GLYCOSYLATED AROMA- AND FRAGRANCE PRECURSORS AND FRAGRANCE PRODUCTS THAT CAN BE ACTIVATED
20180127681 ยท 2018-05-10
Inventors
- Wilfried Schwab (Marktheidenfeld, DE)
- Thomas Hoffmann (Biberbach, DE)
- Fong-Chin Huang (Freising, DE)
- Thilo Fischer (Ismaning, DE)
- Detlef Erich Hinz (Ismaning, DE)
- Heimo Adamski (Langenpreising, DE)
Cpc classification
C11D3/221
CHEMISTRY; METALLURGY
C12P19/18
CHEMISTRY; METALLURGY
C11B9/0076
CHEMISTRY; METALLURGY
A23L27/20
HUMAN NECESSITIES
C12P19/44
CHEMISTRY; METALLURGY
C11B9/0003
CHEMISTRY; METALLURGY
A23V2002/00
HUMAN NECESSITIES
C11D3/507
CHEMISTRY; METALLURGY
International classification
C12P19/18
CHEMISTRY; METALLURGY
C12P19/44
CHEMISTRY; METALLURGY
A23L27/20
HUMAN NECESSITIES
Abstract
The present invention discloses biotechnologically produced inactive aroma- and fragrance/scent precursors in new concentration ranges beyond those of natural aroma glycoside sources, which can be activated by external triggers like enzymes, temperature and p H, and then release the aroma and the fragrance.
Claims
1. Product or composition comprising at least one aroma glycoside comprising an aglycone component and at least one sugar component, wherein the concentration of the at least one aroma glycoside is higher than its concentration in natural products or compositions.
2. Product or composition according to claim 1, wherein the aroma is at least one selected from the list of compounds consisting of eugenol, citronellol, thymol, carvacrol, furaneol, 1-hexanol, homofuraneol, norfuraneol, menthol, raspberry ketone, maltol, ethylmaltol, 2-furfurylthiol, 2-methyl-3-furanthiol, 3-mercapto-2-pentanon, 1-octen-3-ol, sotolon, 4-mercapto-4-methylpentan-2-on, (3-methylthio)-1-propanol, and phenylethanol, preferably from thymol, carvacrol, furaneol, homofuraneol, norfuraneol, raspberry ketone, maltol, ethylmaltol, 2-furfurylthiol, 2-methyl-3-furanthiol, 3-mercapto-2-pentanon, sotolon, 4-mercapto-4-methylpentan-2-on, and (3-methylthio)-1-propanol, more preferably from carvacrol, norfuraneol, raspberry ketone, 2-furfurylthiol, 2-methyl-3-furanthiol, 3-mercapto-2-pentanon, sotolon, 4-mercapto-4-methylpentan-2-on, and (3-methylthio)-1-propanol.
3. Product or composition according to claim 1, wherein the concentration of the at least one aroma glycoside is 1-10000 ppm, preferably 10-1000 ppm, further preferably 20-200 ppm, particularly preferably about 100 ppm.
4. Product or composition according to claim 1, wherein the aroma glycoside comprises an aglycone precursor selected from the group consisting of odorous substances, flavoring agents, essences, perfume oils, perfumes, aromatic substance compositions, and fragrance mixtures.
5. Product or composition according to claim 1, further comprising at least one inactive hydrolase, preferably a glycosidase, particularly a -glucosidase, and at least one further inactive enzyme, particularly when the aglycone is an alcohol and/or a thiol, preferably an oxidase when the aglycone is an alcohol.
6. Product or composition according to claim 1, further comprising at least one selected from the group consisting of odorous substances, flavoring agents, essences, perfume oils, perfumes, aromatic substance compositions, and fragrance mixtures.
7. Glycosyltransferase for producing an aroma glycoside for use in a product or composition according to claim 1, wherein the glycosyltransferase is encoded by a nucleic acid sequence that: a) comprises the sequence of SEQ-ID1, SEQ-ID2, or SEQ-ID3; or b) comprises a sequence that is at least 90%, preferably at least 95%, more preferably at least 98%, identical to SEQ-ID1, SEQ-ID2, or SEQ-ID3; or c) comprises a part of the sequence of SEQ-ID1, SEQ-ID2, or SEQ-ID3, wherein said part of the sequence of SEQ-ID1, SEQ-ID2, or SEQ-ID3 codes at least 50, preferably at least 80, more preferably at least 100, more preferably at least 200, amino acids in length; or d) comprises a sequence that is at least 90%, preferably at least 95%, more preferably at least 98%, identical to a part of the sequence of SEQ-ID1, SEQ-ID2, or SEQ-ID3, wherein said part of the sequence of SEQ-ID1, SEQ-ID2, or SEQ-ID3 codes at least 50, preferably at least 80, more preferably at least 100, more preferably at least 200, amino acids in length.
8. The glycosyltransferase according to claim 7, wherein the glycosyltransferase is capable of catalyzing formation of a glycoside in which a sugar is linked to an aglycone through a -D-glycosyl linkage.
9. A nucleic acid molecule encoding a glycosyltransferase according to claim 7, wherein said nucleic acid molecule is a DNA molecule, particularly a cDNA molecule.
10. A vector comprising a DNA sequence encoding a glycosyltransferase according to claim 7.
11. A host cell containing or transfected with the nucleic acid molecule according to claim 9.
12. A transgenic plant comprising a nucleic acid molecule according to claim 9.
13. A method for forming at least one aroma glycoside, wherein an aglycone is covalently linked to a sugar donor, the method comprising: contacting the aglycone with the sugar donor and a glycosyltransferase according to claim 7 under conditions appropriate for the transfer of the sugar group of said sugar donor; or culturing or growing a host cell or a transgenic plant comprising a nucleic acid molecule encoding a glycosyltransferase according to claim 7 and collecting from said host cell or transgenic plant said aroma glycoside.
14. Product produced by the method according to claim 13.
15. Use of an aroma glycoside in a concentration higher than its concentration in natural products or compositions, preferably in an artificial product or composition from the group consisting of cosmetic products, e.g. deodorants, shower gels, body lotions, skin creams, shampoos, lipsticks, skin whitenings, and tooth pastes; hygienic products, e.g. diapers, sanitary pads, shoe soles, litter bins, cat toilets, and pet beds; food products, e.g.. bakery products, frozen foods, tea, coffee, beverages, chewing gum, sweets, pills against bad breath, deodorant candies, flavor enhancers, blocking/inhibitors of negative flavors, blocking bitter tastes/bitter taste inhibitors, and taste modulators; pharmaceutical products; fragrances; clothing and textiles and products related thereto, e.g. fabric softeners, and impregnations; household products, e.g. scented candles and cards, cigarettes, air fresheners, artificial flowers and plants, and adhesive strips; products in the construction sector, e.g. wood preservatives, wallpapers, mold-fightings/mold control, and odor colors; insect repellents, e.g. skin creams (topical), candies (orally), and candles; and products for electronic devices, e.g. odor TVs/4D TVs, and smartphone gadgets.
Description
[0032] The invention will be further described in detail in the following with reference to the figures and particular embodiments thereof, without being limited thereto.
[0033] In the figures the following is shown:
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041] In
[0042]
[0043] In
[0044] In
DETAILED DESCRIPTION OF THE PRESENT INVENTION
[0045] All ranges disclosed herein are to be considered to be supplemented by the term about, unless clearly defined to the contrary or otherwise clear from the context.
[0046] According to a first aspect, the present invention relates to a product or composition comprising at least one aroma glycoside comprising an aglycone component and at least one sugar component, wherein the concentration of the at least one aroma glycoside is higher than its concentration in natural products or compositions.
[0047] A glycoside, as used herein, is a molecule in which a sugar (the glycone part or glycone component of the glycoside) is bonded to a non-sugar (the aglycone part or aglycone component) via a glycosidic bond. Accordingly, a glycoside may consist of a sugar as glycone component linked through its anomeric carbon atom to e.g. the hydroxy group of an alcohol (chemical structure ROH) as aglycone component. For example, in the glycoside linaloyl -D-glucoside, the glycone component glucose is linked to the aglycone component linalool.
[0048] A glycoside can be produced by carrying out a reaction in which an aglycone component is mixed under appropriate conditions with a sugar donor in the presence of a glycosyltransferase as enzymatic catalyzer.
[0049] Alternatively, a glycoside can be produced by culturing or growing a host cell or transgenic plant expressing a glycosyltransferase according to the invention when adding the respective aglycone and sugar. During culture/growth, such a host cell or transgenic plant will generate glycosides. The glycoside(s) generated in such a host cell or transgenic plant can subsequently be collected from said host cell or transgenic plant by standard methods of extraction and/or chromatography (such as solvent extraction, solid phase extraction and reversed phase chromatography).
[0050] The aromaand thus the aglyconeare not particularly restricted and can be any that is available, either from natural sources or produced synthetically. According to certain aspects, the aroma glycoside is produced from a natural source, e.g. in a plant or in microorganisms. The aroma glycoside can then be introduced into the product or composition, thus producing a man-made product or composition, which is not particularly restricted. Several possible products and compositions will be described in the following, including, but not limited to, cosmetic products, e.g. deodorants, shower gels, body lotions, skin creams, shampoos, lipsticks, skin whitenings, and tooth pastes; hygienic products, e.g. diapers, sanitary pads, shoe soles, litter bins, cat toilets, and pet beds; food products, e.g.. bakery products, frozen foods, tea, coffee, beverages, chewing gum, sweets, pills against bad breath, deodorant candies, flavor enhancers, blocking/inhibitors of negative flavors, blocking bitter tastes/bitter taste inhibitors, and taste modulators; pharmaceutical products; fragrances; clothing and textiles and products related thereto, e.g. fabric softeners, and impregnations; household products, e.g. scented candles and cards, cigarettes, air fresheners, artificial flowers and plants, and adhesive strips; products in the construction sector, e.g. wood preservatives, wallpapers, mold-fightings/mold control, and odor colors; insect repellents, e.g. skin creams (topical), candies (orally), and candles; and products for electronic devices, e.g. odor TVs/4D TVs, and smartphone gadgets. Also concentrates of the aroma glycosides can be produced that can be then used for producing any of the products or compositions.
