ANTIBODY-VACCINE ENGINEERED CONSTRUCTS (AVEC)

20180126001 · 2018-05-10

    Inventors

    Cpc classification

    International classification

    Abstract

    Hereby, we disclose and claim, the concept, designs, enabling technologies, and utility for therapy of patients suffering from cancer, of a novel class of biomolecularly engineered, synthetic molecules: antibody-vaccine engineered constructs (AVEC). They comprise the main functional domains (antibodies and vaccines) and the supporting domains (linkers and reporters). Their mechanisms of actions rely upon antibody dependent redirecting, accelerating, and amplifying of the prophylactic or natural vaccination induced immune response (ADRAAVIR) from the initially elicited by vaccination towards the finally aimed by therapies. The routes of administration to the patients, pharmacokinetics, pharmacodynamics, pharmacogenomics, and therapeutic efficacies are resultant of those of the pertinent antibodies and vaccines assembled within AVEC.

    Claims

    1. Antibody-vaccine engineered construct(s) (AVEC) comprising of the two main domains [(antibody(ies), vaccine(s)] and the additional domain(s) [(linker(s), reporter(s)].

    2. Antibody of the AVEC of the claim 1, is the AVEC antibody domain, is (are) the AVEC guiding and immune effector domain(s).

    3. Vaccine of the AVEC of the claim 1, is the AVEC vaccine domain, is (are) the AVEC vaccine domain(s) eliciting immune response t vaccine.

    4. Linker(s) of the AVEC of the claim 1, is (are) the AVEC domain linking antibody(ies) of the claim 1 with vaccine(s) of claim 1.

    5. Reporter(s) of the AVEC of the claim 1, is (are) the AVEC domain(s) reporting presence and/or localization of the AVEC of the claim 1.

    6. Antibody(ies) of claim 1, wherein the antibody(ies) is (are) comprising antibodies including, but not limiting to an IgG, IgM, IgA, IgE, IgD antibody, Fab fragment(s) of those, Fab2 fragment(s) of those, single chain variable fragment(s) (scFv), dual chain variable fragment(s) (dcFv), single domain variable fragment(s) (sdFv), single domain antibody *SDA), CDR(s), affibody, aptamer and alike including, but not limited to all outlined below including their mutants: A Antibody(ies) of claim 1, wherein the antibody is (are) comprising Anti-HER-2; B Antibody(ies) of claim 1, wherein the antibody is (are) comprising Anti-EGFR-1; C Antibody(ies) of claim 1, wherein the antibody is (are) comprising Anti-CD20; D Antibody(ies) of claim 1, wherein, the antibody is (are) comprising Anti-CD-52; E Antibody(ies) of claim 1, wherein the antibody is (are) comprising Anti-CD-44; F Antibody(ies) of claim 1, wherein the antibody is (are) comprising Anti-PSMA; G Antibody(ies) of claim 1, wherein the antibody is (are) comprising Anti-CTLA-4; H Antibody(ies) of claim 1, wherein the antibody is (are) comprising Anti-EpCAM; I Antibody(ies) of claim 1, wherein the antibody is comprising Anti-SSEA-4; J Antibody(ies) of claim 1, wherein the antibody is (are) comprising Anti-SSEA-3; K Antibody(ies) of claim 1, wherein the antibody is (are) comprising Anti-TRA-160; L Antibody(ies) of claim 1, wherein the antibody is (are) comprising Anti-TRA-181; M. An antibody is anti-CD47 antibody; or N. An antibody is anti-PD-L1 antibody.

    7. Vaccine of claim 1, wherein the vaccine is (are) comprising of VLP, attenuated, denatured vaccines and alike including, but not limited to all as outlined below: A Vaccine(s) of claim 1, wherein the vaccine is (are) comprising HBV B Vaccine(s) of claim 1, wherein the vaccine is (are) comprising HCV C Vaccine(s) of claim 1, wherein the vaccine is (are) comprising HAV D Vaccine(s) of claim 1, wherein the vaccine is (are) comprising HEV E Vaccine(s) of claim 1, wherein the vaccine is (are) comprising HPV F Vaccine(s) of claim 1, wherein the vaccine is (are) comprising EBV G Vaccine(s) of claim 1, wherein the vaccine is (are) comprising CMV H Vaccine(s) of claim 1, wherein the vaccine is (are) comprising VZV I Vaccine(s) of claim 1, wherein the vaccine is (are) comprising HSV J Vaccine(s) of claim 1, wherein the vaccine is (are) comprising Influenza K Vaccine(s) of claim 1, wherein the vaccine is (are) comprising HIV L Vaccine(s) of claim 1, wherein the vaccine is (are) comprising Polio M Vaccine(s) of claim 1, wherein the vaccine is (are) comprising Mumps N Vaccine(s) of claim 1, wherein the vaccine is (are) comprising Measles O Vaccine(s) of claim 1, wherein the vaccine is (are) comprising Rotavirus P Vaccine(s) of claim 1, wherein the vaccine is (are) comprising Dengue Q Vaccine(s) of claim 1, wherein the vaccine is (are) comprising Zika R Vaccine(s) of claim 1, wherein the vaccine is (are) comprising Chikungunya S Vaccine(s) of claim 1, wherein the vaccine is (are) comprising Yellow fever T Vaccine(s) of claim 1, wherein the vaccine is (are) comprising Haem.infl. U Vaccine(s) of claim 1, wherein the vaccine is (are) comprising Rubella V Vaccine(s) of claim 1, wherein the vaccine is (are) comprising Diphtheria W Vaccine(s) of claim 1, wherein the vaccine is (are) comprising Pertussis X Vaccine(s) of claim 1, wherein the vaccine is (are) comprising Tetanus Y Vaccine(s) of claim 1, wherein the vaccine is (are) comprising Tuberculosis Z Vaccine(s) of claim 1, wherein the vaccine is (are) comprising Cholera AA Vaccine(s) of claim 1, wherein the vaccine is (are) comprising Anthrax BB Vaccine(s) of claim 1, wherein the vaccine is (are) comprising Botulisms

    8. Linker of claim 1, wherein the chemical reagent is engineered between the main domains to link them together and alike including, but not limited to all as outlined below, which is (are) comprising: A Linker of claim 1, which is (are) comprising SMBC B Linker of claim 1, which is (are) comprising SMCC C Linker of claim 1, which is (are) comprising EDC D Linker of claim 1, which is (are) comprising PTAD E Linker of claim 1, which is (are) comprising BMC F Linker of claim 1, which is (are) comprising NHS esters G Linker of claim 1, which is (are) comprising isothiocyanates H Linker of claim 1, which is (are) comprising benzoyl fluorides I Linker of claim 1, which is (are) comprising maleimides J Linker of claim 1, which is (are) comprising iodoacetamides K Linker of claim 1, which is (are) comprising thiopyridines L Linker of claim 1, which is (are) comprising arylopropiolonitrile M Linker of claim 1, which is (are) comprising diazonia Linker of claim 1, wherein the amino acid(s) (AA) (one letter AA code) is(are) engineered between the main domains to link them together by means of bifunctional linkers and alike including, but not limited to all as outlined below, which is (are) comprising: A Linker of claim 1, which is (are) comprising {SmSnSoGp}q B Linker of claim 1, which is (are) comprising PEG 0-100 kDa C Linker of claim 1, which is (are) comprising 6-aminohexanoic acid: H2N(CH2)p-COOH D Linker of claim 1, which is (are) comprising H2n-(CH2)q-NH2 E Linker of claim 1, which is (are) comprising COOH(CH2)r-NH2 F Linker of claim 1, which is (are) comprising COOH(CH2)s-COOH G Linker of claim 1, which is (are) comprising COOH(CH2)t-SH H Linker of claim 1, which is (are) comprising SH(CH2)u-NH2 Where p,q,r,s,t,u=0-1000

    9. Linker of claim 1, wherein the AA(s) is(are) engineered between the main domains to link them together by means of expressed coding sequence(s) of DNA that codes for linker as means of creating fusion protein with recombinant protein(s) linker(s) and alike including, but not limited to all as outlined below, which is (are) comprising

    10. The linker of claim 1, which is (are) comprising DNA sequences coding for AA of claim 8

    11. Reporter of claim 1, wherein reporter is (are) including, but not limited to all as outlined below engineered at the AVEC termini or between the main domains to report presence and/or localization of AVEC.

    12. The AVEC of claim 11, wherein the AVEC reporting domain is a metal nanoparticle.

    13. The reporter of claim 11, wherein the metal nanoparticle is selected from the group consisting of: A Au, B Pt, C Pd, D Ag.

    14. The reporter of claim 11, wherein the magnetic ion or nanoparticle.

    15. The reporter of claim 11, wherein superparamagnetic metal is: A Gd, B Eu, C Fe, D Ni, E Co.

    16. The reporter of claim 11, wherein the metal nanoparticle tag is a core-shell nanoparticle, the core shell nanoparticle comprising an inner superparamagnetic metal core and an outer noble metal shell.

    17. A method of treating breast cancer, the method comprising administering the antibody-vaccine engineered construct(s) (AVEC) of claim 2 to a subject in need thereof.

    18. The reporter of claim 11 including but not limiting: A Tc99m, B I125, C I131, D F18, E Cu64.

    19. The reporter of claim 11, wherein is an ion or nanoparticle selected from the group consisting of fluorochromes (aka fluorescent dyes, fluorophores).

    20. The reporter of claim 19 including, but not limiting: A FITC, B TRITC, C rhodamine(s), D Texas Red, E indocyanin green, F phycoerythrins, G Alexa(s), H BODIPY, I DRAQ, J CYTRAK, K coumarins, L Pacific(s), M Cy(s), N IRD(s), O Green fluorescent proteins and their modifications.

    Description

    BRIEF DESCRIPTION OF SEVERAL VIEWS OF THE DRAWINGS

    [0027] FIG. 1. Functional, molecular architecture of an antibody-vaccine engineered is illustrated. The main components of said AVEC are marked in capital letters: ANTIBODY, VACCINE, LINKER 1, LINKER 2, REPORTER. It is the front page view.

    [0028] Said AVEC is comprising of said ANTIBODY: exemplified by an anti-HER-2; said VACCINE: an HBsAg; said REPORTER: an Apc (Allophycocyanin); said LINKER 1 (Gly4Ser1) and LINKER 2 (Gly4).

    [0029] Said AVEC comprises of an ANTIBODY. Said ANTIBODY comprises of an anti-HER-2 FcHC-CDRs, anti-HER-2 LC-CDRs, C1q-DD, FcR-BD. Said anti-HER-2 HC CDR comprises a heavy chains' complementarity regions. Said CDR anti-HER-2 LC-CDRs comprises light chains' complementarity regions. Said C1q-DD comprises a complement systems' 1q docking domains. Said FcR-BD comprises a constant fragments' receptor binding domains.

