0.99 91 82 8 17 0.901 2.125 M1030T-4 860 853 0.99 46 78 51 12 1.696 0.235 M1045 858* 758* 0.88 M1021T-1 1866 1620 0.87 M1032T-1 2423 2049 0.85 M1042 1278 1704 1.33 8 8 88 89 0.919 1.015 M1043 1601 1587 0.99 90 87 5 5 0.968 0.947 aEM3 M1054 2058 1647 0.80 98 96 2 2 0.981 1.400 M1055 729 1533 2.10 25 66 70 31 2.694 0.441 M1021T-1 2985 2805 0.94 87 75 10 20 0.862 2.000 M1045 1336 1047 0.78
Example 8
Preparation of Master Cell Banks for aEM3 and aMOLM14 aAPCs
[0622] aEM3 and aMOLM14 aAPCs may be grown in the following media compositions to produce master cell banks, which may be further grown in this media for supply of aAPCs: 500 mL of Dulbecco's Modified Eagle Medium DMEM/F12 (Sigma-Aldrich, St. Louis, Miss., USA), 50 mL fetal bovine serum (FBS) Heat Inactivated (HI) (Hyclone); 10 mM 4-(2-hydroxyethyl)-1-piperazineethanesulfonic acid (HEPES buffer) (Life Technologies); 1X Primocin (Invivogen); 1X Plasmocin (Invivogen), and 1X 2-mercaptoethanol (Life Technologies).
[0623] The aAPCs described herein, including aEM3 and aMOLM14 aAPCs, may also be grown from a master cell bank using any suitable method known in the art for the growth of cells. In an embodiment, aAPCs are thawed and are then expanded in a medium of 80-90% RPMI 1640+10-20% h.i. FBS (fetal bovine serum) by splitting saturated culture 1:2 to 1:3 every 2-3 days, seeding out at about 0.5-1?10.sup.6 cells/mL in 24-well plates, and maintaining at about 0.5-1.5?10.sup.6 cells/mL, with incubation at 37? C. and 5% CO.sub.2.
[0624] Further steps that may be employed to use the aAPCs of certain embodiments of the present invention in the production of human therapies are known in the art and include cell line characterization (HLA high resolution typing); cytokine release testing; testing of human serum to replace FBS to grow aAPC; testing freezing media to freeze aAPCs; master cell banking (including raw material testing and stability testing); standardization of irradiation (including irradiation dose (1000, 3000, 5000, 10000, 15000 rad), fresh versus frozen aAPCs, and with/without TILs); stability of aAPC; development of a panel to evaluate the contamination of aAPCs; development of molecular biology assays (qPCR, DNA sequencing); testing of TIL expansions from different tumor types, including melanoma, cervical, and head and neck cancer (using a G-Rex 5M); potency, purity, and identity testing; mycoplasma and sterility assays; microbiological testing (USP/EP sterility, bioburden and endotoxin assays); and adventitious viral agent testing.
Example 9
Methods of Expanding TILs and Treating Cancer with Expanded TILs
[0625] TILs may be expanded using the aAPCs of certain embodiments of the present invention, such as aEM3 and aMOLM14 aAPCs, using any of the expansion methods described herein. For example, a method for expanding TILs is depicted in
Example 10
P815 Bioluminescent Redirected Lysis Assay
[0626] In this example, the development of a surrogate target cell line to evaluate the lytic potential of TILs in a Bioluminescent Redirected Lysis Assay (BRLA) is described. The BRLA enables assessment of T cell mediated killing in the absence of autologous tumor cells. Cytolytic activity can be assessed with and without engaging the T cell receptor in one to four hours, assessing T cell killing engaging the T cell receptor and without so-called lymphokine activated killer activities (LAK).
[0627] Mouse mastocytoma P815 cells expressing the endogenous CD16 Fc receptor can bind anti-CD3? (OKT-3), providing a potent TCR activation signal as a target cell line. The P815 Clone G6 was transduced with a lentiviral vector based on eGFP and firefly luciferase, sorted and cloned using the BD FACSAria II. Clone G6 was selected based on eGFP intensity analyzed using an Intellicyt iQue Screener. Target cells and TILs of interest were co-cultured +/? OKT-3 to assess TCR activation (specific killing) or non-specific (lymphokine activated killing, LAK) respectively. Following 4 hours of incubation, firefly luciferin ((4S)-2-(6-hydroxy-1,3-benzothi azol-2-yl)-4,5-dihydrothiazole-4-carboxylic acid, commercially available from multiple sources) was added to the wells and incubated for 5 minutes. Bioluminescence intensity was read using a luminometer. Percent cytotoxicity and survival were calculated using the following formula: % Survival=(experimental survival?minimum)/(maximum signal?minimum signal)?100; % Cytotoxicity=100?(% Survival). Interferon gamma release in the media supernatant of co-cultured TILs was analyzed by ELISA, and LAMP1 (CD107a, clone eBioH4A3) expression on TILs was analyzed on a flow cytometer to evaluate the cytotoxic potency of TILs.