[0051] A variety of the aroma glycosides, being aroma and odor precursors, that can be activated and produced biotechnologically by the glycosyltransferases according to the invention are described below. A basis thereof are aromas like flavorings and fragrances of natural origin that can then be glycosylated, with a small selection of the most important flavorings and fragrances presented in table 2, although not limited thereto; generally, all alcohols of the list of the European union can also be envisioned (COMMISSION IMPLEMENTING REGULATION (EU) No 872/2012 of 1 Oct. 2012 adopting the list of flavoring substances provided for by Regulation (EC) No 2232/96 of the European Parliament and of the Council, introducing it in Annex I to Regulation (EC) No 1334/2008 of the European Parliament and of the Council and repealing Commission Regulation (EC) No 1565/2000 and Commission Decision 1999/217/EC)source: http://eur-lex.europa.eu/legal-content/EN/TXT/!uri=CELEX:32012R0872; further, also glycosylated terpenes as disclosed in http://www.ebi.ac.uk/chebi/searchId.do?chebild=61777 can be produced. Also derivatives, isomers of the respective substances are included in the list of possibilities. According to certain embodiments, the aroma is at least one selected from the list of compounds consisting of eugenol, citronellol, thymol, carvacrol, furaneol, 1-hexanol, homofuraneol, norfuraneol, menthol, raspberry ketone, maltol, ethylmaltol, 2-furfurylthiol, 2-methyl-3-furanthiol, 3-mercapto-2-pentanon, 1-octen-3-ol, sotolon, 4-mercapto-4-methylpentan-2-on, (3-methylthio)-1-propanol, and phenylethanol, preferably from thymol, carvacrol, furaneol, homofuraneol, norfuraneol, raspberry ketone, maltol, ethylmaltol, 2-furfurylthiol, 2-methyl-3-furanthiol, 3-mercapto-2-pentanon, sotolon, 4-mercapto-4-methylpentan-2-on, and (3-methylthio)-1-propanol, more preferably from carvacrol, norfuraneol, raspberry ketone, 2-furfurylthiol, 2-methyl-3-furanthiol, 3-mercapto-2-pentanon, sotolon, 4-mercapto-4-methylpentan-2-on, and (3-methylthio)-1-propanol. Particularly preferably are gl ucosides thereof.
[0052] According to certain embodiments, the aroma glycoside comprises an aglycone precursor selected from the group consisting of odorous substances, flavoring agents, essences, perfume oils, perfumes, aromatic substance compositions, and fragrance mixtures.
TABLE-US-00002 TABLE 2 Selection of flavoring and fragrance precursors that can be produced; the following flavorings and fragrances can be glycosylated, e.g. glucosilated, and thus be converted to precursors Preferred for Preferred for Flavoring or low odor Flavoring or low odor fragrance threshold fragrance threshold geraniol x heptyl alcohol x nerol x linalool x citronellol x menthenethiol x furaneol x octalactone x thymol x octenol x carvacrol propanethiol x eugenol x raspberry ketone x (Himbeerketon) phenyl ethanol sotolon, caramel x furanone vanillin terpineol x menthol 10-undecenol x hexenol x hydroxycitronellol anisole x dihydromyrcenol butanethiol x borneol decalactone x hesperetin ethylguaiacol x raspberry ketone farnesol x homofuraneol furfuryl alcohol x norfuraneol furfuryl mercaptan x maltol guaiacol x ethyl maltol In Table 2, x means that the compound is preferred.
[0053] Also the sugar component is not particularly limited. Different sugars can be used for producing the precursors, as disclosed in e.g. table .sub.3, although not being limited thereto.
TABLE-US-00003 TABLE 3 Selection of sugars: instead of using glucose (glucosides) also other sugars can be used, the resulting precursors will then generally be called glycosides or be named according to the respective sugar; list of sugars (selection): Glucose, Arabinose, Xylose, Rhamnose, Apiose, Galactose
[0054] The term that the concentration of the at least one aroma glycoside is higher than its concentration in natural products or compositions means that the concentration of the aroma glycoside in the product or composition is higher than a concentration in which it can be observed in a natural product, particularly any natural product.
[0055] The concentrations can thereby vary according to the aglyca and sugar component. For example, furaneol can be contained in raspberries in concentrations of about 0.8 mg/kg fruit naturally. The herein described products and compositions compriseaccording to certain embodimentsglycosides of natural aroma agents.
[0056] According to certain embodiments, the concentration of the at least one aroma glycoside in the product or composition is 1-10000 ppm, preferably 2-10000 ppm, further preferably 10-1000 ppm, more preferably 20-200 ppm, even further preferably 50-150 ppm, particularly preferably about 100 ppm. If more than one aroma glycoside is contained in the product or composition, more than one, e.g. each, can have a concentration in the respective ranges, although it is sufficient if at least one aroma glycoside has a concentration in the above ranges.
[0057] According to certain embodiments, the aroma glycoside is produced by a biotechnological process. According to certain embodiments, genes of at least one glycosyltransferase are isolated from at least one plant, particularly from a plant in which a glycoside of interest is contained, and then introduced into an organism, particularly GRAS-organisms (generally recognized as safe/genetically regarded as safe), e.g. microorganisms like yeast or distinct E. coli strains, and one or more aroma glycoside is produced using these organisms by known procedures, e.g. culturing in presence of educts for producing the aroma glycoside.
[0058] According to certain embodiments, the product or composition according to the invention can further comprise at least one inactive hydrolase, preferably a glycosidase, particularly a -glucosidase. This hydrolase can then be activated in the product or composition, e.g. by water when the hydrolase is present in a dry state, so that the aroma is released.
[0059] The product or composition according to the invention can further also comprise at least one inactive hydrolase, preferably a glycosidase, particularly a -glucosidase, and at least one further inactive enzyme, particularly when the aglycone is an alcohol and/or a thiol, preferably an oxidase when the aglycone is an alcohol.
[0060] The further inactive enzyme can be e.g. also a dry enzyme that is activated upon contact with water, thus enabling a delayed functionality of the enzyme. Not only the additional enzyme can be inactive, but also the at least one hydrolase, preferably a glycosidase, particularly a -glucosidase, thus enabling a prolonged and/or delayed release of the aroma upon cleavage of the aroma glycoside by the hydrolase, e.g. glycosidase. Particularly useful are -glucosidases as the glycosyltransferases according to the invention as they can particularly catalyze the formation of -glucosides that can be cleaved by the human microbiome. -glucosides produced biotechnologically up to now, which further carry several sugar units, can only be released intricately using sequential reactions and with special glucosidases.
[0061] The presence of a further enzyme can enable the formation of a different aroma from the aroma first released, e.g. the formation of an aldehyde from an alcohol, wherein both compounds function as aromas, e.g. flavors and/or fragrances, leading to the possibility of producing mixtures of aromas that can be controlled by the release and reaction of the first aroma. Particularly preferably is also the use of thiols, which can be synthesized using the glycosyltransferases of the present invention, as they can be perceived in far lower amounts, and also can be oxidized to achieve new aromas. Although oxidases are exemplified herein as further enzymes, the invention is not restricted thereto, and other enzymes can be present. In the case of alcohol aglycones an oxidase is preferred as further enzyme, though.
[0062] According to certain embodiments, the product or composition according to the invention can also contain more than one aroma glycoside in combination/mixtures, wherein the aroma glycosides can release the aroma either by the same or different procedures after activation. It is thus possible that different aromas are released at the same time, leading to a mixture of aromas with a particular note, or that different aromas are released at different times, leading to arrangements of aromas, e.g. fragrances that change over the course of time. It is also not excluded that the same aroma is coupled to different sugars which are activated by different procedures, so that the aroma can be released from different sources over an even further prolonged period of time.
[0063] According to certain embodiments, the product or composition according to the invention can further comprise at least one selected from the group consisting of odorous substances, flavoring agents, essences, perfume oils, perfumes, aromatic substance compositions, and fragrance mixtures, etc. This way it is possible that the product or composition first exerts the fragrance or flavor of the odorous substances, flavoring agents, essences, perfume oils, perfumes, aromatic substance compositions, and/or fragrance mixtures, etc., whereas the same fragrance or flavor or a different one can further be maintained upon release of the aroma from the aroma glycosides, thus enabling the perception of the aroma from the beginning, even without cleavage of the aroma glycoside, and for a long time upon cleavage of the aroma glycoside. Also mixes of different aromas, one coming from the aroma glycoside, can be achieved.
[0064] It is not excluded that the aroma glycoside can have a further function in the product or composition of the invention, replacing other additives. One example is the usual addition of digeranly succinate or hexarose (geranyl palmitate) to softeners so that geraniol and nerol (rose fragrance) are released by the lipasea hydrolasepresent in the detergent for solving fats. Here, also the aroma glycosides, respectively flavoring and fragrance glycosides according to the invention can be used in place of digeranly succinate or hexarose, which also are activated by further hydrolases (cellulases) present in detergents. Due to their bipolar structure (sugar and non-sugar component) these additionally have the advantage that they can be used as surfactant in their inactive form. Other surfactants thus would be required in decreased amounts, leading to savings for the detergent producers.
[0065] According to a second aspect, the present invention relates to a glycosyltransferase for producing an aroma glycoside as used in a product or composition of the present invention coded by a nucleic acid sequence that
[0066] a) comprises the sequence of SEQ-ID1, SEQ-ID2, or SEQ-ID3; or
[0067] b) comprises a sequence that is at least 90%, preferably at least 95%, more preferably at least 98%, further preferably at least 99%, identical to SEQ-ID1, SEQ-ID2, or SEQ-ID3; or
[0068] c) comprises a part of the sequence of SEQ-ID1, SEQ-ID2, or SEQ-ID3, wherein said part of the sequence of SEQ-ID1, SEQ-ID2, or SEQ-ID3 codes at least 50, preferably at least 80, more preferably at least 100, more preferably at least 200, amino acids in length; or
[0069] d) comprises a sequence that is at least 90%, preferably at least 95%, more preferably at least 98%, further preferably at least 99%, identical to a part of the sequence of SEQ-ID1, SEQ-ID2, or SEQ-ID3, wherein said part of the sequence of SEQ-ID1, SEQ-ID2, or SEQ-ID3 codes at least 50, preferably at least 80, more preferably at least 100, more preferably at least zoo, amino acids in length.
[0070] According to certain embodiments, the glycosyltransferase for producing an aroma glycoside as used in a product or composition of the present invention coded by a nucleic acid sequence comprises an amino acid sequence resulting from SEQ-ID1, SEQ-ID2, or SEQ-ID3, or a par thereof, wherein the part constitutes at least 50, preferably at least 80 or most preferably at least zoo amino acids in lengths; or comprises an amino acid sequence which is at least 90%, preferably at least 95% or most preferably at least 98% identical to the amino acid sequence resulting from SEQ-ID1, SEQ-ID2, or SEQ-ID3, or a part thereof, wherein the part constitutes at least 50, preferably at least 80 or most preferably at least zoo amino acids in lengths.