    [0030] Said AVEC comprises of VACCINE. Said VACCINE is exemplified by an HBsAg (illustrated by dark circle). Said HBsAg comprises of a human hepatitis B virus surface antigen virus like particle (VLP). Its purpose is to engage a native and to stimulate adaptive arms of immunity induced by the CDC required and the FDA approved common vaccination or raised after infection with an HBV. Both arms work as lightning rods for the entire immune system ascended down onto cancer cells, when assembled into AVEC.

    [0031] Said LINKER 1 comprises of an integrating molecule (illustrated by bright lines between ANTIBODY and VACCINE) that joins said ANTIBODY with said VACCINE. Said LINKER 2 comprises an integrating molecule that joins said ANTIBODY with said REPORTER. Said 1 LINKER 1 may be either the same or different than said LINKER 2. Said LINKER 1 and LINKER 2 attain their functions by either a chemical conjugation or a genomic recombination. Said LINKER may be entirely absent in said AVEC expressed as a fusion protein.

    [0032] Said REPORTER comprises: a fluorochrome, a superparamagnet, a nanoparticle, a radionuclide, a nanobubble (illustrated by a bright octagonal star). Said fluorochrome comprises of a fluorescent moiety facilitating its visibility (e.g., B phycoerythrin: Bpe); thus assessing pharmacokinetics of AVEC in vitro and in vivo. Said REPORTER may be entirely absent in said AVEC in absence of need for pharmacokinetic, pharmacodynamics, or imaging information.

    [0033] FIG. 2A. Sensitivity and specificity of AVEC: anti-HER-2HBsAg determined by nuclear magnetic resonance (NMR). The breast cancer cells were labeled with trastuzumab, anti-HER-2.sub.001HBsAg, anti-HER-2.sub.004HBsAg, anti-HBsAg (anti-HBsAg) and relevant isotype antibodies (iso) as indicated, followed by secondary superparamagentic antibodies. Measured changes in relaxivities reflect specificity and sensitivity of labeling. All experiments were conducted three times. The data presented are representative for all.

    [0034] The SK-BR-3 [19] and the patients' breast cancer cells (BC001the data for the patient 001 are representative to all 10 patients) cells were heavily labeled with trastuzumab, anti-HER-2 antibodies, and AVEC: anti-HER-2.sub.001HBsAg, anti-HER-2.sub.004HBsAg constructs.

    [0035] The MCF-7 [20] and the patients' human breast epithelial=cells (HBE) were not labeled at the statistically significant range to cause relaxivity change. The isotype antibodies did not label the breast cancer and healthy cells.

    [0036] FIG. 2B. Sensitivity and specificity of AVEC: anti-HER-2HBsAg determined by immunoprecipitation and electrophoresis. Sera of patients with high titers of anti-HBsAg antibodies were rapidly cryoimmobilized, crushed, thawed, immunoprecipitated with superparamagnetic molecular baits as indicated, released into electrophoresis, and immunoblotted. Lanes' of superparamagnetic immunoprecipitation labels. 1. Immuno-nave patient, not immunized, not infected, tested with the clinical diagnostics. 2. Vaccinated patient tested with AVEC: anti-HER-2.sub.001HBsAg; 3 Vaccinated patient tested with isotype antibody; 4. Vaccinated patient tested with AVEC anti-HER-2.sub.004HBsAg; 5. Vaccinated patient tested with isotype antibody; 6. Vaccinated patient tested with Engerix; 7. Vaccinated patient tested with isotype antibody; 8. Vaccinated patient tested with Recombivax; 9. Vaccinated patient tested with isotype antibody; 11. Vaccinated patient tested with anti-HBsAg isotype antibody 10, 12 molecular weight standards. Three experiments provided the same data. All molecular baits used in this study were pulling out the same anti-HBsAg molecule as determined by Hepatitis B clinical diagnostic assays.

    [0037] FIG. 2C. Sensitivity and specificity of AVEC: anti-HER-2HBsAg determined by immunoblotting. The blots from FIG. 2B were quantified at high sensitivity and revealed only anti-HBsAg antibodies in the patients' sera and no other molecules immunoprecipitated and labeled.

    [0038] FIG. 2D. Sensitivity and specificity of trastuzumab determined by flow cytometry. The HER-2+ breast cancer cells were labeled with trastuzumab, tagged with fluorochrome (Tb) (intensity on X, count on Y in 1000/div.).

    [0039] FIG. 2E. Sensitivity and specificity of AVEC: anti-HER-2.sub.004HBsAg determined by flow cytometry. The HER-2+ breast cancer cells were labeled with AVEC: anti-HER-2.sub.004HBsAg tagged with fluorochrome (Eu) (intensity on X, count on Y in 1000/div.).

    [0040] FIG. 2F. Sensitivity and specificity of trastuzumab and AVEC: anti-HER-2HBsAg determined by flow cytometry. The HER-2+ breast cancer cells were labeled with mix of both AVEC: anti-HER-2.sub.004HBsAg (on X) and trastuzumab (on Y) tagged with different flurochromes outlined in FIG. 2D and FIG. 2E.

    [0041] FIG. 2G. Sensitivity and specificity of anti-HER-2.sub.001HBsAg determined by flow cytometry. The HER-2+ breast cancer cells were labeled with AVEC: anti-HER-2.sub.001HBsAg followed by fluorescent anti-HBsAg.

    [0042] FIG. 2H. Sensitivity and specificity of AVEC: anti-HER-2.sub.001 determined by flow cytometry. The HER-2+ breast cancer cells were labeled with AVEC: anti-HER-2.sub.001HBsAg followed by anti-HBsAg fluorescent antibodies on Y) and after initial labeling with AVEC: anti-HER-2.sub.001HBsAg, the cells were labeled with the FITC fluorescent trastuzumab on X.

    [0043] FIG. 2I. Sensitivity and specificity of AVEC: anti-HER-2.sub.001HBsAg determined by flow cytometry. After initial labeling with AVEC: anti-HER-2.sub.001HBsAg, the cells were labeled with the FITC fluorescent trastuzumab (on X) for the cell count (on Y).

    [0044] FIG. 2J. Sensitivity and specificity of trastuzumab determined by flow cytometry. The HER-2+ breast cancer cells were labeled with isotype antibodies for trastuzumab.

    [0045] FIG. 2K. Sensitivity and specificity of AVEC: anti-HER-2.sub.001HBsAg determined by flow cytometry. The HER-2+ breast cancer cells were labeled with isotype antibodies for isotype antibodies for anti-HER-2.sub.001.

    [0046] FIG. 2L. Sensitivity and specificity of AVEC: anti-HER-2.sub.004HBsAg determined by flow cytometry. The HER-2+ breast cancer cells were labeled with isotype antibodies for isotype antibodies for anti-HER-2.sub.004.

    [0047] FIG. 2M. Sensitivity and specificity of AVEC: anti-HER-2HBsAg determined by flow cytometry. The HER-2+ breast cancer cells were labeled with isotype antibodies for isotype antibodies for isotype antibodies for anti-HBsAg.

    [0048] FIG. 3A. Mechanism of action of AVEC: anti-HER-2HBsAg. determined by thymidine incorporation. SK-BR-3 breast cancer cells were labeled for 1-7 h at 37 C. with 0.3 mg/ml trastuzumab or anti-HER-2HBsAg in full human sera from the HBV-vaccinated patients keeping strongly above 100.0 IU/ml anti-HBV. That was followed by studying growth inhibition through thymidine incorporation.

    [0049] FIG. 3B. Mechanism of action of AVEC: anti-HER-2HBsAg determined by immunolabeling and fluorescence microscopy. The breast cancer cells from the patient with metastatic HER-2+ breast cancer were treated with fluorescent AVEC: anti-HER-2.sub.001HBsAg. These tests were repeated three times. This route of MOA is representative for all 10 patients' breast cancer cells.

    [0050] FIG. 3C. Mechanism of action of AVEC: anti-HER-2.sub.001HBsAg determined by labeling with anti-phosphatidylserine (anti-PS) to detect apoptosis. The breast cancer cells from the patient with metastatic HER-2+ breast cancer were treated with fluorescent anti-phosphatidylserine (anti-PS). These tests were repeated three times. This route of MOA is representative for all 10 patients' breast cancer cells. After 1 h some cells were slipping into apoptosis as shown by the PS flip.

    [0051] FIG. 3D. Mechanism of action of AVEC: anti-HER-2.sub.001HBsAg determined by labeling with propidium iodide (PI) to detect necrosis. The breast cancer cells from the patient with metastatic HER-2+ breast cancer were treated with PI. These tests were repeated three times. This route of MOA is representative for all 10 patients' breast cancer cells. After 1 h the cells were showing collapse of chromatin.

    [0052] FIG. 3E. Mechanism of action of AVEC: anti-HER-2.sub.001HBsAg determined by immunoassay. After 6 h most of the cells, which were marked as apoptotic by anti-PS. Almost 40% of the cancer cells were apoptotic due to treatment. That efficacy more than doubled after the treatment with anti-HER-2.sub.001HBsAg or anti-HER-2.sub.004HBsAg. Apoptotic cells: AC.

    [0053] FIG. 3F. Mechanism of action of AVEC: anti-HER-2.sub.001HBsAg determined by immunoassay. Nearly 10% were determined necrotic as the result of the treatment with trastuzumab. The percentage of the necrotic cells after the treatment with anti-HER-2.sub.001HBsAg or anti-HER-2.sub.004HBsAg more than tripled over that attained with trastuzumab. Necrotic Cells: NC.

    [0054] FIG. 4A. Factors affecting immunotherapeutic efficacy of AVEC: anti-HER-2HBsAg.

    [0055] SK-BR-3, MCF-7, and the patients' HER-2+ breast cancer cells were treated with trastuzumab, biosimilar anti-HER-2, anti-HBV, AVEC: anti-HER-2.sub.001HBsAg, and AVEC: anti-HER-2.sub.0041HBsAg in erythrocyte-free blood, in which concentrations of the complement system were adjusted according to measuring of C1q and C3 at 37 C. The experiments were concluded by labeling of the cells with propidium iodide. Necrotic cells were counted by flow cytometry. The experiments were repeated three times. Increasing concentrations of complement system components resulted in increased efficacy of the breast cancer cells killing. The novel immunotherapeutics AVEC: anti-HER-2.sub.004HBsAg and AVEC: anti-HER-2.sub.001HBsAg more than doubled the efficacy trastuzumab and anti-HER-2 biosimilars via the CDC. KC: killed cells. CC: C1/C3 complement concentration ratios.