[0628] Results are shown in
[0629] The results were confirmed using a second TIL batch as shown in
[0630] Results were further confirmed using a third TIL batch.
[0631]
[0632]
[0633] In conclusion, the BRLA requires no radionuclides and is as efficient and sensitive as traditional cytotoxicity assays. Flow cytometric assessment of Lamp1 expression on TILs at individual time points demonstrates degranulation of cytotoxic T cells relative to the potency shown by BRLA. The BRLA demonstrates similar to better potency than standard chromium release assay. BRLA also enables evaluation of the potency of TIL lytic activity. Comparison of BRLA with chromium release assay shows the efficiency and reliability of BRLA. BRLA has a linear relationship with IFN? release by TILs. Release assay of IFN-?, TNF? and Granzyme B by ELISpot is consistent with the cytotoxic efficiency of the TILs evaluated by BRLA.
Example 11
Process for Weaning EM3 Cells from FBS to hAB Serum
[0634] In order to avoid reactivity, some cell lines may need to be weaned from one medium to another. Here, EM3 cells are weaned from FBS to hAB serum to avoid reactivity. As shown in
Example 12
Freezing Media Formulation Optimization
[0635] To cryobank EM3 cells cultured as described herein, methods were freezing media formulation were optimized. As shown in
Example 13
Growth of aEM3 Cells in GREX Flasks
[0636] aEM3 cells were cultured in gas permeable cell culture flasks (i.e., GREX flasks (Wilson Wolf Manufacturing)) and the effect on cell doubling time was observed over an 8 day time course. As shown in
Example 14
Flow Panel Analysis to Determine aEM3 Cell Purity
[0637] To determine the purity of cells cultured according to the processes described herein, a flow panel analysis was used to determine the purity of aEM3 aAPCs. The results of such analysis are described in
Example 15
aEM3 Feeder Cells as an Alternative to PBMC Feeders
[0638] As described herein, aEM3 cells may be used as an alternative for PBMC feeders, resulting in unexpectedly different properties for both TIL expansion process and the resulting TILs. To compare differences in cytokine expression, PBMCs and aEM3 cells were stimulated by treatment with OKT-3. As shown in
Example 16
Comparison Between Complete Media and Serum Free Media TIL Expansion
[0639] In order to optimize the TIL expansion protocols, several TIL expansion expirements were peformed as described herein, but with serum free media rather than complete media (CM1).
[0640] In one experiment, tissue fragments were cultured in a single well with CM1 or various serum free media with 300 IU/mL of IL-2. Cells were then counted on Day 11 before initiating REP. The various serum free media used included Prime CDM (Irvine), CTS Optimizer (ThermoFisher), and Xvivo-20 (Lonza). As shown in
[0641] Additionally, tissue fragments were cultured with CM1 or various serum free media with 6000 IU/mL of IL-2 until Day 11. REP was then initiated on Day 11 using PBMC feeders, OKT-3, and IL-2, and culture was split on Day 16. Cultures were then terminated at the end of Day 22. The various serum free media used included Prime CDM (Irvine), CTS Optimizer (ThermoFisher), and Xvivo-20 (Lonza). As shown in
Example 17
Growth of aAPCs in Serum Free Media as Compared to Serum-Based Media
[0642] In order to optimize aAPC growth and maintenance protocols in the absence of serum, aEM3 cells were cultured using various serum free media.
[0643] aEM3 cells were cultured in 24 well plates at 1?10.sup.6 cells per well for 3 days using general cell culture protocols as described herein, with the exception that that one group of cells were provided with serum-based media (cDMEM (10% hSerum) and the other groups of cells were provided with serum free media. The serum free media utilized for the study included CTS OpTmizer (ThermoFisher), Xvivo 20 (Lonza), Prime-TCDM (Irvine), and XFSM (MesenCult) media. Cells were then counted on Day 3.
[0644] As shown in
Example 18
Propagation, Maintenance, and Cryopreservation of aAPCs
[0645] In this example, procedures are provided for the preparation and preservation of aAPCs. Specifically, aEM3 cells from a cell line designated TIL-Rs3 were propagated and cryopreserved.
[0646] Thawing and recovery of aEM3 cells may be accomplished using the following non-limiting procedure. Cyropreserved aEM3 cells are warmed slowly in pre-warmed media (37? C.) that is prepared from CTS OpTmizer Basal Media (Thermo Fisher), CTS OpTmizer Cell Supplement (Thermo Fisher), Gentamicin (Lonza), and Glutamax (Life Technologies). The suspended cells are then centrifuged at 1500 rpm for 5 minutes at 4? C. The resulting supernatant is discarded and the remaining aEM3 cells are resuspended in the foregoing media and plated (5?10.sup.6 cells/10 mL per well of a 6 well plate).