[0071] According to certain embodiments, the present invention relates to a glycosyltransferase for producing an aroma glycoside as used in a product or composition of the present invention having an amino acid sequence that
[0072] a) comprises the sequence of SEQ-ID4, SEQ-ID5, or SEQ-ID6; or
[0073] b) comprises a sequence that is at least 90%, preferably at least 95%, more preferably at least 98%, further preferably at least 99%, identical to SEQ-ID4, SEQ-ID5, or SEQ-ID6; or
[0074] c) comprises a part of the sequence of SEQ-ID4, SEQ-ID5, or SEQ-ID6, wherein said part of the sequence of SEQ-ID4, SEQ-ID5, or SEQ-ID6 is at least 50, preferably at least 80, more preferably at least 100, more preferably at least zoo, amino acids in length; or
[0075] d) comprises a sequence that is at least 90%, preferably at least 95%, more preferably at least 98%, further preferably at least 99%, identical to a part of the sequence of SEQ-ID4, SEQ-ID5, or SEQ-ID6, wherein said part of the sequence of SEQ-ID4, SEQ-ID5, or SEQ-ID6 is at least 50, preferably at least 80, more preferably at least goo, more preferably at least zoo, amino acids in length.
[0076] Herein, the amino acid sequences SEQ-ID4, SEQ-ID5, or SEQ-ID6 are coded by the nucleic acid sequences SEQ-ID1, SEQ-ID2, or SEQ-ID3, respectively.
[0077] In some embodiments, the glycosyltransferase is a small molecule glycosyltransferase. A small molecule glycosyltransferase is a glycosyltransferase that catalyzes the transfer of a monosaccharide moiety from a sugar donor to a small molecule as acceptor molecule. A small molecule is a molecule that has a molecular weight below 1 500 Dalton, preferably below 1 000 Dalton.
[0078] According to certain embodiments, the present invention refers to a glycosyltransferase coded by a nucleic acid sequence having the sequence of SEQ-ID1, SEQ-ID2, or SEQ-ID3 or has the amino acid sequence of SEQ-ID4, SEQ-ID5, or SEQ-ID6. This is meant to designate that the nucleic acid sequence, respectively amino acid sequence, of said glycosyltransferase consists of said certain nucleic acid sequence, respectively amino acid sequence.
[0079] Glycosyltransferases having a nucleic acid sequence comprising SEQ-ID1 (i.e. the sequence of FaGTs1-5) or SEQ-ID2 (i.e. the sequence of FaGTs1-13) or SEQ-ID3 (i.e. the sequence of VvdGT13) or a related nucleic acid sequence can be obtained by standard methods of recombinant DNA technology.
[0080] According to certain embodiments, the glycosyltransferase is capable of catalyzing formation of a glycoside in which a sugar is linked to an aglycone through a -D-glycosyl linkage.
[0081] According to a further aspect the present invention relates to a nucleic acid molecule encoding a glycosyltransferase of the invention, wherein said nucleic acid molecule is a DNA molecule, particularly a cDNA molecule. The present invention also refers to a cRNA molecule based on the DNA molecule of the invention.
[0082] According to another aspect, the present invention refers to a vector comprising a DNA sequence encoding a glycosyltransferase of the present invention. Construction of a vector may be performed using e.g. a restriction enzyme, ligase etc. according to a standard method known in the art.
[0083] A further aspect of the present invention relates to a host cell containing or transfected with the nucleic acid molecule or the vector according to the invention.
[0084] As host cell transfected with the nucleic acid molecule as described above, the cell of a prokaryotic or eukaryotic organism or the prokaryote or eukaryote itself may be used. Bacteria, for example, commonly used hosts such as bacteria belonging to genus Escherichia such as Escherichia coli can be used as the prokaryotic organism, although also other prokaryotes can be used. Alternatively, a cell of a lower eukaryotic organism such as eukaryotic microorganisms including, for example, yeast (e.g. Saccharomyces cerevisiae) or fungi like Aspergillus oryzae and Aspergillus niger can be used. Animal cells or plant cells also can be used as a host. Examples of animal cells that can be used include cell lines of mouse, hamster, monkey, human, etc., as well as insect cells such as silkworm cells and adult silkworm per se.
[0085] A host cell being transfected refers to a situation where foreign DNA is introduced into the cell. A transfected host cell may be stably transfected, i.e. foreign DNA is introduced and integrated into the genome of the transfected cell. Alternatively, a transfected host cell may be transiently transfected, wherein the foreign DNA fails to integrate into the genome of the transfected cell. The transformation of a host with a nucleic acid molecule or a vector can be performed according to standard methods.
[0086] According to a further aspect, the present invention relates to a transgenic plant comprising a nucleic acid molecule or a vector according to the present invention. The term transgenic plant refers thereby to a plant that has a heterologous gene, i.e. a gene not from its natural environment, integrated into its genome and that transmits said heterologous gene to its progeny. For example, a heterologous gene includes a gene from one species introduced into another species. According to certain embodiments, a heterologous gene also includes a gene native to an organism that has been altered in some way (e.g., mutated, added in multiple copies, or linked to non-native regulatory sequences).
[0087] Another aspect of the present invention is directed to a method of forming at least one aroma glycoside, wherein an aglycone is covalently linked to a sugar donor comprising contacting the aglycone with the sugar donor and a glycosyltransferase of the invention under conditions appropriate for the transfer of the sugar group of said sugar donor. These appropriate conditions depend, among others, on the aglycone, the sugar donor and the glycosyltransferase, particularly its enzymatic activity, and thus also e.g. the temperature and pH, and can be suitable set once the compounds are determined. In certain embodiments, said method is an in vitro method which, preferably, does not involve any steps carried out in vivo. In some embodiments, said method is an in vivo method carried out in a host cell or transgenic plant as defined above. According to certain embodiments, only one aroma glycoside is formed in this method.
[0088] According to a still further aspect the present invention is directed to a method of producing at least one aroma glycoside, said method comprising the steps of: [0089] culturing or growing a host cell or a transgenic plant of the invention; and [0090] collecting from said host cell or transgenic plant said aroma glycoside.
[0091] The culturing or growing depends on the host cell or transgenic plant and can be suitably set by the skilled person, e.g. regarding nutrient addition, culture medium, growth conditions, etc. The collecting also depends on the type of host cell or transgenic plant and can be carried out using usual means like extraction, which also can be suitable set. Preferably, the aglycone is present in said host cell or transgenic plant during said culturing or growing said host cell or transgenic plant. Further preferably, the sugar donor is present in the culture medium used for culturing said host cell or in the water used for watering that transgenic plant. In certain embodiments, said culturing or growing said host cell is carried out in a bioreactor.
[0092] It is not excluded that more than one aroma glycoside is produced in a host cell or transgenic plant, which can be suitably carried out by selecting the respective aglycones and sugars. According to certain embodiments, only one aroma glycoside is produced in a host cell or transgenic plant of the invention.
[0093] In a further aspect the present invention relates to a product produced by the inventive methods. The product herein can comprise also mixtures of aroma glycosides. Furthermore, the product can contain the aroma glycoside in a concentration higher than its concentration in natural products or compositions, particularly higher than its concentration when produced in a host cell or transgenic plant of the same species and/or type which is not according to the invention.
[0094] According to a further aspect, the present invention is directed to the use of an aroma glycoside in a concentration higher than its concentration in natural products or compositions, preferably in an artificial product or composition from the group consisting of cosmetic products, e.g. deodorants, shower gels, body lotions, skin creams, shampoos, lipsticks, skin whitenings, and tooth pastes; hygienic products, e.g. diapers, sanitary pads, shoe soles, litter bins, cat toilets, and pet beds; food products, e.g.. bakery products, frozen foods, tea, coffee, beverages, chewing gum, sweets, pills against bad breath, deodorant candies, flavor enhancers, blocking/inhibitors of negative flavors, blocking bitter tastes/bitter taste inhibitors, and taste modulators; pharmaceutical products; fragrances; clothing and textiles and products related thereto, e.g. fabric softeners, and impregnations; household products, e.g. scented candles and cards, cigarettes, air fresheners, artificial flowers and plants, and adhesive strips; products in the construction sector, e.g. wood preservatives, wallpapers, mold-fightings/mold control, and odor colors; insect repellents, e.g. skin creams (topical), candies (orally), and candles; and products for electronic devices, e.g. odor TVs/4D TVs, and smartphone gadgets. According to certain aspects, the aroma glycoside used is the aroma glycoside present in a product or composition according to the invention. According to certain embodiments, the aroma glycosides used in the product or composition according to the present invention are used.
[0095] As already noted above, the aroma precursors according to the invention, e.g. the flavoring and fragrance precursors that can be activated open up many new applications with their special properties, a few of which can be seen in Table 4.
[0096] The identified enzymes themselves can be marketed as products by, for example, adding them together with the sugar substrates to semi-finished products in order to neutralize volatile, bad tasting or smelling flavors or odors by transferring them to non-volatile precursors using the enzymatic reaction.
TABLE-US-00004 TABLE 4 Selection of applications of the flavoring and fragrance precursors that can be activated; Use in: Construction Wood preservatives, Wallpapers, Building materials (mould sector control), Odor colors Household Scented candles, Batteries, Cigarettes, Scented cards, 4D television, Scent dispensers, Candles, Flowers, Paper flowers with absorbing stem Hygiene Diapers, Urinary bags, Shoe soles, Trash can, Swimming and bathing pools, Cat's litter box, Animal beds, Dog hygiene, Pheromone pills, Tampons, Latex gloves, Anti- mosquito-candies, Anti-mosquito-skin cream, Anti- mosquito agent, Repellents, Detergents Cosmetics Toothpaste, Shower gel, Body lotion, Skin cream, Hair gels, Skin lotion, Lipstick, Finger nails, Skin whitening Food Chewing gumi, Tea, Pills against bad breath, Coffee, Spices, Frozen goods (pizza, etc.), Pastries, Deodorant candy, Drinks, Flavor enhancers, Blocking of negative flavors, Bitter flavor inhibition, Taste modulation, Textiles Clothing Electronics Electric appliances, e.g. 4D television; sensors
[0097] Certain specific embodiments of the present invention are described in the following:
[0098] (1) Biotechnologically produced aroma glycosides, characterized in that they are inactive precursors of flavorings or fragrances, are applied in new concentration ranges beyond those of natural aroma glycoside sources, and can be appropriately activated by:
[0099] a) biological mechanisms, e.g. addition of enzymes, e.g. -glucosidase,
[0100] b) physical mechanisms, e.g. an increase in temperature, e.g. above 70 C.,
[0101] c) chemical mechanisms, e.g. a pH change, e.g. below a pH of 3,
[0102] d) aroma glycosides, characterized in that they are effective as taste modulators in uncleaved form, e.g. (and not limiting) as bitter-masking or sweet-enhancing agents, or also as flavorings of the perception umami or kokumi.
[0103] (2) Aroma glycoside according to (1), characterized in that
[0104] a) the released aglycones are understood as e.g. odorous substances/scents, aroma agents, flavorings, perfume oils, odors/smells/fragrances, odorous substance compositions, odor compositions and the like.