    [0056] FIG. 4B Factors affecting immunotherapeutic efficacy of AVEC: anti-HER-2.sub.004HBsAg and AVEC: anti-HER-2.sub.001HBsAg. SK-BR-3, MCF-7, and the patients' breast cancer cells were treated with trastuzumab, anti-HER-2, anti-HBV, and AVEC: anti-HER-2.sub.004HBsAg and AVEC: anti-HER-2.sub.001HBsAg in erythrocyte-free blood, in which the number of the immune cells was adjusted in relation to the number of breast cancer cells. Measurements were pursued as in FIG. 3A. Increasing the ratio of the effector immune cells to target cancer cells resulted in proportional increase in efficacy of the breast cancer cells' killing. The novel clusters AVEC: anti-HER-2.sub.004HBsAg and AVEC: anti-HER-2.sub.001HBsAg more than tripled the efficacy of the experimental therapy via ADCC over trastuzumab and anti-HER-2 biosimilars. KC: killed cells. CC: effector cells/cancer cells concentration ratios.

    [0057] FIG. 5A. Sensitivity and specificity of AVEC: anti-HER-2.sub.001HBsAg in targeting ovarian cancer cells determined by nuclear magnetic resonance. The ovarian cancer cells from cultures (OV90, TOV112, SK-OV-3), human ovary surface (HOSE) cells were labeled with trastuzumab, AVEC: anti-HER 2.sub.001anti-HBsAg, AVEC: anti-HER-2.sub.004anti-HBsAg, and relevant isotype antibodies rendered superparamagnetic. Antibodies labeling the cells were changing the cells' magnetic properties, which were measured with nuclear magnetic resonance (NMR). The assays were repeated four times. The data presented are representative for all acquired. The changes in the length of T1 resulted from the changes in magnetic resonance, which were altered by presence of superparamagnetic antibodies and were proportional to the numbers of antibodies attached to the labeled cells. With the same number of cells in each batch, the relaxivity changes were directly proportional to the numbers of cell receptors displayed by the cells. Therefore, they facilitated comparisons of sensitivity of labeling between the cells, while being pursued with different antibodies. The OV90, TOV112, and SKOV3 cells were labeled with trastuzumab, anti-HER-2 biosimilars, AVEC: anti-HER-2.sub.001anti-HBsAg and AVEC: anti-HER-2.sub.004anti-HBsAg at the statistically significant superiority over those labeled with the isotype antibodies and isotype-based AVEC. The control HOSE cells were labeled at the same negligible levels as the isotype antibodies. (i: isotype antibody).

    [0058] FIG. 5B Sensitivity and specificity of AVEC: anti-HER-2HBsAg in targeting ovarian cancer patients determined by nuclear magnetic resonance. The ovarian cancer ascites cells from the patients (Patient 1-Patient 3) were labeled with the same superparamagnetic antibodies, followed by the measurement of relaxivities, as outlined for cultured cells in FIG. 5A. The ovarian epithelial cancer ascites cells were all showing high numbers of the HER-2 receptors specifically labeled by the tested antibodies. Measurements of the relaxivities demonstrated statistically significant difference in the numbers of receptors on the ovarian epithelial cancer ascites cells over HOSE. Measurements of the relaxivities demonstrated statistically significant difference attained by labeling with the anti-HER-2 antibodies and AVEC over the relevant isotypes. The assays were repeated four times. The data presented are representative for all acquired (i isotype antibody).

    [0059] FIG. 6A. Sensitivity and specificity of trastuzumab to attract anti-Fc antibodies. The ovarian cancer cells from cultures (OV90) were labeled initially with trastuzumab followed by the anti-FcR-BD fluorescent antibody (N: cell count on Y; intensity on X).

    [0060] FIG. 6B Sensitivity and specificity of trastuzumab to attract anti-HBV antibodies. The ovarian cancer cells from cultures (OV90) were labeled initially with trastuzumab followed by the anti-HBV fluorescent antibody (F2: on X) and trastuzumab isotype followed by anti-Fc antibody (F1: on Y). None of them resulted in labeling of HER-2+ ovarian cancer cells.

    [0061] FIG. 6C Sensitivity and specificity of AVEC: anti-HER-2.sub.001HBsAg to attract anti-Fc antibodies. The ovarian cancer cells from cultures (OV90) were labeled initially with AVEC: anti-HER-2.sub.001HBsAg followed by the anti-FcR-BD fluorescent antibody (N: cell count on Y; intensity on X).

    [0062] FIG. 6D. Sensitivity and specificity of AVEC: anti-HER-2.sub.001HBsAg to attract anti-HBV antibodies. The ovarian cancer cells from cultures (OV90) were labeled initially with AVEC: anti-HER-2.sub.001HBsAg followed by THE anti-HBsAg fluorescent antibody. The assays were repeated four times. The data presented are representative for all acquired. These cells revealed having high number of HER-2 receptors (>2106/cell) were effectively labeled with AVEC: anti-HER-2.sub.001HBsAg and anti-HBV antibodies. However, only the HER2+ ovarian cancer cells labeled with AVEC attracted the anti-HBsAg antibody onto the ovarian cancer cells, but the cells labeled with trastuzumab did not not attract anti-HBV antibodies.

    [0063] FIG. 6E. Sensitivity and specificity of AVEC: anti-HER-2.sub.001HBsAg to attract anti-HBV antibodies. Blood from the patients (1-3) vaccinated against HBV were depleted of erythrocytes, magnetic AVEC's: anti-HER-2.sub.001HBsAg were used to pull out anti-HBsAg, while the concentrations were adjusted to 10.0 mIU/ml and electrophoresed. Strong bands corresponding to molecular weight of anti-HBsAg antibodies are clear.

    [0064] FIG. 6F. Sensitivity and specificity of AVEC: anti-HER-2.sub.001HBsAg to attract anti-HBV antibodies. The gels from FIG. 6E were quantified. These data show very specific and sensitive affinity of the patients' anti-HBsAg towards AVEC: anti-HER-2.sub.001HBsAg. Some of the antibodies were undergoing some degree of chain separation showing up as faster bands.

    [0065] FIG. 6G. Sensitivity and specificity of AVEC: anti-HER-2.sub.001HBsAg to attract anti-HBV antibodies. Blood from the patients (1-8) vaccinated against HBV were depleted of erythrocytes, magnetic AVECs: anti-HER-2.sub.001HBsAg were used to pull out anti-HBsAg and electrophoresed without adjusting the concentrations.

    [0066] FIG. 6H. Sensitivity and specificity of AVEC: anti-HER-2.sub.001HBsAg to attract anti-HBV antibodies. The gels from FIG. 6G were quantified. The quantifications revealed different concentrations of the anti-HBsAg in different patients and different degree dissociation of the chains. The assays were repeated four times. The data presented are representative for all acquired.

    [0067] FIG. 7A. Mechanism of action of AVEC: anti-HER-2.sub.001HBsAg in ovarian cancer cells' killing determined by immunofluorescence. The patients' ovarian cancer cells were labeled for 6 h at 37 C. with AVEC: anti-HER-2.sub.001 in full erythrocytes' free blood from the HBV-vaccinated patients with the anti-HBV adjusted to 10.0 IU/ml. That was followed by labeling with anti-phosphatidylserine (anti-PS). Most of the cells demonstrate a flip of phosphatidylserine; thus advancing apoptosis. The assays were repeated four times. The data presented are representative for all acquired.

    [0068] FIG. 7B. Mechanism of action of AVEC: anti-HER-2.sub.001HBsAg in ovarian cancer cells' killing determined by immunofluorescence. The patients' ovarian cancer cells were labeled for 6 h at 37 C. with AVEC: anti-HER-2.sub.001HBsAg in full erythrocytes' free blood from the HBV-vaccinated patients with the anti-HBV adjusted to 10.0 IU/ml. That was followed by labeling with the fluorescent anti-genomic DNA anti-gDNA). The labeling is indicative of advancing necrosis. The assays were repeated four times. The data presented are representative for all acquired.

    [0069] FIG. 7C. Mechanism of action of AVEC: anti-HER-2.sub.001HBsAg and anti-HER-2.sub.004HBsAg in repressing the ovarian cancer cells' growth was studied by radiolabeling. That was accomplished by incorporation of tritium tagged thymidine. AVEC inflicted statistically significant higher impact upon the cells' growth, when compared to isotype antibodies. AVEC had negligible effects upon HAE and HOSE cells.

    [0070] FIG. 7D. Mechanism of action of AVEC: anti-HER-2.sub.001HBsAg byinduced apoptosis was evaluated by labeling with anti-phosphatidylserine (anti-PS) superparamagnetic antibodies and measuring relaxivity in NMR. Anti-HER-2 naked antibodies resulted in approximately 40% of cells being apoptotic. Treatment with the AVEC resulted in the number of apoptotic cells more than doubled. Labeling of HOSE cells was negligible. Labeling of cells with isotype antibodies (i) was negligible.

    [0071] FIG. 7E. Mechanism of action of AVEC: anti-HER-2.sub.001HBsAg by induced necrosis was evaluated by labeling with anti-genomic DNA (anti-gDNA) superparamagnetic antibodies and measuring relaxivities in NMR. Anti-HER-2 naked antibodies resulted in approximately 10% of cells being necrotic. Treatment with the AVEC: anti-HER-2.sub.001HBsAg resulted in the number of necrotic cells nearly tripled over anti-HER2 biosimilar. These assays were repeated four times. The data presented are representative for all acquired.

    [0072] FIG. 8A. Factors affecting immunotherapeutic efficacy of AVEC: anti-HER-2.sub.001HBsAg.

    [0073] As the controls, blood of every healthy volunteer and HBV infected and vaccinated patients was depleted of erythrocytes and analyzed. Three main populations of cells were revealed by forward (FS) and side (S) scattering. The data presented are representative for all acquired.

    [0074] FIG. 8B. Factors affecting immunotherapeutic efficacy of AVEC: anti-HER-2.sub.001HBsAg. As the controls, blood of the every healthy volunteer and HBV infected and vaccinated patients was depleted of erythrocytes and analyzed. Various cells fractions (I) were determined through cell counts.

    [0075] FIG. 8C. Factors affecting immunotherapeutic efficacy of AVEC: anti-HER-2.sub.001HBsAg. As the controls for the numbers of NKC and CTL effector cells, various fractions of white blood cells (WBC) labeled with anti-FcR were sorted and counted, so that the number of the effector cells and cancer cells to effector cells inter-fractions' ratios could be adjusted in the forthcoming experiments and personalizing therapy.

    [0076] FIG. 8D. Factors affecting immunotherapeutic efficacy of AVEC: anti-HER-2.sub.001HBsAg promoting ADCC. The OV90 cells were labeled with AVEC: anti-HER-2.sub.001HBsAg followed by anti-Fc-R-BD on Y as F1 and anti-HBsAg (on X as F4). These assays were repeated four times. The data presented are representative for all performed.