[0647] Propagation of aEM3 cells may be accomplished using the following non-limiting procedure. Aliquots of the foregoing media are prepared in gas permeable cell culture flasks (i.e., GREX 10 flasks (Wilson Wolf Manufacturing)). The plated aEM3 cells are washed by centrifugation (i.e., 1500 rpm for 5 minutes at 4? C.), resuspended in media, and added to the GREX flasks at cell density of 1-2?10.sup.6 cells/mL. The aEM3 cell suspension was diluted with 30 mL of media and the GREX flasks were then incubated for 3-4 days at 37? C. under CO.sub.2. After 3-4 days, the GREX flasks were removed from the incubator and placed in a biological safety cabinet (BSC). The cultured aEM3 cells are carefully extracted from the GREX flasks by pipette and the resulting extraction is centrifuged to provide the increased number of aEM3 cells, which may be resuspended at a cell density of 10-20?10.sup.6 cells per GREX 10 flask.
[0648] An alternative cryopreservation of aEM3 cells may be accomplished using the following non-limiting procedure. The foregoing GREX 10 flasks containing the aEM3 cells are removed from the incubator and placed in a BSC. The cultured aEM3 cells are carefully extracted from the GREX flasks by pipette and the resulting extraction is centrifuged to provide the increased number of aEM3 cells, which is resuspended in a volume of CryStor 10 (Biolife Solutions) to provide a concentration of 10-100?10.sup.6 cells/vial in cryovials. The aEM3 cell suspensions may be placed in a freezing container and transferred to a ?80? C. freezer.
Example 19
Demonstration of Rapid Recovery of aEM3 Cells Following Cryopreservation
[0649] aEM3 cells from the TIL-R3 cell line (1-2?10.sup.6 cells) were cryopreserved according to the procedure set forth in Example 18 using CS-10 cryopreservation media. Vials of such cells were then thawed and the cells were counted. Cell counts were taken pre-freeze, post-thaw, and 3 days after thaw (i.e., Post-Thaw Recovery). As shown in
[0650] TIL-R3 cells (1?10.sup.6 cells) were thawed (Day 3 post-thaw) and plated at a density of 0.5?10.sup.6/cm.sup.2 in each well of a 24 well plate. On day 0 and 3, viable cells were counted and recorded. On the first passage (Day 6), cells were split at the density of 2?10.sup.6 cells/cm.sup.2 or 0.5?10.sup.6 cells/cm.sup.2. At the end of the first passage, a cell count was performed. The resulting cell counts are shown in
[0651] Furthermore, TIL-R3 cells (20?10.sup.6 cells) were cultured at a density of 2?10.sup.6/cm.sup.2 in GREX 10 flasks according to the procedure described in Example 18. On days 4 and 8, live cells were counted and recorded. The resulting cell counts are shown in
Example 20
CD8 Skewness, Expansion Performance, and CD3 Contamination of TILs Cultured with aEM3 aAPCs
[0652] Fifteen different PreREP TIL lines (0.4?10.sup.5 cells) were co-cultured with either aEM3 aAPCs (as described herein) or PBMC feeders (10?10.sup.6), OKT3 (30 ng/mL) and IL-2 (3000 IU/mL) and cultures were split on Day 5 using 6 well Grex plates. Cultures were sampled at day 11 and analyzed by flow cytometry. The relative ratio of CD8.sup.? cells was calculated by the formula (CD8% aEM3)/(CD8% PBMC). The results shown in
Example 21
Telomere Length Measurement
[0653] Genomic DNA was isolated from pre-REP or post-REP (magnetic bead sorted for CD3.sup.+) TILs for a qPCR (quantitative polymerase chain reaction) assay to measure telomere length. The real time qPCR method is described in Cawthon, Nucleic Acids Res. 2002, 30(10), e47; and Yang, et al., Leukemia, 2013, 27, 897-906. Briefly, the telomere repeat copy number to single gene copy number (T/S) ratio was determined using an PCR thermal cycler (Bio-Rad Laboratories, Inc.) in a 96-well format. Ten ng of genomic DNA was used for either the telomere or hemoglobin (hgb) PCR reaction and the primers used were as follows: [0654] Tel-1b primer (CGG TTT GTT TGG GTT TGG GTT TGG GTT TGG GTT TGG GTT) (SEQ ID NO:40); [0655] Tel-2b primer (GGC TTG CCT TAC CCT TAC CCT TAC CCT TAC CCT TAC CCT) (SEQ ID NO:41); [0656] hgb1 primer (GCT TCT GAC ACA ACT GTG TTC ACT AGC) (SEQ ID NO:42); and [0657] hgb2 primer (CAC CAA CTT CAT CCA CGT TCA CC) (SEQ ID NO:43).
[0658] All samples were analyzed by both the telomere and hemoglobin reactions, and the analysis was performed in triplicate on the same plate. In addition to the test samples, each 96-well plate contained a five-point standard curve from 0.08 ng to 250 ng using genomic DNA isolated from the 1301 human T-cell leukemia cell line (available from Sigma and ATCC). The T/S ratio (?dCt) for each sample was calculated by subtracting the median hemoglobin threshold cycle (Ct) value from the median telomere Ct value. The relative T/S ratio (?ddCt) was determined by subtracting the T/S ratio of the 10.0 ng standard curve point from the T/S ratio of each unknown sample.
[0659] Results are shown in