[0105] b) the aglycones are for example geraniol, nerol, citronellol, thymol, carvacrol, eugenol, phenyl ethanol, vanillin, menthol, hexenol, anisole, butanethiol, decalactone, ethylguaiacol, farnesol, furfuryl alcohol, furfuryl mercaptan, guaiacol, heptyl alcohol, linalool, methenthiol, octalactone, propanethiol, raspberry ketone, terpineol, io-undecenol, hydroxycitronellol, dihydromyrcenol, borneol or hesperetin, or norfuraneol; particularly preferred are according to (i) a), b), c), but also according to d): furaneol, homofuraneol, caramel furanone, furanthiol, maltol, ethyl maltol, octenol, sotolon.
[0106] b) organic alcohols are glycosylated, e.g. from the list of aroma agents approved in Europe (union list).
[0107] c) they are terpene glycosides, e.g. glycosylated terpenoids with one or more hydroxy functions (CHEBI:61777 list).
[0108] d) the aglycones are glycosylated with a proportion, e.g. molar proportion, of one or a multitude thereof with glucose, arabinose, xylose, rhamnose, apiose or galactose,
[0109] e) they have additional functions, e.g. antimicrobial, antifungal effect, flavor enhancement, sweetening agent, repellent, detergent.
[0110] (3) Aroma glycoside according to (i), characterized in that they are produced by a biotechnological process, for example via glycosyltransferases, e.g. with glucosyltransferases
[0111] a) with the nucleotide sequence SEQ-ID1 and the amino acid sequence resulting thereof, or an amino acid sequence which is at least 90%, preferably at least 95% or most preferably at least 98% identical to the amino acid sequence resulting from SEQ-ID1, or a part thereof, wherein the part constitutes at least .sub.50, preferably at least 80 or most preferably at least zoo amino acids in lengths,
[0112] b) with the nucleotide sequence SEQ-ID2 and the amino acid sequence resulting thereof, or an amino acid sequence which is at least 90%, preferably at least 95% or most preferably at least 98% identical to the amino acid sequence resulting from SEQ-ID2, or a part thereof, wherein the part constitutes at least 50, preferably at least 80 or most preferably at least zoo amino acids in lengths,
[0113] c) with the nucleotide sequence SEQ-ID3 and the amino acid sequence resulting thereof, or an amino acid sequence which is at least 90%, preferably at least 95% or most preferably at least 98% identical to the amino acid sequence resulting from SEQ-ID3, or a part thereof, wherein the part constitutes at least 50, preferably at least 80 or most preferably at least zoo amino acids in lengths,
[0114] d) which are for example a terpene glycosyltransferase, preferably a monoterpene glycosyltransferase,
[0115] e) which for example bind an aglycone containing a hydroxy group with a sugar via a -D-glykosyl-bond to a glycoside,
[0116] f) which use for example UDP sugars as sugar source, e.g. UDP-glucose, UDP-arabinose, UDP-xylose, UDP-rhamnose, UDP-apiose, UDP-galactose,
[0117] g) which for example glycosylate the aglycones according to (2).
[0118] (4) A vector with the DNA-sequence from (3), which codes a glycosyltransferase.
[0119] (5) A host cell containing or transfected with the nucleic acid molecule according to (3) or containing the vector according (4).
[0120] (6) The host cell according to (5), which produces a glycosyltransferase according to (3).
[0121] (7) A transgenic plant comprising a nucleic acid molecule according to (3) 6 or a vector according to (4).
[0122] (8) The transgenic plant according to (.sub.7), which produces a glycosyltransferase according to (3).
[0123] (9) Use of a glycosyltransferase according to (3) or a vector according to (4) or a host according to (5)-(6) or a transgenic plant according to (7)-(8) for producing aroma glycosides according to (1)-(2).
[0124] (10) Aroma glycose according to 1, characterized in that they are used for
[0125] a) hygienic applications and products, e.g. body deodorant, diapers, urinary bags, shoe soles, trash cans, swimming and bathing pools/tubs, cat's litter boxes, animal beds, dog hygiene, pheromone pills, tampons, latex gloves, anti-mosquito candies, anti-mosquito skin cream, anti-mosquito agents, toothpaste, shower gel, body lotion, skin cream, hair gels, skin lotion, lipstick, fingernail/nail polish, skin whitening,
[0126] b) applications and products in the food sector, e.g. chewing gum, tea, pills against bad breath, coffee, spices, frozen goods (pizza, etc.), pastries/baking goods, deodorant candies, drinks, taste enhancers, blocking of negative tastes, bitter taste inhibition, taste modulation,
[0127] c) textiles, e.g. in detergent additives, softeners,
[0128] Particularly preferred are applications in steam irons or ironers, even more preferred therein special applications in which the part cleaving thermally according to (1)b) is technically set exactly by choice of temperature and exposure time, and the not immediately released part of the odor in impregnated form stays as depot on the texiles/fabrics for future activation during use (particularly according to (1)a).
[0129] d) applications and products in the construction sector, e.g. wood preservatives, wallpapers, building materials (mould control), odor color (Geruchsfarbe),
[0130] e) applications in household products, e.g. scented candles, batteries, cigarettes, scented cards, 4D television, scent dispensers, candles, flowers.
[0131] (11) Product or composition containing one or more aroma glycosides in concentrations that are higher than their concentrations in natural products or compositions.
[0132] (12) Product or composition according to (11), wherein the aroma glycoside is produced biotechnologically.
[0133] (13) Product or composition according to (11) or (12), in which the concentration of the one or more aroma glycoside, respectively, is from 1-10000, preferably 10-1000, further preferably 20-200, most preferably around 100 ppm.
[0134] (14) Product or composition according to one of (11)-(13), which is a pharmaceutical or cosmetic product or composition, personal hygiene products, consumer articles, foods, nutraceuticals, food supplements, textile care products, household products or products in the construction sector.
[0135] (15) Glycosyltransferase, coded by a nucleic acid
[0136] a) with the nucleotide sequence SEQ-ID1 or a nucleotide sequence which is at least 90%, preferably at least 95% or most preferably at least 98% identical to the SEQ-ID1, or a part thereof, which codes at least 50, preferably at least 80 or most preferably at least zoo amino acids,
[0137] b) with the nucleotide sequence SEQ-ID2 or a nucleotide sequence which is at least 90%, preferably at least 95% or most preferably at least 98% identical to the SEQ-ID2, or a part thereof, which codes at least 50, preferably at least 80 or most preferably at least zoo amino acids,
[0138] c) with the nucleotide sequence SEQ-ID3 or a nucleotide sequence which is at least 90%, preferably at least 95% or most preferably at least 98% identical to the SEQ-ID3, or a part thereof, which codes at least 50, preferably at least 80 or most preferably at least zoo amino acids,
[0139] (1) Product or composition, preferably fragrance article that can be activated, containing fragrance glycosides, wherein the fragrance glycosides are contained in concentration ranges that are higher than that of natural fragrance glycoside sources, and the fragrance article is used
[0140] a) as fragrance article in the area of household products and promotional products, e.g. as scented candles, batteries, cigarettes, scented cards, 4D television, scent dispensers, candles, flowers, adhesive strips, strips, patch/band-aid.
[0141] b) as insect repellent products, e.g. with candles and in scenting of rooms.
[0142] (2) Product or composition according to (1), whereinbeside the fragrance glycosidesan activating enzyme, e.g. -glucosidase, is contained.
[0143] (3) Product or composition according to (1) and/or (2), wherein the fragrances can be activated according to need by
[0144] a) biological mechanisms, e.g. an addition of enzymes, e.g. -glucosidase,
[0145] b) physical mechanisms, e.g. an increase of temperature, e.g. above 70 C.,
[0146] c) chemical mechanisms, e.g. a change in pH, e.g. below a pH of 3,
[0147] d) according to (2) only through addition of water.
[0148] (4) Product or composition according to (2), wherein a repeated activation is possible by having a phase of drying after the first activation.
[0149] (5) Product or composition according to (1), in which
[0150] a) the released aglycones are understood as e.g. odorous substances/scents, perfume oils, odors/smells, odorous substance compositions, odor compositions and the like.
[0151] b) the released aglycones are for example geraniol, nerol, citronellol, thymol, carvacrol, eugenol, phenyl ethanol, vanillin, menthol, hexenol, anisole, butanethiol, decalactone, ethylguaiacol, farnesol, furfuryl alcohol, furfuryl mercaptan, guaiacol, heptyl alcohol, linalool, methenthiol, octalactone, propanethiol, raspberry ketone, terpineol, io-undecenol, hydroxycitronellol, dihydromyrcenol, borneol, hesperetin, norfuraneol and ethyl maltol; particularly preferred are according to (3)a), b), c), d): furaneol, homofuraneol, caramel furanone, furanthiol, maltol, ethyl maltol, octenol, sotolon.
[0152] c) the contained aglycones are organic alcohols that have been glycosylated, e.g. from the list of aroma agents approved in Europe (union list).
[0153] d) the fragrance precursors are terpene glycosides, e.g. glycosylated terpenoids with one or more hydroxy functions (CHEBI:61777 list).
[0154] e) the contained aglycones are glycosylated with a proportion, e.g. molar proportion, of one or a multitude thereof with glucose, arabinose, xylose, rhamnose, apiose or galactose.
[0155] (6) Product or composition of (1), wherein the fragrance glycosides are produced biotechnolgically.
[0156] (7) Product or composition of (1), in which the concentration of the one or more fragrance glycosides, respectively, is from 1-10000, preferably 10-1000, further preferably 20-200, most preferably around 100 ppm.
[0157] (8) Product or composition of (1), which is an artificial flower, for example without a stem as swimming flower, for example as flower with absorbing stem which transfers water from a glass to the flower/flower blosson and releases the fragrance there.
[0158] (9) Product or composition of (8), optionally with one or more properties of the following list:
[0159] a) The flower petals additionally have a color that can be activated by water.
[0160] b) The artificial stigma is formed as a depot in spherical (full sphere or coated hollow sphere) form to take up bigger amounts of fragrance that can be activated and of enzyme. Thereby, whole rooms can be scented.
[0161] c) Using smart papers a spatial change can be achieved by water supply, and thereby e.g. the opening of a closed flower can be mimicked.
[0162] d) Surprising artistic effects can be displayed by an intelligent arrangement of origami components.
[0163] (10) Product or composition of (1), which is a stripe, preferably self-adhering, preferably equipped with a depot, e.g. a fleece/non-woven, e.g. with a length of 1 cm to 100 cm without a restriction regarding width and height, for versatile scenting in wet rooms or usage with promotional items/articles.
EXAMPLES
[0164] The present invention will now be described in detail with reference to several examples thereof. However, these examples are illustrative and do not limit the scope of the invention.