    [0077] FIG. 8E Factors affecting immunotherapeutic efficacy of AVEC: anti-HER-2.sub.001HBsAg via complement system (CS). are OV90 cells were treated at 37 C. with trastuzumab, biosimilar anti-HER-2, anti-HBV, AVEC: anti-HER-2.sub.004 and AVEC: anti-HER-2.sub.001HBsAg in erythrocyte-free blood from the HBV vaccinated patients, while the concentrations of the complement system (CS) were adjusted for C1q and C3 as indicated on the diagram. Increasing concentrations of complement system components resulted in increased efficacy of the ovarian cancer cells killing counts (KC) as complement dependent cytotoxicity (CDC). Importantly, treatment with AVEC at nearly three times lower concentrations of C1q and C3 resulted in nearly the same therapeutic efficacy as naked anti-HER-2 antibodies at three times higher concentrations. This efficacy was at significantly higher statistical rate than with the relevant isotype antibodies. This impact onto cancer cells was also of statistical significance difference over that onto human ovary surface epithelial (HOSE) and human artery endothelial HAE cells. These assays were repeated four times. The data presented are representative for all performed. KC: killed cells. CC: C1/C3 complement concentration ratios.

    [0078] FIG. 8F. Factors affecting immunotherapeutic efficacy of AVEC: anti-HER-2.sub.004 and AVEC: anti-HER-2.sub.001HBsAg via effector cells. OV90 cells were treated at 37 C. with trastuzumab, biosimilar anti-HER-2, anti-HBV, and AVEC:anti-HER-2.sub.004 and AVEC: anti-HER-2.sub.001HBsAg in erythrocyte-free blood from the HBV vaccinated patients, while the ratios between cytotoxic effector cells (EF) and the killed ovarian cancer cells (KC) were adjusted as indicated on the diagram. Increasing the ratio of the effector cytotoxic cells to ovarian cancer cells clearly increased efficacy of killing cancer cells by antibody dependent cytotoxic cells (ADCC). Importantly, ratios of effector to cancer cells, when AVEC were administered, resulted in the same immunotherapeutic efficacy as compared to higher ratios when naked antibodies were administered. In other words less cytotoxic cells were needed for AVEC to deliver the same therapeutic effect as more cells when naked antibodies were administered. This feature is critically important, when the patients are immunocompromised after the rounds of systemic therapy and the patients' ability grow the immune cells is annihilated by intended to suppress proliferation of cancer cells, but as side effects universally suppressing proliferation of all patients' cells. The AVEC's efficacy was at statistically significant advance over the relevant isotype antibodies. The AVEC's impact onto cancer cells was also of statistically significant difference over that onto HOSE and HAE cells. These assays were repeated four times. The data presented herein are representative for all acquired. KC: killed cells. EF: effector cells: cancer cell numbers' ratios.

    DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENT

    Antibody-Vaccine Engineered Constructs (AVEC)

    [0079] An antibody-vaccine engineered construct (AVEC) comprising of an ANTIBODY, a VACCINE, a LINKER, a REPORTER is illustrated in FIG. 1. Furthermore, the methods for designing and manufacturing of AVEC, as in claim 1, are provided herein. Moreover, the utility of said AVEC, as in claim 1, for therapy of cancer is provided herein. Finally, the methods for determination of their pharmacokinetics, pharmacodynamics, and pharmacogenomics of said AVEC, as in claim 1, as pertinent to determining the personalized, precision medicine designing of effective routes of administration, doses and regimens, as well as, verifying their clinical efficacy, are provided herein.

    [0080] AVEC described herein, as designed, generated, and tested, as described in the Examples below and References have a very high qualitative and/or quantitative specificity towards biomarkers on tumor cells or cancer cells in vivo or in vitro, while in blood, serum, or any other physiological solution, fluid and/or tissue. While having the very high binding specificity and sensitivity to tumor cell or cancer cell biomarkers, AVEC have almost no specificity and sensitivity, toxicity towards the healthy cells. They are entirely bio-compatible. They have very long shelf-lives.

    [0081] Their mechanisms of actions, as in the details described and analyzed in the Examples below, rely upon antibody dependent redirecting, accelerating, and amplifying of the prophylactic or natural vaccination induced immune response (ADRAAVIR) from that initially elicited by vaccination towards this finally aimed by therapies=redirecting immunity from microbes against cancers.

    [0082] Their route of administration to the patients, pharmacokinetics, pharmacodynamics, and pharmacogenomics, as described in the Examples below, are resultant of those of the pertinent antibodies and vaccines assembled within AVEC.

    [0083] Therefore, we disclose an entirely new and a very broad and entirely novel paradigm for immunotherapy of patients suffering from cancer and autoimmune diseases, which has become viable through biomolecular engineering of artificial molecules, which are capable for interfacing preventive and therapeutic immunities.

    [0084] Development of two immunotherapeutics: trastuzumab and pertuzumab, against the same target HER-2, is de facto an attempt of reconstructing the response of the natural immune system involving polyclonal antibodies. Herein, we present a way to by-pass the need for developing multiple clones of antibodies against HER-2, but rather we use HBsAg, which serves as a lightning rod for redirecting all the clones of antibodies and cytokines generated by the FDA approved and the CDC recommended prophylactic immunization. Therefore, it amplifies the therapeutic efficacy of the single clone of anti-HER-2 to the level equivalent to eliciting polyclonal antibodies, plethora of cells, and multiple cytokines.

    [0085] If ever developed, any new anti-cancer vaccines would have to be introduced against multiple cancers and assembled into a program, as now by the CDC for microbes: viruses and bacteria. Otherwise, development of the active, strong immune response by a patient suffering from a cancer and undergoing cytocidal and toxic systemic therapies, whose immune system is greatly compromised by the first line systemic chemotherapies, is hard. Systemic therapies are intended to kill all proliferating cancer cells, but as the omnipresent adverse effect, they result in immunocompromised patients, as the proliferating cells of the immune system are killed.

    [0086] Moreover, multiple vaccinations are multiple immunizations; thus each additional one of them may increase risks of cross reactivity.

    [0087] In some embodiments, as outlined in one of Examples provided below, AVEC engage both arms of the patients' immune system: innate and adaptiveacquired through vaccination against e.g., hepatitis B virus. HBsAg is the epitope uniquely different from all epitopes displayed on healthy human cells. Furthermore, this therapyADRAAVIR does not rely upon time consuming development of a new therapeutic response, when in fighting of cancer, the time is of essence; acceleration of therapy is of essence, as every day the cancer progresses, if not stopped. Moreover, ADRAAVIR relies upon existing readiness of immune system of the patients. As such, ADRAAVIR presents the least iatrogenic, fastest, most efficient option for immunotherapy of cancer patients.

    Antibody Domains:

    [0088] Efficacy and safety of therapy with AVEC rely upon specificity and sensitivity of their antibody domains. The very specific pharmacogenomics tests are required by the FDA to be performed prior to administration of the immunotherapy employing naked antibodies, antibody drug conjugates (ADC), and antibody toxin conjugates (ATC). These tests are aimed to determine, if receptors being the potential targets of antibodies are overexpressed on cancer cells. This is accomplished by PCR, FISH, and/or IHC. Accordingly, we have assembled the panel of probes and recombinant isolated receptors for measuring the level of expression of the therapeutic targets for AVEC. Some of them including, but not limiting, to those shown in the table below.

    TABLE-US-00001 TABLE PRIMERSANDPROBESTOERBB1-4. OLIGO len tm gc% any 3 seq ErbB1 LEFTPRIMER 20 60.01 50.00 6.00 1.00 Cagcgctaccttgtcattca(SEQID RIGHTPRIMER 20 60.00 55.00 7.00 2.00 NO:1)Tgcactcagagagctcagga HYBOLIGO 20 60.08 45.00 8.00 3.00 (SEQIDNO:2) gaatgcatttgccaagtcct(SEQID NO:3) ErbB1 LEFTPRIMER 20 60.00 55.00 3.00 1.00 gggctcacagcaaacttctc(SEQID RIGHTPRIMER 20 60.02 50.00 7.00 0.00 NO:4)aagccagactcgctcatgtt HYBOLIGO 20 60.00 55.00 2.00 2.00 (SEQIDNO:5) acacacacacacacacaccg(SEQID NO:6) ErbB1 LEFTPRIMER 20 60.00 55.00 3.00 1.00 ggctcacagcaaacttctcc(SEQID RIGHTPRIMER 20 60.02 50.00 7.00 0.00 NO:7)aagccagactcgctcatgtt HYBOLIGO 20 60.00 55.00 2.00 2.00 (SEQIDNO:8) acacacacacacacacaccg(SEQID NO:9) ErbB1 LEFTPRIMER 20 59.97 50.00 4.00 2.00 acttgacaggggaaacatgc(SEQID RIGHTPRIMER 20 60.00 55.00 3.00 3.00 NO:10)caaggtctgggaaccactgt HYBOLIGO 20 60.09 40.00 4.00 2.00 (SEQIDNO:11) ttgcacaattccaaccttga(SEQID NO:12) ErbB1 LEFTPRIMER 20 60.00 55.00 3.00 1.00 ggctcacagcaaacttctcc(SEQID RIGHTPRIMER 20 59.97 50.00 4.00 1.00 NO:13)gcatgtttcccctgtcaagt HYBOLIGO 20 60.00 55.00 2.00 2.00 (SEQIDNO:14) acacacacacacacacaccg(SEQID NO:15) ErbB1 LEFTPRIMER 20 60.00 55.00 3.00 1.00 gggctcacagcaaacttctc(SEQID RIGHTPRIMER 20 59.97 50.00 4.00 1.00 NO:16)gcatgtttcccctgtcaagt HYBOLIGO 20 60.00 55.00 2.00 2.00 (SEQIDNO:17) acacacacacacacacaccg(SEQID NO:18) ErbB2/ LEFTPRIMER 20 59.99 55.00 2.00 0.00 ccataacacccacctctgct(SEQID HER2 RIGHTPRIMER 20 59.95 55.00 6.00 3.00 NO:19)actggctgcagttgacacac HYBOLIGO 20 60.06 55.00 4.00 1.00 (SEQIDNO:20) ErbB2/ LEFTPRIMER 20 59.94 55.00 8.00 0.00 acacagcggtgtgagaagtg(SEQID HER2 RIGHTPRIMER 20 60.09 65.00 4.00 0.00 NO:22)aggccaggggagag(SEQ HYBOLIGO 20 59.65 55.00 3.00 3.00 IDNO:23)tcagaccctcttgggaccta (SEQIDNO:24) ErbB2/ LEFTPRIMER 20 60.16 55.00 3.00 3.00 gcctccacttcaaccacagt(SEQID HER2 RIGHTPRIMER 20 59.99 55.00 4.00 2.00 NO:25)cccacgtccgaaaggta HYBOLIGO 20 60.31 55.00 5.00 2.00 (SEQIDNO:26) tgtgactgcctgtccctaca(SEQID NO:27) ErbB2/ LEFTPRIMER 20 59.84 55.00 4.00 0.00 cccagctctttgaggacaac(SEQID HER2 RIGHTPRIMER 20 59.91 50.00 8.00 0.00 NO:28)agccagctggttgttcttgt HYBOLIGO 20 59.89 55.00 10.00 3.00 (SEQIDNO:29) agcttcgaagcctcacagag(SEQID NO:30) ErbB2/ LEFTPRIMER 20 59.91 55.00 4.00 3.00 tggggagagagttctgagga(SEQID HER2 RIGHTPRIMER 20 60.16 50.00 7.00 1.00 NO:31)acagatgccactgtggttga HYBOLIGO 20 60.16 57.89 8.00 8.00 (SEQIDNO:32) gactgctgccatgagcagt(SEQID NO:33) ErbB2/ LEFTPRIMER 20 59.84 55.00 4.00 0.00 cccagctctttgaggacaac(SEQID HER2 RIGHTPRIMER 20 59.87 55.00 4.00 0.00 NO:34)ggatcaagacccctcctttc HYBOLIGO 20 59.89 55.00 10.00 3.00 (SEQIDNO:35) agcttcgaagcctcacagag(SEQID NO:36) ErbB2/ LEFTPRIMER 20 59.99 55.00 2.00 0.00 ccataacacccacctctgct(SEQID HER2 RIGHTPRIMER 20 59.95 55.00 6.00 3.00 NO:37)actggctgcagttgacacac HYBOLIGO 20 60.06 55.00 4.00 1.00 (SEQIDNO:38) accaagctctgctccacact(SEQID NO:39) ErbB2/ LEFTPRIMER 20 59.93 50.00 5.00 3.00 ccatctgcaccattgatgtc(SEQIDNO:40) HER2 RIGHTPRIMER 20 60.02 60.00 3.00 1.00 gagcggaaggtgctgtc(SEQID HYBOLIGO 20 59.97 50.00 4.00 4.00 NO:41)cgggagttggtgtctgaatt (SEQIDNO:42) ErbB2/ LEFTPRIMER 20 60.05 55.00 2.00 0.00 ccctcatccaccataacacc(SEQID HER2 RIGHTPRIMER 20 59.95 55.00 6.00 3.00 NO:43)actggctgcagttgacacac HYBOLIGO 20 60.06 55.00 4.00 1.00 (SEQIDNO:44) accaagctctgctccacact(SEQID NO:45) ErbB2/ LEFTPRIMER 20 60.05 50.00 3.00 2.00 cgcttttggcacagtctaca(SEQID HER2 RIGHTPRIMER 20 60.07 55.00 5.00 3.00 NO:46)tcccggacatggtctaagag HYBOLIGO 20 59.93 45.00 6.00 2.00 (SEQIDNO:47) aattccagtggccatcaaag(SEQID NO:48) ErbB2/ LEFTPRIMER 20 59.93 45.00 6.00 2.00 aattccagtggccatcaaag(SEQID HER2 RIGHTPRIMER 20 60.07 55.00 5.00 3.00 NO:49)tcccggacatggtctaagag HYBOLIGO 20 60.14 55.00 5.00 2.00 (SEQIDNO:50) ggtgacacagcttatgccct(SEQID NO:51) ErbB2/ LEFTPRIMER 20 59.99 55.00 2.00 0.00 ccataacacccacctctgct(SEQID HER2 RIGHTPRIMER 20 59.95 55.00 6.00 3.00 NO:52)actggctgcagttgacacac HYBOLIGO 20 60.06 55.00 4.00 1.00 (SEQIDNO:53) accaagctctgctccacact(SEQID NO:54) ErbB2/ LEFTPRIMER 20 60.05 55.00 2.00 0.00 ccctcatccaccataacacc(SEQID HER2 RIGHTPRIMER 20 59.95 55.00 6.00 3.00 NO:55)actggctgcagttgacacac HYBOLIGO 20 60.06 55.00 4.00 1.00 (SEQIDNO:56) accaagctctgctccacact(SEQID NO:57) ErbB2/ LEFTPRIMER 20 60.05 50.00 3.00 2.00 cgcttttggcacagtctaca(SEQID HER2 RIGHTPRIMER 20 60.07 55.00 5.00 3.00 NO:58)tcccggacatggtctaagag HYBOLIGO 20 59.93 45.00 6.00 2.00 (SEQIDNO:59) aattccagtggccatcaaag(SEQID NO:60) ErbB2/ LEFTPRIMER 20 59.93 45.00 6.00 2.00 aattccagtggccatcaaag(SEQID HER2 RIGHTPRIMER 20 60.07 55.00 5.00 3.00 NO:61)tcccggacatggtctaagag HYBOLIGO 20 60.14 55.00 5.00 2.00 (SEQIDNO:62) ggtgacacagcttatgccct(SEQID NO:63) ErbB2/ LEFTPRIMER 20 59.93 45.00 6.00 2.00 aattccagtggccatcaaag(SEQID HER2 RIGHTPRIMER 20 59.93 50.00 5.00 3.00 NO:64)tttcccggacatggtctaag HYBOLIGO 20 60.14 55.00 5.00 2.00 (SEQIDNO:65) ggtgacacagcttatgccct(SEQID NO:66) ErbB3 LEFTPRIMER 20 59.95 60.00 3.00 3.00 gagcccagaggagaagact(SEQID RIGHTPRIMER 20 59.99 55.00 6.00 0.00 NO:67)tctgatgcgacagacactcc HYBOLIGO 20 59.83 60.00 3.00 0.00 (SEQIDNO:68) gagtctgagtgttcggaggg(SEQID NO:69) ErbB3 LEFTPRIMER 20 59.93 50.00 4.00 2.00 aattgactggagggacatcg(SEQID RIGHTPRIMER 20 60.12 55.00 3.00 3.00 NO:70)ggagcacagatggtcttggt HYBOLIGO 20 59.87 50.00 4.00 2.00 (SEQIDNO:71) aggacaatggcagaagctgt(SEQID NO:72) ErbB3 LEFTPRIMER 20 59.93 50.00 4.00 2.00 aattgactggagggacatcg(SEQID RIGHTPRIMER 20 60.26 55.00 3.00 1.00 NO:73)aggagcacagatggtcttgg HYBOLIGO 20 59.87 50.00 4.00 2.00 (SEQIDNO:74) aggacaatggcagaagctgt(SEQID NO:75) ErbB3 LEFTPRIMER 20 59.87 50.00 4.00 2.00 aggacaatggcagaagctgt(SEQID RIGHTPRIMER 20 60.32 60.00 4.00 1.00 NO:76)cgaggtacacaggctccact HYBOLIGO 20 60.12 55.00 3.00 2.00 (SEQIDNO:77) accaagaccatctgtgctcc(SEQID NO:78) ErbB3 LEFTPRIMER 20 59.68 50.00 8.00 2.00 ggaagtttgccatcttcgtc(SEQID RIGHTPRIMER 20 59.87 50.00 4.00 0.00 NO:79)acagcttctgccattgtcct HYBOLIGO 20 59.93 50.00 4.00 2.00 (SEQIDNO:80) aattgactggagggacatcg(SEQID NO:81) ErbB3 LEFTPRIMER 20 60.34 60.00 6.00 2.00 gagggacccaggtctacgat(SEQID RIGHTPRIMER 20 59.87 50.00 4.00 0.00 NO:82)acagcttctgccattgtcct HYBOLIGO 20 59.93 50.00 4.00 2.00 (SEQIDNO:83) aattgactggagggacatcg(SEQID NO:84) ErbB4 LEFTPRIMER 20 60.04 45.00 3.00 0.00 tttcgggagtttgagaatgg(SEQID RIGHTPRIMER 20 59.97 50.00 7.00 2.00 NO:85)gaaactgtttgccccctgta HYBOLIGO 20 60.04 50.00 4.00 4.00 (SEQIDNO:86) aagatggaagatggcctcct(SEQID NO:87) ErbB4 LEFTPRIMER 20 60.04 45.00 3.00 0.00 tttcgggagtttgagaatgg(SEQID RIGHTPRIMER 20 59.97 50.00 7.00 2.00 NO:88)gaaactgtttgccccctgta HYBOLIGO 20 60.04 50.00 4.00 4.00 (SEQIDNO:89) aagatggaagatggcctcct(SEQID NO:90) ErbB4 LEFTPRIMER 20 59.91 45.00 5.00 2.00 ggtgaatttcgggagtttga(SEQID RIGHTPRIMER 20 59.97 50.00 7.00 2.00 NO:91)gaaactgtttgccccctgta HYBOLIGO 20 60.04 50.00 4.00 4.00 (SEQIDNO:92) aagatggaagatggcctcct(SEQID NO:93) ErbB4 LEFTPRIMER 20 59.97 45.00 5.00 2.00 ggtgcttttggaacggttta(SEQID RIGHTPRIMER 20 59.84 55.00 4.00 0.00 NO:94)aaccggacgtgtggatg HYBOLIGO 20 59.69 45.00 4.00 3.00 (SEQIDNO:95) caaggcaaatgtggagttca(SEQID NO:96) ErbB4 LEFTPRIMER 20 59.97 45.00 5.00 2.00 ggtgcttttggaacggttta(SEQID RIGHTPRIMER 20 59.84 55.00 4.00 2.00 NO:97)caaccggacgtgtggat HYBOLIGO 20 59.69 45.00 4.00 3.00 (SEQIDNO:98) caaggcaaatgtggagttca(SEQID NO:99) ErbB4 LEFTPRIMER 20 60.15 55.00 7.00 2.00 ccagaccaatgtctgtcgtg(SEQID RIGHTPRIMER 20 60.04 50.00 4.00 0.00 NO:100)aggaggccatcttccatctt HYBOLIGO 20 60.04 45.00 3.00 0.00 (SEQIDNO:101) tttcgggagtttgagaatgg(SEQID NO:102)

    [0089] The AVEC antibody domains had three sources. The antibodies were designed and manufactured as human antibodies according to the methods described [21, 22]. Alternatively they were synthesized, they were manufactured as biosimilars of the antibodies approved by the FDA: trastuzumab, pertuzumab, cetuximab, panitumumab, alemtuzumab, rituximab based upon importing their sequences from IMGT and expressing in human cells. Finally, the antibodies approved by the FDA were incorporated into AVEC: trastuzumab, pertuzumab, cetuximab, panitumumab, alemtuzumab, rituximab. For designing of the DNA plasmid constructs for the aforementioned biosimilar antibodies, the coding sequences were imported from the ImMunoGeneTics antibody sequences' bank (IMGT, Paris, F, EU) [23, 24].

    [0090] For generating of anti-HBsAg, anti-HBcAg, anti-HBeAg antibodies the B cells were acquired from the patients suffering from the Acute and/or Chronic Hepatitis B. The protocol was identical to that published. HBV isolated from the patients' blood by PEG gradients precipitation or from liver biopsies by CsCl gradient centrifugations, were rapidly frozen, lyophilized and stored [25].