[0165] Cosmetics/Hygiene
Example 1
[0166] Fragrances in Cosmetic Articles that Can Be Activated
[0167] By adding aromas/aroma agents and fragrances to cosmetic articles the fragrant effect can be prolonged. For example the fragrant effect of a deodorant can be prolonged (see
Example 2
[0168] Wetness Display Through Fragrances that Can Be Activated in Diapers
[0169] The fragrances that can be activated are put into a cellulose layer of a diaper in a dry state, through humidity and/or the bacterial enzymes contained in the excrements a release of the fragrance component is enabled, which serves as signal for the diaper change and at the same time covers bad smells.
Example 3
[0170] Glycosides that Can Be Activated for Use in Shoe Soles
[0171] Shoe soles are treated with a spray which contains the fragrances that can be activated. The bacteria in the foot sweat activate the glycosides and prevent the unpleasant smell of the shoes during prolonged use in this way.
Example 4
[0172] Glycosides that Can Be Activated for Use in Textiles
[0173] The fragrances that can be activated can be added to the detergent or the softener so that they wet the textiles after washing. During wearing of the textiles the fragrance is only activated by sweat bacteria and thus protects the wearer of the textiles from bad smells.
[0174] Particularly innovative are applications in steam irons or ironers, in which the part cleaving thermally is technically set exactly by choice of temperature and exposure time (immediate scent effect), and the not immediately released part of the odor in impregnated form stays as depot on the texiles/fabrics for future activation during use.
[0175] Foods
Example 5
[0176] Food Flavors that Can Be Activated
[0177] Inactive aroma precursors are used in foods in order to release the aroma after activation. All foods are usable therefore which can be activated by temperature (>70 C.), microorganisms, addition of water and enzyme or influence of saliva. Examples thereof are foods which are heated during preparation like bread, cake and pizza, foods for which microorganisms are used for preparation, dry foods that come into contact with fluids like muesli and pulverized cold dishes, or foods that stay for a time in the mouth like chewing gum or drops/candies.
[0178] The proof-of-principle was now shown successfully for the example bread. Dough from three different kinds of bread was treated with the aroma precursor geranyl glucoside. In summary the breads with an addition of 100 ppm geranyl glucoside showed a conversion of about 6% glucoside to geraniol. This conversion is ascribed to the biggest extent to pyrolytic processes (about 5%) during the ten-minute baking process at 230 C. and partly on the enzyme-catalyzed hydrolytic processes (about i%) during the preparation of yeast--glucosidase.
[0179] The realization of a sensoric orthonasal test with testing the difference (triangle test) between bread with and without addition of geranyl glucoside for crust and crumb showed that the added amount of 100 ppm with a conversion of 6%, corresponding to a content of 1.7 mg/kg, respectively 1.7 ppm geraniol, in bread is sufficient to perceive a change of the total aroma.
[0180] The aromas that can be activated can be introduced into: semi-finished products, cake premixes, food supplements, sugar for burnt punch, waffles, crepes, hot fruit sauces, hot drinks, noodles.
[0181] The release of the aromas from the precursors can be realized by: the cooking process, saliva, enzymes of microorganisms, baking, microwave, open fire, together with glycosidases only together with water.
[0182] Baking test 1Flower Dough
[0183] Dough blanks of 10 g flour each were used as base. A negative control (flour, salt and water), three samples (added geranyl glucoside), a recovery (addition of geraniol to the bread prior to freezing according to a postulated conversion of glucoside of about 6% in order to determine the losses during the analytical process) and a control for geraniol in the glucoside solution (addition of an aliquot amount of glucoside only after the baking process to determine the content of geraniol). Several process steps are carried out according to standardized instructions, for each of the six blanks separately.
[0184] Preparing the Dough/Paste:
[0185] For a blank/blind test (1) 9.98 g well-mixed flour were weighed into a glass vessel and 0.2 g NaCl were added. The mixture was at first mixed in a dry state for 1 min in a farinograph (=kneader) and kneaded for 8 min after pipetting 6.4 ml dist. water. The dough was taken out quickly and weighed for a first time (E1). A first fermenting period of zo min at 31 C. took place in a water vapor saturated proofing cabinet. After taking the dough out of the cabinet a second weighing (E2) took place as well as the homogenization. The ball-shaped blank was put into a round molder (Rundwirker) and turned for 10 turns with a superimposed pestle. It was drawn through a pasta/noodle roller, folded two times without inclusion of air and again turned in the round molder for 20 turns. Finally a forming by hand was performed. After the homogenization a second fermentation period of 35 min follows.
[0186] For samples (2a-c) additionally 10 l of a geranyl glucoside (GG) solution (c=98 mg/ml) were quickly pipetted after the addition of water into the kneader.
[0187] In the control (3) no glucoside was added during preparation of the dough. The addition of 10 l glucoside solution takes place for testing on impurities of the solution by geraniol immediately before reconditioning for the measurement to the baked, frozen bread.
[0188] In the recovery (4) no glucoside was added during preparation of the dough. The addition of 170 l geraniol solution (1.24 mM) takes place for recovery of geraniol (0.0124 mol/g bread, corresponding to a conversion of 6% GG) immediately before freezing with liquid nitrogen into the interior of the cooled bread.
[0189] Baking
[0190] Baking took place on a tray in the oven for 10 min at 230 C. Before and after putting the samples vapor was put into the closed oven, respectively (spraying and evaporating of 25 ml dist. H.sub.2O).
[0191] Cooling/Post-Processing
[0192] The baked bread was left standing for 60 min at room temperature and subsequently frozen in liquid nitrogen. Storage of the breads took place at 18 C. until the conditioning/preparation.
[0193] Result
[0194] For the bread samples the following weights of Table 5 were recorded:
TABLE-US-00005 TABLE 5 Mass of bread samples of baking test 1 Sample 1 2a 2b 2c 3 4 E1 in g 15.9 15.5 15.7 15.9 15.7 16. E2 in g 15.9 15.5 15.7 16. 15.7 16.
[0195] After baking the breads were compared according to their appearance and smell in order to check first perceivable differences. All 5 breads showed a desired ball-like form of about same size. Inflation during the two-time fermentation only took place to a very small degree. Blank (negative) test (1.1), control (1.3) and recovery (1.4) showed a pale, hardly browned crust. The sample blanks (1.2a-c) had dark, brown spots. These came possibly from an increased content of glucose after release of the added glucoside and the increasingly taking-place Maillard-reaction resulting therefrom. Sample (2b) showed the coloration most pronounced, what indicates slightly changed conditions during baking.
[0196] The results are shown in
[0197] The sensory observations regarding the individual samples were in accordance to the expectations according to the different sample preparations with and without GG-dosage.
[0198] The analytical examination of the breads via GC resulted in the following measurement values of Table 6. For GC analysis, a Thermo Finnigan Trace DSQ mass spectrometer coupled to a Thermo Finnigan Trace GC was used. The instrument was equipped with a BPX5 20 M fused silica capillary column (30 m0.25 mm i.d., 0.25 m film thickness). Helium gas flow rate was 1.1 ml/min. The injection port was operated in splitless mode. The injector temperature was 250 C., the ion source and interface temperatures were kept at 230 and 280 C., respectively. The GC parameters were as follows: initial temperature 40 C. for 3 min, increased to 100 C. at a rate of 10 C./min and from 100 C. to 190 C. at a rate of 30 C./min. The EI-MS ionization voltage was 70 eV. Mass data was acquired in the range of 30-300 m/z. Compounds were identified by comparing their mass spectra and retention indices to the NIST mass spectra library and reference compounds.
[0199] The blind sample 1 as well as control 3 showed no geraniol sign/peak. The negative proof of control 3 (post-addition of GG stock solution after the baking process into the cooled bread) showed that no residue contents of geraniol due to impurities or decomposition processes were present in the GG stock solution and falsifications/errors could be excluded. The contents of geraniol in the bread samples therefore were determined directly from the peak areas of the extract measurements of the samples, with the results shown in Tables 7 and 8.
[0200] Averaging resulted in the following:
[0201] With a recovery factor of 0.30, calculated from adding geraniol to the recovery sample before freezing (4), quite stable measurement results were achieved for the respective samples with 4.7% (2c) to 5.1% (2b) conversion of GG to geraniol in the baking test with flour dough. The slightly deviating result of sample 2b is most likely related to the changed conditions during the bread preparation. It seems contradictory that the named sample has lower contents of geraniol in spite of a stronger browning. Since the difference could not be tackled exactly all three results were taken for averaging. The calculated mean value of the triplicate determination was therefore 4.8% conversion from 3.2 mol GG in 17 g bread based on flour dough. The cited conversion was already perceivable as fruity component of the crust aroma after baking.
[0202] Baking Test 2Simple Yeast Dough
[0203] As samples dough blanks of 10 g flour each were used. A negative control (flour, salt, sugar, yeast and water), three samples (additionally geranyl glucoside) and a recovery (addition of geraniol to the bread before freezing according to a postulated conversion of glucoside of 6% in order to determine losses during the analytical procedure) were used. Several process steps were carried out according to standardized specifications, separate for each of the five blanks.
[0204] Preparing the Dough/Paste:
[0205] For a blank/blind test (i) 9.98 g well-mixed flour were weighed into a glass vessel. 0.2 g NaCl and 0.1 g sucrose were added and the mixture was put in the kneader. An addition of 0.7 g (cooled) baking yeast directly to the kneader followed. The mixture was at first kneaded in a dry state for 1 min and kneaded for 8 min after pipetting 6.3 ml dist. H.sub.2O. All further steps including the work-up and sample taking ware carried out according to the sample with flour dough (1). In the samples (2a-c) 10 l GG-solution were pipetted directly after the addition of water to the kneader. The preparation of the recovery (3) was carried out analogous to the blind sample. After cooling for one hour 170 l geraniol solution were injected herein into the breadcrumb directly before freezing with liquid nitrogen.
[0206] Result
[0207] For the bread samples the following weights of Table 9 were recorded:
TABLE-US-00006 TABLE 9 Mass of bread samples of baking test 2 Sample 1 2a 2b 2c 3 E1 in g 16.3 16.7 16. 16. 16.94 E2 in g 16.3 16.5 16. 16.7 16.68
[0208] All five breads showed a bigger volume and stronger coloring of the crust compared to the baking test based on flour dough. The inflating during the fermentation process is attributed to the formation of gases due to the added yeast, which are held back due to the net-like dough structure. The strong brown color resulted either from an increased glucose and protein content or stronger heating processes in the crust, which are related to the changed bread structure. Striking was the irregular browning of sample zb in contrast to the two other bread samples. The reason for this is an erroneous production of the bread. Contrary to the specification two homogenization steps were carried out during preparation of the dough, which lead to a stronger densification of the bread blank. As a result also the degree of the release of geraniol is influenced to an unknown degree due to the changed thermo and pyrolysis conditions. This circumstance had to be taken into account during evaluation of the baking test.
[0209] The results are shown in
[0210] The measurement of blind sample1 showed no geraniol peak. The amounts of geraniol in the bread samples are shown in Table 11.
[0211] A recovery factor of 0.33 was found from the quantification of the recovery sample. In the samples of this baking test the strong variation between the measurement results of the three breads was apparent, whose conversion was between 5.1% (2a) and 11.8% (2b). Since the higher result for sample 2b could be attributed to the deviations during the preparation of the bread, only samples 2a and 2c were taken into account during averaging of the results, the results of which are shown in Table 12.
[0212] The calculated mean value of the two-fold determination resulted in a conversion of 6.1% from 3.2 pmol GG in 17 g bread on the basis of a simple yeast dough. The obtained results were 1.2% higher than the one of baking test 1 with bread from flour dough (4.9%).
[0213] Baking Test 3Standard Yeast Dough
[0214] As samples dough blanks of 10 g flour each were used. A negative control (flour, salt, sugar, fat, yeast, L-ascorbic acid and water), three samples (additionally geranyl glucoside) and a recovery (addition of geraniol to the bread before freezing according to a postulated conversion of glucoside of 6% in order to determine losses during the analytical procedure) were used. Several process steps were carried out according to standardized specifications, separate for each of the five blanks.
[0215] Preparing the Dough/Paste:
[0216] For a blank/blind test (i) 9.98 g well-mixed flour were weighed into a glass vessel. 0.2 g NaCl and 0.1 g sucrose and 0.1 g palm fat were added and the mixture was put in the kneader. An addition of 0.7 g (cooled) baking yeast directly to the kneader followed. The mixture was at first kneaded in a dry state for 1 min and kneaded for 8 min after pipetting 6.0 ml dist. H.sub.2O and 0.3 ml ascorbic acid solution.
[0217] All further steps including the work-up and sample taking ware carried out according to the sample with flour dough (1). In the samples (2a-c) 10 l GG-solution were pipetted directly after the addition of water and ascorbic acid solution to the kneader. The preparation of the recovery (3) was carried out analogous to the blind sample. After cooling for one hour 170 l geraniol solution were injected herein into the breadcrumb directly before freezing with liquid nitrogen.
[0218] Result
[0219] For the bread samples the following weights of Table 13 were recorded:
TABLE-US-00007 TABLE 13 Mass of bread samples of baking test 3 Sample 1 2a 2b 2c 3 E1 in g 17.0 16. 16. 16. 16.90 E2 in g 16. 16. 16. 16. 16.87
[0220] All five breads showed a similarly increased volume after baking as in the baking test with simple yeast dough. The breads were all colored brown uniformly and strongly, so that no difference could be seen between the samples with and without precursor. The results are shown in
[0221] The measurement of blind sample 1 again showed no geraniol peak.
[0222] From the calculation the following values of Table 15 are obtained.
[0223] A recovery factor of 0.68 was obtained from the quantification of the recovery sample. The samples showed sufficiently constant measurement values between 5.5% (2a) and 6.1% (2b) of GG in this experiment.
[0224] The averaging of the triple determination resulted in the values given in Table 16.
[0225] The calculated mean value of the triplicate determination resulted in a conversion of 5.7% from 3.2 pmol GG in 17 g bread based on standard yeast dough. It was thus a little under the value of conversion determined in baking test 2 (simple yeast dough without ascorbic acid) of 6.1% and above the one of baking test 1 (flour dough) of 4.8%, with the results summarized in Table 17.
[0226] In total similarly low conversion rates of geranyl glucoside for the differently prepared baking tests were obtained. The bread samples based on yeast dough showed similarly pronounced results with 6.1% (simple yeast dough) and 5.7% conversion (standard yeast dough). In the bread this translated to a content of geraniol of 1.77 and 1.67 mg/kg, respectively. Bread based on flour dough showed a result about 1% lower with a conversion of 4.8% GG, what corresponds to a content of 1.40 mg/kg geraniol in the baked bread.
[0227] A statement if the determined conversion of geranyl glucoside to aromatic geraniol can also be perceived by untrained consumer resulted in the following sensory test.
[0228] Sensory Test
[0229] In order to test the influence of the amount of geraniol released in the baking test on the total aroma of the breads and its impression on the consumer an orthonasalic sensory test was carried out. In a triangle test with untrained panelists breads based on standard yeast dough with and without addition of GG were tested for a perceivable difference.
[0230] Bread made of standard yeast dough was tested analogous to the amount of 100 ppm geraniol (corresponds to 1 mg/10 g) used until now in raw bread dough and its difference to a blind sample. As sample dough blanks of 50 g flour each based on standard yeast dough (baking test 3standard yeast dough) were used (see
[0231] Preparing the Dough/Paste:
[0232] For the blind sample A 94.9 g well-mixed flour were weighed into a glass vessel. 1.0 g NaCl, 0.5 g sucrose and 0.5 g palm fat were added and the mixture was put in the kneader. An addition of 3.5 g (cooled) baking yeast directly to the kneader followed. The mixture was at first kneaded in a dry state for 1 min and kneaded for 8 min after addition of 30.o ml dist. H.sub.2O and 1.5 ml ascorbic acid solution. For the positive sample B additionally 50 l of a GG stock solution (c=98 mg/ml) were pipetted quickly after the addition of water and ascorbic acid to the kneader.
[0233] The dough was taken out quickly and weighed a first time (E1). A first fermenting period of 20 min at 31 C. took place in a water vapor saturated proofing cabinet. After taking the dough out of the cabinet a homogenization took place. The ball-shaped blank was put into a round molder and turned for 10 turns. It was rolled flat to a height of 1 cm, folded two times without inclusion of air and again turned in the round molder for 20 turns. Finally a forming by hand to form a roll was performed. This roll was put into a small loaf pan made of aluminum and weighed again (E2). After the homogenization a second fermentation period of 40 min followed.
[0234] Baking
[0235] Baking took place in the oven for 20 min at 230 C. Before and after putting the blank vapor was put into the closed oven, respectively (spraying and evaporating of 25 ml dist. H.sub.2O).
[0236] Cooling/Preparation
[0237] The baked bread was left standing for 6o min at room temperature and subsequently prepared for the sensory test. For testing the crust it was taken off with a knife, simultaneously shredded and 1 g each weighed into an airtight sensory vessel made of glass with ground joint and cover/lid. For preparing the crumb the bread that was totally freed from the crust was at first cut into 1.5 cm thick slices using a bread slicer and separated with an electronic knife into cuboids with a size of about 1.55.02.0 cm.sup.3 and a weight of 4.0 g. A cuboid each was put into an airtight sensory vessel made of glass with ground joint and cover/lid. Directly thereafter the sensory test took place.
[0238] Test
[0239] The process of the sensory test followed a simple triangle test with a test for differences based on DIN/ISO 4120 (Busch-Stockfisch, 2008). Bread crust and bread crumb of two charges of bread A and B were respectively tested in a triad of three filled sensory vessels from 18 panelists each orthonasal for a perceptible difference, wherein two vessels contained identical samples and the third was filled differently. All three samples were encoded with three-digit number codes. The following sample assemblies resulted:
TABLE-US-00008 Crust: B B A (937) (482) (561) and A A B (561) (208) (482) Crumb: A B A (391) (256) (847) and B A B (256) (391) (408)
[0240] Each panelist carried out two tests following each other, first for the sensory test of the crust, then for the crumb. After-tasting of the vessels within a test was allowed, a decision was forced (Forced-Choice-Principle). Following the test all singular results were brought together and evaluated statistically.
[0241] Result
[0242] In a basic protocol the results of the single protocols were brought together and evaluated statistically to test for a significance of the difference.
[0243] For this purpose the extent of the -risk/-error was determined based on the relation of correct and wrong answers: the probability of the conclusion that a perceivable difference is present although this is not the case (also termed error of the first order/type, significance lever or probability of an erroneous rejection).
[0244] The -risk was determined using suitable significance tables.
[0245] Valid is the following:
[0246] <0,05 (5%) n.s.=not significant =<0.05 (5%)
[0247] =0,05 (5%) s=significant
[0248] =0,01 (1%) h.s.=highly significant
[0249] =0,001 (0.1%) s.h.s.=very highly significant
[0250] The test showed the following result of Table 18.
[0251] The evaluation of both tests showed that most of the panelists could perceive a difference between the blind sample and bread. When checking the significance level an -value of 1% resulted in the sensory test of the crumb with 12 correct answers for 18 panelists. This confirmed that the breads actually could be differentiated according to their smell and no difference that was not present was erroneously perceived. In the test for difference of the aroma of the crust an -value of 0.1% was achieved with 13 correct answers for also 18 panelists, and thus a highly significant result (see
[0252] The application of geranyl glucoside as additive of bread in the described way and an appropriate dosing is thus suitable for producing an aromatized food. It could not be determined with the test if the fruity odor quality would be accepted by the consumer and, if yes, in which amounts. The results of the preference test clarified this.
[0253] Taste Modulation
[0254] The glycosylated aroma agents also have taste-modulating properties. The glycosylation can reduce or prevent a bitter taste or function as taste enhancer. In addition, the enhanced stability of the glycosides is also advantageous in the application as taste modulators.
Example 6
[0255] The experiments of Example 5 were repeated using furaneol instead of geraniol with amounts of the aroma at a factor 2 to 5 increased. The results of Example 5 could be confirmed with these experiments.
[0256] Repellent
Example 7
[0257] Glycosides that Can Be Activated for Application as Repellent with Long-Term Effect
[0258] A skin cream with e.g. citronellol glucoside can be e.g. used as repellent for mosquitoes (subfamilies Anophelinae and Culicinae). Therein the free citronellol is released by enzymes of skin bacteria from the citronellol glucoside over a prolonged period of time and enables a long-lasting mosquito protection. A similar effect can be achieved by taking up the citronellol glucoside in a candy orally and releasing the citronellol during digestion, which then is released in the whole body. This application is e.g. to be applied preferably during stays in the tropics to effectively repel mosquitoes that transfer sicknesses.
[0259] Construction Materials
Example 8
[0260] Glycosides that Can Be Activated for Use in Controlling Mold
[0261] Construction materials, e.g. modern stones for building walls or insulation mats, etc., are added with the glycosides. Due to the fungicidal effect which only is activated enzymatically the mold can be controlled effectively. Only when mold wants to form and thus releases enzymes itself it kills itself this way.
[0262] Electronics
Example 9
[0263] Glycosides that Can Be Activated for Odor TV
[0264] The fragrances that can be activated can be stored in an inactive state for a very long time in contrast to the free fragrances. This predestines them for the application in odor TV (4D TV), wherein they can then be selectively released by electric heating.
Example 10
[0265] Glycosides Used for an Electronic Sensor System
[0266] The fragrances that can be activated can be used for an electronic sensor system. After activation by a trigger such as enzymes, temperature, or pH the volatile flavors/odors or the released sugars of the glycosides act as a signal for an electronic sensor system and can be measured with an electronic sensor.