    [0091] HBsAg were produced in human hepatoma cells transfected with plasmid DNA. Prior to selection, during in vitro evolution, they were reconstituted with buffer and served as the molecular baits. They also served as the controls for anti-HBsAg antibodies [26-32].

    [0092] For generating of anti-HSVgB and anti-HSVgD antibodies the B cell were acquired from the patients suffering from infections with the Herpes Simplex Viruses. The protocol was identical to that described above.

    [0093] For generating of anti-HPV-VP 16 and 18 antibodies the B cell were acquired from the patients suffering from the infections with Human Papilloma Viruses. The protocol was identical to that described above.

    [0094] The above aforementioned original and biosimilar antibodies IgG, scFv, dsFvs, sdFvs, and CDRs were expressed from the DNA constructs assembled through the amplicons driven by the CDR primers listed below [31,32]. The primers were selected after analysis of sequences data base. They were expressed from combinatorial libraries using HEK293 cell and mRNA displays according to published protocols [21, 22, 31, 32]

    [0095] Primers including, but not limiting to the ones outlined below:

    TABLE-US-00002 PrimersforCDR1: H1-Forward: (SEQIDNO:103) 5-GAGGAGGAGGAGGAGGAGGCGGGGCCCAGGCGG CCCAGGTGCAGCTGGTGC-3; H1-Reverse: (SEQIDNO:104) 5-GCGGACCCAGCTCATTTCATAAKMAKMGAAAKM GAAAKMAGAGGCTGCACAGGAGAG-3 PrimersforCDR2: H2-Forward1: (SEQIDNO:105) 5-GAAATGAGCTGGGTCCGCCAGGCTCCAGGACAA SGSCTTGAGTGG-3; H2-Forward2: (SEQIDNO:106) 5-GAAATGAGCTGGGTCCGCCAGGCTCCAGGGAAG GCCCTGGAGTGG-3; H2-Forward3: (SEQIDNO:107) 5-GAAATGAGCTGGGTCCGCCAGGCTCCAGGGAAG GGNCTRGAGTGG-3; H2-Reverse1: (SEQIDNO:108) 5-ATTGTCTCTGGAGATGGTGACCCTKYCCTGRAA CTY3; H2-Reverse2: (SEQIDNO:109) 5-ATTGTCTCTGGAGATGGTGAATCGGCCCTTCAC NGA-3; H2-Reverse3: (SEQIDNO:110) 5-ATTGTCTCTGGAGATGGTGACTMGACTCTTGAG GGA-3; H2-Reverse4: (SEQIDNO:111) 5-ATTGTCTCTGGAGATGGTGACSTGGCCTTGGAA GGA-3; H2-Reverse5: (SEQIDNO:112) 5-ATTGTCTCTGGAGATGGTAAACCGTCCTGTGAA GCC3; PrimersforCDR3: H3-Forward1: (SEQIDNO:113) 5-ACCCTGAGAGCCGAGGACACRGCYTTRTATTAC TGT3; H3-Forward2: (SEQIDNO:114) 5-ACCCTGAGAGCCGAGGACACAGCCAYRTATTAC TGT-3; H3-Forward3: (SEQIDNO:115) 5-ACCCTGAGAGCCGAGGACACRGCYGTRTATTAC TGT-3; H3-Reverse: (SEQIDNO:116) 5-GTGGCCGGCCTGGCCACTTGAGGAGACGGTGAC C-3 PrimersforotherCDRs CDR-H1-Forward (SEQIDNO:117) 5-CTCTGGATTCACCTTCRRTTATKMTATGAGCTG GGTCCGCCAGGCTCCAG-3 CDR-H2-Forward (SEQIDNO:118) 5-GGGCTGGAGTGGGTCTCAKBGATCTMTYMTRRT RRTRGTARTAHATATTACGCTGATTCTGTAAAAGGT CGGTTCACCATCTCCAGAG-3 CDR-H3-9-Reverse (SEQIDNO:119) 5-CTGGCCCCAGTAGTCGAAMNNMNNMNNMNNTYT CGCACAGTAATACACGGC-3 CDR-H3-14-Reverse (SEQIDNO:120) 5-CTGGCCCCAGTAGTCGAAMNNMNNMNNMNNMNN MNNMNNAVSAYCTYTCGCACAGTAATACACGGC-3 CDR-H3-20-Reverse (SEQIDNO:121) 5-CTGGCCCCAGACGTCCATASCATHAKMAKAAKA MNNMNNMNNMNNMNNMNNMNNAMBAVBANVTYTCGC ACAGTAATACACGGC-3 CDR-H3-2055-Reverse (SEQIDNO:122) 5-CTGGCCCCAGACGTCCATASCATHAKMAKAAKA ACAMNNMNNMNNMNNACAMNNAMBAVBANCTYTCGC ACAGTAATACACGGC-3 CDR-L1-Forward (SEQIDNO:123) 5-GAGGGTCACCATCTCTTGTASTGGCTCTTCATC TAATATTGGCARTAATDMTGTCWMCTGGTACCAGCA GCTCCCAG-3 CDR-L2-Forward (SEQIDNO:124) 5-CCCAAACTCCTCATCTATKMTRATARTMAKCGG CCAAGCGGGGTCCCTGACCGATTC-3 CDR-L3-Reverse (SEQIDNO:125) 5-GAGGCTGATTATTACTGTGSTDCTTGGGATKMT AGCCTGARTGSTTATGTCTTCGGCGGAGGC-3 PrimersforFRs FR3-Forward: (SEQIDNO:126) 5-ACCATCTCCAGAGACAATTCC-3 FR3-Reverse: (SEQIDNO:127) 5-GTCCTCGGCTCTCAGGGTG-3 FR-H1-Forward: (SEQIDNO:128) 5-GAGGTGCAGCTGTTGGAGTCTGGGGGAGGCTTG GTACAGCCTGGGGGGTCCCTG-3 FR-H1-Reverse: (SEQIDNO:129) 5-GCTAAAGGTGAATCCAGAGGCTGCACAGGAGAG TCTCAGGGACCCCCCAGGCTG-3 FR-H2-Reverse: (SEQIDNO:130) 5-TGAGACCCACTCCAGCCCCTTCCCTGGAGCCTGGCG GACCCA-3 FR-H3-Reverse: (SEQIDNO:131) 5-GGCTGTTCATTTGCAGATACAGCGTGTTCTTGGAAT TGTCTCTGGAGATGGTGAACCG-3 FR-H3-Forward: (SEQIDNO:132) 5-GTATCTGCAAATGAACAGCCTGAGAGCCGAGGACAC GGCCGTGTATTACTGTGCG-3 JH-15-Forward: (SEQIDNO:133) 5-T-TCGACTACTGGGGCCAGGGTACACTGGTCACCG TGAGCTCA-3 JH-6-Forward: (SEQIDNO:134) 5-ATGGACTGCTGGGGCCAGGGTACACTGGTCACCGTG AGCTCA-3 FR-L1-Forward: (SEQIDNO:135) 5-CAGTCTGTGCTGACTCAGCCACCCTCAGCGTCTGGG ACCCCC-3 FR-L1Reverse: (SEQIDNO:136) 5-ACAAGAGATGGTGACCCTCTGCCCGGGGGTCCCAGA CGCTGAG-3 FR-L2-Reverse: (SEQIDNO:137) 5-ATAGATGAGGAGTTTGGGGGCCGTTCCTGGGAGCTG CTGGTACCAG-3 FR-L3-Reverse: (SEQIDNO:138) 5-GATGGCCAGGGAGGCTGAGGTGCCAGACTTGGAGCC AGAGAATCGGTCAGGGACCCC-3 FR-L3-F (SEQIDNO:139) 5-TCAGCCTCCCTGGCCATCAGTGGGCTCCGGTCCGAG GATGAGGCTGATTATTACTGTG-3 JL-Forward: (SEQIDNO:140) 5-TATGTCTTCGGCGGAGGCACCAAGCTGACGGTCCTA GGC-3 FRH3-short-Reverse: (SEQIDNO:141) 5-CGCACAGTAATACACGGCC-3 JH15-short-Forward: (SEQIDNO:142) 5-TTCGACTACTGGGGCCAG-3 JH6-short-Forward: (SEQIDNO:143) 5-ATGGACGTCTGGGGCCAGGGTACACTG-3 pC3X-Forward: (SEQIDNO:144) 5-GCACGACAGGTTTCCCGAC-3 pC3X-Reverse: (SEQIDNO:145) 5-AACCATCGACAGCACCG-3 H1-Reverse: (SEQIDNO:146) 5-GCTAAAGGTGAATCCAGAG-3 H2-Forward: (SEQIDNO:147) 5-CTGGGTCCGCCAGGCTCCAG-3 H2-Reverse: (SEQIDNO:148) 5-TGAGACCCACTCCAGCCC-3 H3-Forward: (SEQIDNO:149) 5-CGGTTCACCATCTCCAGAG-3 L1-Reverse: (SEQIDNO:150) 5-CAAGAGATGGTGACCCTC-3 L2-Forward: (SEQIDNO:151) 5-CTGGTACCAGCAGCTCCCAG-3 L2-Reverse: (SEQIDNO:152) 5-ATAGATGAGGAGTTTGGG-3 L3-Forward: (SEQIDNO:153) 5-GGGGTCCCTGACCGATTC-3 L3-Reverse: (SEQIDNO:154) 5-CACAGTAATAATCAGCCTC-3 JL-short-Forward: (SEQIDNO:155) 5-TATGTCTTCGGCGGAGGC-3

    [0096] The original generated antibodies and/or their fragments, which were developed according to the procedures outlined above and in Examples, while relying upon the aforementioned CDRs and tested with the recombinant receptors outlined above, were incorporated as the AVEC antibody domains. The sequences including, but not limited to those, which are listed below.