[0267] Household Products
Example 11
[0268] Artificial Flowers and Plants
[0269] One further example is the use of inactivated fragrance precursors in an artificial flower. This consists of decorative artificial flower petals which surround a surface, e.g. a circle, or ball consisting of an absorbent material functioning as depot (see
[0270] When this artificial flower is put into a water container, e.g. a vase, water is lead through the absorbent material of the stem to the depot, in which the water enables the glycosidase, e.g. glucosidase to cleave the sugar of the fragrance precursor. The fragrance molecule thus formed is volatile and thus gets into the air, so that the artificial flower smells.
[0271] An experimental setup (proof-of-principle) was carried out as follows:
[0272] Solutions of different amounts of geranyl glucoside in ethanol were put on carrier materials with each a size of 2 cm.sup.2, respectively, and dried. Afterwards 5 to 10 mg of glucosidase were added and pasted over with a carrier material. In a setup the amounts described in Table 19 were used.
TABLE-US-00009 TABLE 19 Experimental setup of example 11 Glucosidase Geranylglucosid Water Perceptible odor 5 mg 2 mg 1 ml weak 10 mg 5 mg 1 ml significant 10 mg 10 mg 1 ml significant 10 mg 1 ml 2 mg 1 ml 10 mg 5 mg
[0273] The loaded carrier materials were then wetted with 1 mL water. With a usage of 5 mg geranyl glucoside a distinctly perceptible odor could be smelled. With 2 mg, a weak odor could be achieved, and without either glucosidase or geranyl glucoside or water no odor could be noticed, as expected. A follow-up experiment was to rewet already used carrier materials after drying again. Also here again a volatile odor was perceived. The developed aromatic flowers thus can be used repeatedly and are not disposable articles.
[0274] In a further example an artificial flower was recreated, which can be seen in
[0275] Further embodiments of the embodiment are: [0276] The flower petals have colors that can be activated and that only become colored by water. [0277] The depot should be ball-shaped (full sphere or coated semi-sphere) so that bigger amounts of the fragrance that can be activated and the enzyme can be included. This way whole room can be scented. [0278] Using smart paper a spatial change can be accomplished through feeding water and e.g. the opening of a closed flower can be mimicked. [0279] Also origami-components are possible. [0280] Floating water lilies would not need the stem. [0281] Glycoside mixtures should be used so that the resulting fragrance can be smelled by as many people as possible.
[0282] In addition, the principle of artificial flowers can be transferred to other articles, e.g. scented balls which only release the fragrance after introduction into water, coated colored waterfalls for fountain fragrance fireworks (Brunnenduftfeuerwerke), self-adhering stripes that are furnished with an absorbent layer and can be adhered everywhere as fragrance dispensers after wetting, e.g. on promotional items.
[0283] Further Applications
[0284] This list of examples is not exhaustive. From Table 4 further applications can be derived. The basis is always the activation with subsequent effect, like e.g. aromatic, smelling, fungicidal, bactericidal or repelling for mosquitoes.
[0285] New Glycosyltransferases and Glycosides
Example 12
[0286] Biotechnological Production of Furanon Glycosides Using Glycosyltransferases
[0287] Glycosylated natural substances are important components of foods, pharmaceutical and cosmetic products due to their manifold physiological activities. For example, glycosylated diterpenes, steroids and flavonoids are used as sweeteners (steviosides, glycyrrhizin, neohesperidin) in the food industry, while steroid and antibiotic glycosides are used as medicines and glycoside extracts as cosmetic agents. Chemical-synthetic glycosylation reactions of the take place in the presence of heavy-metal containing catalysts, so that therefore recently biocatalysts are sought which can catalyze this reaction alternatively. Products obtained via biocatalysts correspond to the natural substances, are free of heavy metal residues and can therefore be declared as natural according to present law, which is a direct advantage for the consumer and for industry an indirect advantage in marketing. In nature, regio- and enantioselective sugar transfers are catalyzed by nucleoside diphosphate carbohydrate (e.g. UDP glucose) depending glycosyltransferases (UGTs). Glycosyltransferases that convert low molecular substrates transfer sugar on a plurality of acceptors like hormones and secondary metabolites as well as biotic and abiotic chemicals and toxins. The enzymes are coded in the different organisms by a big multigene family and can be identified by a common motif in their primary sequence (PSPG Box, Plant Secondary Product Glycosyltransferase). The transfer of a carbohydrate residue to a mostly lipophilic acceptor changes its chemical properties and its bioactivity and can facilitate the access to cellular membrane transporter systems. In vitro studies show that a singular UGT protein can glycosylate several substrates of different origin, but also that several UGTs can glycosylate the same substrate, which makes the identification of substrate specificity difficult to predict and thus impedes it.
[0288] Due to the sequencing of genomes of different organisms on a huge scale now continually many new UGT sequences are being published. During sampling of the UGT gene family of plant species which are particularly known for the production of glycosides sequences could be isolated now which code for UGT enzymes which catalyze the glycosylation of aromas/aroma agents very efficiently.
[0289] Own Technical Solution
[0290] In the search for efficient biocatalysts which can be particularly used for the production of aroma glycosides the UGT gene family of plant species Vitis vinifera (grape vine) and Fragaria x ananassa (strawberry) was examined. For this at first the gene sequences were searched that are strongly expressed in the fruits of the plant species. These were subsequently isolated, expressed in the host organism Escherichia coli, and the enzymatic activity toward different potential substrates was determined. At least three of the coding nucleic acid sequences (FaGTs1-5, FaGTs1-13 and VvdGT13, see appended sequences) catalyze the formation of aroma glycosides very efficiently.
[0291] The Essential New
[0292] During the transfer of the plant gene sequence to E.coli unexpectedly an additional sequence was obtained. The corresponding protein sequence shows at positions 222 and 323 in place of histidine and aspartic acid the amino acids tyrosine and glutamic acid. This sequence was termed by us FaGTs1-13 and included in further experiments. A result thereof was that this new sequence has a 3o% increased activityin relation to molar conversioncompared to sequence FaGTs1-5 (see
[0293] In
[0294] Unexpectedly, the biocatalysts FaGTs1-5 and FaGTs1-13 produced the glucosides of homofuraneol (
TABLE-US-00010 TABLE 20 Pipetting scheme for the in vitro assay Tris buffer (0.,1M, pH 7.5) 100 l Substrate (60 mM) 2 l UDP-glucose (.sup.12C) 0.2 mM 49.9 l UDP-glucose (.sup.14C) 0.3 mM 0.1 l Enzyme 2 g Ad 200 l with H2O
1 h at 30 C. incubation
[0295] The reaction was started by adding UDP-glucose and stopped after incubation with 1 ml n-butanol. After vortexing for at least 15 s the reaction mixture was centrifuged 2 min at 12 000g for separation of the phases, and 800 l of the upper organic phase containing the product were now transferred to 2 ml scintillation cocktail (Ultima-Flo AF, PerkinElmer). Non-converted UDP glucose remains in the aqueous phase and thus does not contribute to the radioactivity intensity in the sample (organic phase).
[0296] In whole cell fermentations wherein resting cells were incubated in Mg minimal medium (22 mM KH.sub.2PO.sub.4, 47.8 mM Na.sub.2HPO.sub.4.2H.sub.2O, 19 mM NH.sub.4Cl, 8.6 mM NaCl, 0.1 mM CaCl.sub.2, 2 mM MgSO.sub.4, 1% glucose, pH 7.0) with the furanones more than 1 g/l furanon glycosides could be biotechnologically produced without any optimization until now. The simple production of biocatalysts in big amounts, the in vivo production of the co-substrate UDP-glucose in the cells and the abundant product amounts facilitate now the possibility to produce the target substances in an economical scale for industrial applications.
[0297] The products described herein enable for the first time the appropriate, biologically, physically and pH chemically controlled activation of flavorings and fragrances instead of the physical-chemical release of flavorings and fragrances used until now.
[0298] The glycosyltransferase method described herein is highly innovative. It is based on a natural principle, uses modern methods of biotechnology and is already very efficient on a laboratory scale. It is possible to produce the required amounts of flavoring and fragrance glycosides with it. It is unparalleled and in an unique position.
[0299] All references cited in this specification are herewith incorporated by reference in their entirety. The present method has been described in detail with reference to certain embodiments and specified by examples. However, a skilled person will acknowledge that also other modifications, changes, or similar alterations can be made to the present invention without deviating from the spirit of the invention.