    TABLE-US-00003 TABLE SequencesofCDRsincluding,butnotlimitingtotheonesoutlinedbelow. Receptor ExemplarSequence(nucleic Translation(amino Target ConsensusSequence(5.fwdarw.3) acidsequence)(5.fwdarw.3) acidsequence)(5.fwdarw.3) anti-huEGFRH1.sub.a ggnttywsnttywsnacntayggnatgcaytrr ggcttcttcacctatggcatgcatta GFSFSTYGMH (SEQIDNO:156) a(SEQIDNO:210) (SEQIDNO:264) anti-huEGFRH2.sub.a gtnathtgggaygayggnwsntayaartayttyg gtgatttgggatgatggcagctataaatattttgg VIWDDGSYKYFGD gngaywsngtntrr(SEQIDNO:157) cgacgtgtaa(SEQIDNO:211) SV(SEQID NO:265) anti-huEGFRH3.sub.a gtnathtgggaygayggnwsntayaartayttyg gtgatttgggatgatggcagctataaatattttgg DAITMVRGVMKEYF gngaywsngtntrr(SEQIDNO:158) cgacgtgtaa(SEQIDNO:212) DY(SEQID NO:266) anti-huEGFRH1.sub.b ggnttyacntaywsnacntayggnatgcaytrr ggctttacctacacctatggcatgcattaa GFTYSTYGMH (SEQIDNO:159) (SEQIDNO:213) (SEQIDNO:267) anti-huEGFRH2.sub.b gtnathtgggargayggnwsntayaartaytay gtgatttgggaagatggcagctataaatattatg VIWEDGSYKYYGD ggngaywsngtntrr(SEQIDNO:160) gcgacgtgtaa(SEQIDNO:214) SV(SEQID NO:268) anti-huEGFRH3.sub.b gayggnathwsnatggtnmgngcngtnatg gatggcatcatggtgcgcgcggtgatgcgcgatt DGISMVRAVMRDY mgngaytayttygayttytrr attttgatttttaa(SEQIDNO:215) FDF(SEQID (SEQIDNO:161) NO:269) anti-huEGFRH1.sub.c ggnttyacnttywsnacnttygcnatgcaytrr ggctttaccttcacctttgcgatgcattaa GFTFSTFAMH (SEQIDNO:162) (SEQIDNO:216) (SEQIDNO:270) anti-huEGFRH2.sub.c gtnathtgggaygayggnwsntayaarttytayg gtgatttgggatgatggcagctataaattttatgc VIWDDGSYKFYAE cngarwsngtntrr(SEQIDNO:163) ggaaagcgtgtaa(SEQIDNO:217) SV(SEQID NO:271) anti-huEGFRH3.sub.c gayggnathacnatggtnmgnggngtnatg gatggcattaccatggtgcgcggcgtgatgcgcg DGITMVRGVMRDYF mgngaytayttygayttytrr attattttgatttttaa(SEQIDNO:218) DF(SEQIDNO:272) (SEQIDNO:164) anti-huEGFRL1.sub.a mgngcnwsncargayathwsnwsngcnytn cgcgcgagccaggatatcagcgcgctggtgtaa RASQDISSALV gtntrr(SEQIDNO:165) (SEQIDNO:219) (SEQIDNO:273) anti-huEGFRL2.sub.a gaygcnwsnwsnytngartrr gatgcgagcagcctggaata DASSLE (SEQIDNO:166) a(SEQIDNO:220) (SEQIDNO:274) anti-huEGFRL3.sub.a carcarttyaaywsntayccnytnacntr cagcagtttaacagctatccgctgaccta QQFNSYPLT r(SEQIDNO:167) a(SEQIDNO:221) (SEQIDNO:275) anti-huEGFRL1.sub.b mgngcnwsncargarathwsnwsngcnytny cgcgcgagccaggaaatcagcgcgctgctgta RASQEISSALL tntrr(SEQIDNO:168) a(SEQIDNO:222) (SEQIDNO:276) anti-huEGFRL2.sub.b gargcnwsnwsnytngaracntrr gaagcgagcagcctggaaaccta EASSLET (SEQIDNO:169) a(SEQIDNO:223) (SEQIDNO:277) anti-huEGFRL3.sub.b caraayttyaaywsntayccnytnwsntr cagaactttaacagctatccgctgagcta QNFNSYPLS r(SEQIDNO:170) a(SEQIDNO:224) (SEQIDNO:278) anti-huEGFRL1.sub.c mgngcnwsncargayathacnwsngcnytny cgcgcgagccaggatattaccagcgcgctgctgt RASQDITSALL tntrr(SEQIDNO:171) aa(SEQIDNO:225) (SEQIDNO:279) anti-huEGFRL2.sub.c gaygcnwsnwsnytngarwsn gatgcgagcagcctggaaag DASSLES (SEQIDNO:172) c(SEQIDNO:226) (SEQIDNO:280) anti-huEGFRL3.sub.c aaycarttycarwsntayccnytnwsn aaccagtttcagagctatccgctgag NQFQSYPLS (SEQIDNO:173) c(SEQIDNO:227) (SEQIDNO:281) anti-huEGFRVIIIH1.sub.a ggnttywsnttymgnaarttyggnatgwsntr ggcttctttcgcaaatttggcatgagcta GFSFRKFGMS r(SEQIDNO:174) a(SEQIDNO:228) (SEQIDNO:282) anti-huEGFRvIIIH2.sub.a wsnathwsnacnggnggntayaaywsntayt agcatcaccggcggctataacagctattacgata SISTGGYNSYYSD aywsngayaaygtntrr(SEQIDNO:175) acgtgtaa(SEQIDNO:229) NV(SEQID NO:283) anti-huEGFRvIIIH3.sub.a ggnttywsnwsnacnwsntaygcnatggayta ggcttcagcaccagctatgcgatggattattaa GFSSTSYAMDY ytrr(SEQIDNO:176) (SEQIDNO:230) (SEQIDNO:284) anti-huEGFRvIIIH1.sub.b ggnttyacnttyaaraarttyggnatgwsntr ggctttacctttaaaaaatttggcatgagcta GFTFKKFGMS r(SEQIDNO:177) a(SEQIDNO:231) (SEQIDNO:285) anti-huEGFRvIIIH2.sub.b wsnathwsnacnggnggnttyaayacntayt agcatcaccggcggctttaacacctattacgata SISTGGFNTYYSDN aywsngayaaygtntrr(SEQID acgtgtaa(SEQIDNO:232) V(SEQIDNO:286) NO:178) anti-huEGFRvIIIH3.sub.b ggntaywsnwsnacnwsnttyggnatggayta ggctacagcaccagctttggcatggattattaa GYSSTSFGMDY ytrr(SEQIDNO:179) (SEQIDNO:233) (SEQIDNO:287) anti-huEGFRvIIIH1.sub.c ggntaywsnttymgnaarttyggnatgwsntr ggctactttcgcaaatttggcatgagcta GYSFRKFGMS r(SEQIDNO:180) a(SEQIDNO:234) (SEQIDNO:288) anti-huEGFRvIIIH2.sub.c wsnathwsnacnggnggntaycaracntayta agcatcaccggcggctatcagacctattacgata SISTGGYQTYYSD ywsngayaaygtntrr(SEQIDNO:181) acgtgtaa(SEQIDNO:235) NV(SEQID NO:289) anti-huEGFRvIIIH3.sub.c ggntaywsnwsnacnwsntaygcnatggaytt ggctacagcaccagctatgcgatggatttttaa GYSSTSYAMDF ytrr(SEQIDNO:182) (SEQIDNO:236) (SEQIDNO:290) anti-huEGFRvIIIL1.sub.a mgngcnwsncarwsngtncaywsngayggn cgcgcgagccagagcgtgcacgatggcaacac RASQSVHSDGNTY aayacntayatgcartrr(SEQIDNO:183) ctatatgcagtaa(SEQIDNO:237) MQ(SEQID NO:291) anti-huEGFRvIIIL2.sub.a gcngcnwsnaaymgnttywsntr gcggcgagcaaccgcttcta AASNRFS r(SEQIDNO:184) a(SEQIDNO:238) (SEQIDNO:292) anti-huEGFRvIIIL3.sub.a carcarggnacncarytnccnmgnacntr cagcagggcacccagctgccgcgcacctaa QQGTQLPRT r(SEQIDNO:185) (SEQIDNO:239) (SEQIDNO:293) anti-huEGFRvIIIL1.sub.b mgnwsnwsncarwsngtncaywsngaygg Cgcagcagccagagcgtgcacgatggcaaca RSSQSVHSDGNSY naaywsntayytnwsntrr gctatctgagctaa(SEQIDNO:240) LS(SEQID (SEQIDNO:186) NO:294) anti-huEGFRvIIIL2.sub.b ggngcnwsnaayaarttywsntrr ggcgcgagcaacaaattcta GASNKFS (SEQIDNO:187) a(SEQIDNO:241) (SEQIDNO:295) anti-huEGFRvIIIL3.sub.b carcarggnacncarytnccnmgnacntr Cagcagggcacccagctgccgcgcacctaa QQGTQLPRT r(SEQIDNO:188) (SEQIDNO:242) (SEQIDNO:296) anti-huEGFRvIIIL1.sub.c aarwsncarwsnytngtncaywsngayggna aaaagccagagcctggtgcacgatggcaaca KSQSLVHSDGNSY aywsntayytnwsntrr(SEQIDNO:189) gctatctgagctaa(SEQIDNO:243) LS(SEQID NO:297) anti-huEGFRvIIIL2.sub.c mgnathwsnaaymgnttywsntr cgcatcaaccgcttctaa(SEQIDNO:244) RISNRFS r(SEQIDNO:190) (SEQIDNO:298) anti-huEGFRvIIIL3.sub.c carcarggnacncarytnccnmgnacntr cagcagggcacccagctgccgcgcacctaa QQGTQLPRT r(SEQIDNO:191) (SEQIDNO:245) (SEQIDNO:299) anti-huTfRH1.sub.a ggntaywsntaywsnwsntaytggatgtrr ggctactacagctattggatgta GYSYSSYWM (SEQIDNO:192) a(SEQIDNO:246) (SEQIDNO:300) anti-huTfRH2.sub.a gcnathgayccnmgnaaywsngayacnath gcgattgatccgcgcaacagcgataccatttata AIDPRNSDTIYNPQ tayaayccncarttytrr acccgcagttttaa(SEQIDNO:247) F(SEQIDNO:301) (SEQIDNO:193) anti-huTfRH3.sub.a ytntaytaytaygaywsntrr ctgtattattatgactaa LYYYDS (SEQIDNO:194) (SEQIDNO:248) (SEQIDNO:302) anti-huTfRH1.sub.b ggntayacnathwsnwsntaytggatgtrr ggctataccatcagctattggatgta GYTISSYWM (SEQIDNO:195) a(SEQIDNO:249) (SEQIDNO:303) anti-huTfRH2.sub.b gcngcngayccnmgnaaywsngayacnath gcggcggatccgcgcaacagcgataccatttatc AADPRNSDTIYQP taycarccncartaytrr agccgcagtattaa QY(SEQID (SEQIDNO:196) (SEQIDNO:250) NO:304) anti-huTfRH3.sub.b ytntaytayttygaywsntrr ctgtattattttgactaa(SEQIDNO:251) LYYFDS (SEQIDNO:197) (SEQIDNO:305) anti-huTfRH1.sub.c ggntayacngcnacnacntaytggatgtr ggctataccgcgaccacctattggatgtaa GYTATTYWM r(SEQIDNO:198) (SEQIDNO:252) (SEQIDNO:306) anti-huTfRH2.sub.c atgathcayccnwsngaywsngargtnmgnyt atgattcatccgagcgacgaagtgcgcctgaac MIHPSDSEVRLN naaycartrr cagtaa Q(SEQID (SEQIDNO:199) SEQIDNO:253) NO:307) anti-huTfRH3.sub.c ytntaytayttygarwsntrr ctgtattattttgaaagcta LYYFES (SEQIDNO:200) a(SEQIDNO:254) (SEQIDNO:308) anti-huTfRL1.sub.a gayathaayaaytaygtntgytrr gatattaacaactatgtgtgcta DINNYVC (SEQIDNO:201) a(SEQIDNO:255) (SEQIDNO:309) anti-huTfRL2.sub.a aargcnaaymgnytngtngaytrr aaagcgaaccgcctggtggatta KANRLVD (SEQIDNO:202) a(SEQIDNO:256) (SEQIDNO:310) anti-huTfRL3.sub.a ytncartaygaygarttyccntayacntr ctgcagtatgatgaatttccgtatacctaa LQYDEFPYT r(SEQIDNO:203) (SEQIDNO:257) (SEQIDNO:311) anti-huTfRL1.sub.b garathaayaaytayytntgytrr gaaattaacaactatctgtgcta EINNYLC (SEQIDNO:204) a(SEQIDNO:258) (SEQIDNO:312) anti-huTfRL2.sub.b mgngcnaayaarytngtngaytr cgcgcgaacaaactggtggatta RANKLVD r(SEQIDNO:205) a(SEQIDNO:259) (SEQIDNO:313) anti-huTfRL3.sub.b ytncartaygaygayttyccntayacntr ctgcagtatgatgattttccgtataccta LQYDDFPYT r(SEQIDNO:206) a(SEQIDNO:260) (SEQIDNO:314) anti-huTfRL1c gayathaaycarttyytntgytrr gatattaaccagtttctgtgcta DINQFLC (SEQIDNO:207) a(SEQIDNO:261) (SEQIDNO:315) anti-huTfRL2.sub.c mgngcnaaymgnytngtngaytr cgcgcgaaccgcctggtggatta RANRLVD r(SEQIDNO:208) a(SEQIDNO:262) (SEQIDNO:316) anti-huTfRL3.sub.c gtncartaygaygarttyccntaywsntr gtgcagtatgatgaatttccgtacta VQYDEFPYS r(SEQIDNO:209) a(SEQIDNO:263) (SEQIDNO:317) *The consensus sequences are degeneracy sequences which follow the standard IUPAC symbols for DNA (R = A or G; Y =C or T; M = A or C; W = A or T; S = C or G; B = C, G or T; D = A, G or T; H = A, C or T; V = A, C or G; and N is any nucleotide (A, C G or T)).