TABLE-US-00011 Sequenceprotocol SEQ-ID1:FaGTS1-5 ATGAAGAAAGCAGAGCTAGTGTTCATCCCTGCACCAGGAGCCGGCCACCT TGTGTCAGCCTTGCAATTCGGAAAGCGTCTGCTTCAGCGAGATGATCGAA TTTCAATCACAGTTCTTGCCATCAAATCAGCAGCCCCTTCATCTTTAGGT TCATACACAGAAGCCCTTGTAGCTTCCGAGTCCCGTCTCCAACTCATTGA CGTCCCTCAAGCTGAGCTCCCTCCATTAGAGTTTGCAAAGTCACCAGCTA AGTTTTTCATTCTAAACATTGAGAACCATGTTCCTAATGTCAGAGAGGCC CTCACTAACTATGTCTCATCTAAGCAAGACTCGGTTCCAATTGTTGGAGT GGTTCTTGATTTCTTCTGTGTCTCCATGATTGATGTGGTCAATGAATTCA ATCTCCCTTCTTATCTATTCATGACAAGCAATGCAGGGTATCTTTCTTTC AAGTTCCACTTTCCGGCGCAGGATAGCCGGACCGGTCGGCCGCCTAAAGA CTCCGATCCTGATTGGTTAGTCCCCGGTATTGTCCCCCCTGTTCCTACCA AAGTTTTGCCTGTGTCTTTAACTGATGGTAGCTACTATAATTATCTTGGG GTTGCTTCGAGATTTAGAGAGGCCAAAGGTATCATAGCAAATACATGTGT TGAGCTAGAGACACATGCGTTCAACTCTTTTGCTGAAGATCAAACTACGC CTCCGGTGTACCCAGTTGGACCGGTGCTTGATCTCAACGATGGTCAGGCT CGGTCCAATTTAAACCAGGCGCAGCGTGACAAGATCATCAGCTGGCTTGA TGATCAGCCTGAAGAGTCTGTTGTGTTCTTATGCTTTGGAAGCATGGGGA GCTTTACTGAAGCACAAGTGAAGGAGATAGCTCTGGGCCTTGAGCAGAGT GGGCAGAGGTTCTTGTGGTCTTTGCGTTTGACACCACCAAAGGGGAGTAA AAGTTTGAGTCCTGTGGACTGCTCGAACCTTGAGGAAGTATTGCCGGATG GATTCTTGGAGAGGACTAGAGAAAAGGGACTGATATGCGGGTGGGCGCCG CAGGTGGACGTCTTGTCACACAAGGCAACCGGAGGCTTTGTGTCGCATTG TGGGTGGAACTCGATCTTGGAGAGCTTGTGGCATGGCGTGCCGATTGTGA CATGGCCTATGTATGCTGAGCAACAGCTGAATGCGTTTCGATTGGTGAAG GAGATGGGGTTGGGATTGGAGATGAGGTTGGATTACAAGCGAGGTGGTGA TGAGGTTGTGAAGGCAGATGAGATTGGGAAGGCTGTAGCTAGTGTGATGG AGAACAGTGAGGTGAGGAAGAAAGTGAAAGAAATTGGGGTGGTGTGCAGA AAAGCTGTAGAGGATGGAGGGTCTTCTTCTGTTTCACTTGGAAGGTTCAT TGAAGATGTGATGAGGAATCATTTTGGTTCTGAGTAA SEQ-ID2:FaGTS1-13 ATGAAGAAAGCAGAGCTAGTGTTCATCCCTGCACCAGGAGCCGGCCACCT TGTGTCAGCCTTGCAATTCGGAAAGCGTCTGCTTCAGCGAGATGATCGAA TTTCAATCACAGTTCTTGCCATCAAATCAGCAGCCCCTTCATCTTTAGGT TCATACACAGAAGCCCTTGTAGCTTCCGAGTCCCGTCTCCAACTCATCGA CGTCCCTCAAGCTGAGCTCCCTCCATTAGAGTTTGCAAAGTCACCAGCTA AGTTTTTCATTCTAAACATTGAGAACCATGTTCCTAATGTCAGAGAGGCC CTCACTAACTATGTCTCATCTAAGCAAGACTCGGTTCCAATTGTTGGAGT GGTTCTTGATTTCTTCTGTGTCTCCATGATTGATGTGGTCAATGAATTCA ATCTCCCTTCTTATCTATTCATGACAAGCAATGCAGGGTATCTTTCTTTC AAGTTCCACTTTCCGGCGCAGGATAGCCGGACCGGTCGGCCGCCTAAAGA CTCCGATCCTGATTGGTTAGTCCCCGGTATTGTCCCCCCTGTTCCTACCA AAGTTTTGCCTGTGTCTTTAACTGATGGTAGCTACTATAATTATCTTGGG GTTGCTTCGAGATTTAGAGAGGCCAAAGGTATCATAGCAAATACATGTGT TGAGCTAGAGACATATGCGTTCAACTCTTTTGCTGAAGATCAAACTACGC CTCCGGTGTACCCAGTTGGACCGGTGCTTGATCTCAACGATGGTCAGGCT CGGTCCAATTTAAACCAGGCGCAGCGTGACAAGATCATTAGCTGGCTTGA TGATCAGCCTGAAGAGTCTGTTGTGTTCTTATGCTTTGGAAGCATGGGGA GCTTTACTGAAGCACAAGTGAAGGAGATAGCTCTGGGCCTTGAGCAGAGT GGGCAGAGGTTCTTGTGGTCTTTGCGTTTGACACCACCAAAGGGGAGTAA AAGTTTGAGTCCTGTGGAATGCTCGAACCTTGAGGAAGTATTGCCGGATG GATTCTTGGAGAGGACTAGAGAAAAGGGACTGATATGCGGGTGGGCGCCG CAGGTGGACGTCTTGTCACACAAGGCAACCGGAGGCTTTGTGTCGCATTG TGGGTGGAACTCGATCTTGGAGAGCTTGTGGCATGGCGTGCCGATTGTGA CATGGCCTATGTATGCTGAGCAACAGCTGAATGCGTTTCGATTGGTGAAG GAGATGGGGTTGGGATTGGAGATGAGGTTGGATTACAAGCGAGGTGGTGA TGAGGTTGTGAAGGCAGATGAGATTGGGAAGGCTGTAGCTAGTGTGATGG AGAACAGTGAGGTGAGGAAGAAAGTGAAAGAAATTGGGGTGGTGTGCAGA AAAGCTGTAGAGGATGGAGGGTCTTCTTCTGTTTCACTTGGAAGGTTCAT TGAAGATGTGATGAGGAATCATTTTGGTTCTGAGTAA SEQ-ID3:VvdGT13 ATGGCTGAAAAACCTCCCCACATAGCCATTCTCCCGACCCCTGGCATGGG TCACCTCATCCCTCTCATTGAACTAGCCAAACGCCTCGTCACCCACCATG GATTCACAGTCACTTTCATCATCCCCAACGATAATTCTTCTCTCAAAGCC CAGAAGGCCGTGCTCCAGAGCCTCCCTCCCAGCATAGACTCCATTTTTCT TCCTCCGGTTAGTTTTGATGACTTGCCGGCGGAGACGAAGATCGAGACTA TGATTTCTCTCACTGTGGTTCGGTCACTTTCCCATCTCCGGAGCTCGCTG GAGTTGCTGGTTTCGAAGACCCGAGTGGCGGCGCTCGTCGTCGATCTCTT CGGAACCGACGCGTTCGACGTCGCGGCGGAGTTCGGGGTGGCGCCGTACA TTTTCTTCCCGTCGACGGCGATGGCTCTCTCGCTGTTTCTGTTCCTTCCG AAGCTGGATGAGATGGTGGCGTGCGAATTTCGGGACATGAATGAACCGGT GGCGATTCCTGGTTGCGTGCCGGTCCACGGCTCGCAGCTGCTCGACCCGG TTCAGGATAGGAGGAACGACGCTTACAAGTGGGTTCTACACCACACCAAG AGATATCGACTGGCTGAAGGGATAATGGTGAATAGCTTCATGGAGTTGGA GCCTGGACCGCTCAAGGCTCTGCAGACACCCGAACCGGGTAAACCGCCGG TCTACCCGGTCGGACCGCTGATAAAGAGGGAGTCGGAGATGGGATCCGGT GAGAACGAGTGTTTGAAGTGGCTGGACGACCAGCCACTTGGCTCCGTCCT ATTCGTCGCTTTCGGGAGCGGTGGGACCCTCCCCAGTGAGCAATTAGATG AGCTGGCCTTGGGCTTAGAGATGAGTGAGCAAAGATTTTTGTGGGTAGTG AGGAGCCCTAGTCGTGTGGCTGATTCCTCATTCTTCAGTGTCCATTCTCA AAATGACCCTTTCTCTTTCTTACCTCAAGGGTTTGTAGATAGAACCAAAG GGCGGGGCCTCTTGGTGTCATCCTGGGCACCACAGGCTCAAATTATTAGC CACGCATCCACCGGAGGGTTCTTGTCTCATTGCGGGTGGAACTCCACTCT CGAGAGCGTTGCCTGCGGTGTCCCCATGATCGCTTGGCCGCTCTACGCCG AGCAAAAAATGAACGCAATAACATTAACCGACGACTTAAAAGTGGCATTG AGGCCAAAAGTTAACGAAAATGGTCTAATCGATCGTAATGAAATTGCTCG AATTGTTAAGGGTCTGATGGAAGGGGAAGAAGGAAAGGGTGTACGCAGTC GAATGAAGGACCTTAAGGACGCCTCCGCAAAAGTTTTGAGCCATGATGGG TCTTCTACAAAGGCACTCTCAACCGTGGCTCAAAAATGGAAGGCTCACAA GAATTATTAG SEQ-ID4: MKKAELVFIPAPGAGHLVSALQFGKRLLQRDDRISITVLAIKSAAPSSLG SYTEALVASESRLQLIDVPQAELPPLEFAKSPAKFFILNIENHVPNVREA LTNYVSSKQDSVPIVGVVLDFFCVSMIDVVNEFNLPSYLFMTSNAGYLSF KFHFPAQDSRTGRPPKDSDPDWLVPGIVPPVPTKVLPVSLTDGSYYNYLG VASRFREAKGIIANTCVELETHAFNSFAEDQTTPPVYPVGPVLDLNDGQA RSNLNQAQRDKIISWLDDQPEESVVFLCFGSMGSFTEAQVKEIALGLEQS GQRFLWSLRLTPPKGSKSLSPVDCSNLEEVLPDGFLERTREKGLICGWAP QVDVLSHKATGGFVSHCGWNSILESLWHGVPIVTWPMYAEQQLNAFRLVK EMGLGLEMRLDYKRGGDEVVKADEIGKAVASVMENSEVRKKVKEIGVVCR KAVEDGGSSSVSLGRFIEDVMRNHFGSE SEQ-ID5: MKKAELVFIPAPGAGHLVSALQFGKRLLQRDDRISITVLAIKSAAPSSLG SYTEALVASESRLQLIDVPQAELPPLEFAKSPAKFFILNIENHVPNVREA LTNYVSSKQDSVPIVGVVLDFFCVSMIDVVNEFNLPSYLFMTSNAGYLSF KFHFPAQDSRTGRPPKDSDPDWLVPGIVPPVPTKVLPVSLTDGSYYNYLG VASRFREAKGIIANTCVELETYAFNSFAEDQTTPPVYPVGPVLDLNDGQA RSNLNQAQRDKIISWLDDQPEESVVFLCFGSMGSFTEAQVKEIALGLEQS GQRFLWSLRLTPPKGSKSLSPVECSNLEEVLPDGFLERTREKGLICGWAP QVDVLSHKATGGFVSHCGWNSILESLWHGVPIVTWPMYAEQQLNAFRLVK EMGLGLEMRLDYKRGGDEVVKADEIGKAVASVMENSEVRKKVKEIGVVCR KAVEDGGSSSVSLGRFIEDVMRNHFGSE SEQ-ID6: MAEKPPHIAILPTPGMGHLIPLIELAKRLVTHHGFTVTFIIPNDNSSLKA QKAVLQSLPPSIDSIFLPPVSFDDLPAETKIETMISLTWRSLSHLRSSLE LLVSKTRVAALVVDLFGTDAFDVAAEFGVAPYIFFPSTAMALSLFLFLPK LDEMVACEFRDMNEPVAIPGCVPVHGSQLLDPVQDRRNDAYKWVLHHTKR YRLAEGIMVNSFMELEPGPLKALQTPEPGKPPVYPVGPLIKRESEMGSGE NECLKWLDDQPLGSVLFVAFGSGGTLPSEQLDELALGLEMSEQRFLWVVR SPSRVADSSFFSVHSQNDPFSFLPQGFVDRTKGRGLLVSSWAPQAQIISH ASTGGFLSHCGWNSTLESVACGVPMIAWPLYAEQKMNAITLTDDLKVALR PKVNENGLIDRNEIARIVKGLMEGEEGKGVRSRMKDLKDASAKVLSHDGS STKALSTVAQKWKAHKNY