    [0097] In some embodiments, the biosimilar antibodies and/or their fragments were developed according to the procedures outlined above and in Examples and in References, while relying upon the DNA constructs designed and prepared based upon the sequences imported from the IMGT antibody sequences bank and tested with the recombinant receptors outlined above. They were incorporated as the AVEC antibody domains. Their sequences are listed below.

    TABLE-US-00004 TABLE Sequencesofbiosimilarantibodies Fvsusedhereinincluding,butnotlimitingto theonesoutlinedbelow. Trastuzumabbiosimilar-anti-HER2 trastuzumab|Humanized||H-GAMMA-1 EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYTRY 60 ADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSS 120 ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS 180 GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGG 240 PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN 300 STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREE 360 MTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW 420 QQGNVFSCSVMHEALHNHYTQKSLSLSPGK 450(SEQIDNO:318) trastuzumab|Humanized||L-KAPPA(V-KAPPA) DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVPS 60 RFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEIKRTVAAPSVFIFPP 120 SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT 180 LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 214(SEQIDNO:319) Cetuximabbiosimilar-anti-EGFR cetuximab|Chimeric||H-GAMMA-1 QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYN 60 TPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSAA 120 STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG 180 LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGP 240 SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS 300 TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEM 360 TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ 420 QGNVFSCSVMHEALHNHYTQKSLSLSPGK 449(SEQIDNO:320) cetuximab|Chimeric||L-KAPPA(V-KAPPA) DILLTQSPVILSVSPGERVSFSCRASQSIGTNIHWYQQRTNGSPRLLIKYASESISGIPS 60 RFSGSGSGTDFTLSINSVESEDIADYYCQQNNNWPTTFGAGTKLELKRTVAAPSVFIFPP 120 SDEQLKSGTASVVOLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT 180 LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 214(SEQIDNO:321) Pertuzumabbiosimilar-anti-HER2 pertuzumab|Humanized||H EVQLVESGGGLVQPGGSLRLSCAASGFTFTDYTMDWVRQAPGKGLEWVADVNPNSGGSIY NQRFKGRFTLSVDRSKNTLYLQMNSLRAEDTAVYYCARNLGPSFYFDYWGQGTLVTVSSA STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGP SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEM TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ QGNVFSCSVMHEALHNHYTQKSLSLSPG(SEQIDNO:322) pertuzumab|Humanized||H DIQMTQSPSSLSASVGDRVTITCKASQDVSIGVAWYQQKPGKAPKLLIYSASYRYTGVPS RFSGSGSGTDFTLTISSLQPEDFATYYCQQYYIYPYTFGQGTKVEIKRTVAAPSVFIFPP SDEQLKSGTASVVOLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC(SEQIDNO:323) Rituximabbiosimilar-anti-CD20 >Rituximab|chimeric|H QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWVKQTPGRGLEWIGAIYPGNGDTSY NQKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYYCARSTYYGGDWYFNVWGAGTTVT VSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAV LQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSCDKTHTCPPCPAPE LLG GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQ YNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR D ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK(SEQIDNO:324) >RituximabChimeric||L QIVLSQSPAILSASPGEKVTMTCRASSSVSYIHWFQQKPGSSPKPWIYATSNLASGVPVR FSGSGSGTSYSLTISRVEAEDAATYYCQQWTSNPPTFGGGTKLEIKRTVAAPSVFIFPPS DEQLKSGTASVVOLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC(SEQIDNO:325) Alemtuzumabbiosimilar-anti-CD52 alemtuzumab|Humanized||H-GAMMA-1 QVQLQESGPGLVRPSQTLSLTCTVSGFTFTDFYMNWVRQPPGRGLEWIGFIRDKAKGYTT 60 EYNPSVKGRVTMLVDTSKNQFSLRLSSVTAADTAVYYCAREGHTAAPFDYWGQGSLVTVS 120 SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS 180 SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLG 240 GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY 300 NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD 360 ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR 420 WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 451(SEQIDNO:326) alemtuzumab|Humanized||L-KAPPA DIQMTQSPSSLSASVGDRVTITCKASQNIDKYLNWYQQKPGKAPKLLIYN 50 TNNLQTGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCLQHISRPRTFGQ 100 GTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKV 150 DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQG 200 LSSPVTKSFNRGEC 214(SEQIDNO:327)

    [0098] Finally, the FDA approved antibodies were used as the building blocks for AVEC. These included: rituximab (Rituxan); trastuzumab (Herceptin); cetuximab (Erbitux); pertuzumab (Perjeta); panitumumab (Vectibix); alemtuzumab (Campath).

    Vaccine Domains

    [0099] The AVEC vaccine domains were used from two sources either as recombinant proteins with synthetic sequences expressed in E. coli, yeast, and/or human cells or as the FDA approved vaccines.

    Coding Sequences of Vaccines as Listed in Sequence Listing

    [0100] The sequences were imported from the GenBank and their immunogenis sites verified with the DNAStar software to be identical as those of the FDA approved vaccines, as shown below. They were assembled as dsDNA by overlap extension. The details of specific protocols are provided in Examples and in References. Briefly, they coding sequences were cloned into the transfection vectors controlled by the promoters suitable for a particular expression system: for expression in yeast (Saccharomyces cerevisiae and/or Pichia pastoris) they were under control of the of the alcohol oxidase promoter [27] and for expression in E. Coli under control of the T7 promoter [22] and for expression in human cells (human myeloma, hepatoma, HEK293), they were under control of the cytomegalovirus promoter [22]. The expression systems and methods facilitating expression were the same as those systems described above and in Examples and in References for expression of antibodies.

    TABLE-US-00005 TABLE Referencesforsequencesofvaccinesusedinthisproject. HBsAg HBV MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGG SPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFITLFILLLCLIFLLVLLDYQG MLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTOPIPSSWAFAK YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLL PI FFCLWVYIGENBANK:J02205.1(SEQIDNO:328) GGATCCCAGAGTCAGGGGTCTGTATCTTCCTGCTGGTGGCTCCAGTTCAG GAACAGTAAA CCCTGCTCCGAATATTGCCTCTCACATCTCGTCAATCTCCGCGAGGACTG GGGACCCTGT GACGAACATGGAGAACATCACATCAGGATTCCTAGGACCCCTGCTCGTGT TACAGGCGGG GTTTTTCTTGTTGACAAGAATCCTCACAATACCGCAGAGTCTAGACTCGT GGTGGACTTC TCTCAATTTTCTAGGGGGATCTCCCGTGTGTCTTGGCCAAAATTCGCAGT CCCCAACCTC CAATCACTCACCAACCTCCTGTCCTCCAATTTGTCCTGGTTATCGCTGGA TGTGTCTGCG GCGTTTTATCATATTCCTCTTCATCCTGCTGCTATGCCTCATCTTCTTAT TGGTTCTTCT GGATTATCAAGGTATGTTGCCCGTTTGTCCTCTAATTCCAGGATCAACAA CAACCAGTAC GGGACCATGCAAAACCTGCACGACTCCTGCTCAAGGCAACTCTATGTTTC CCTCATGTTG CTGTACAAAACCTACGGATGGAAATTGCACCTGTATTCCCATCCCATCGT CCTGGGCTTT CGCAAAATACCTATGGGAGTGGGCCTCAGTCCGTTTCTCTTGGCTCAGTT TACTAGTGCC ATTTGTTCAGTGGTTCGTAGGGCTTTCCCCCACTGTTTGGCTTTCAGCTA TATGGATGAT GTGGTATTGGGGGCCAAGTCTGTACAGCATCGTGAGTCCCTTTATACCGC TGTTACCAAT TTTCTTTTGTCTCTGGGTATACATTTAAACCCTAACAAAACAAAAAGATG GGGTTATTCC CTAAACTTCATGGGCTACATAATTGGAAGTTGGGGAACTTTGCCACAGGATC (SEQIDNO:329) GenBank:J02205.1 AGCATACAATCAACTATCTGGAATTCCCGA GGACTGGGGACCCTGTGACGAACATGGAGAACATC GENBANK:J02560.1(SEQIDNO:330) GenBank:J02560.1 MFQDPQERPGKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGN PYAVCDKCLKFYSKISEYRHYCYSVYGTTLEQQYNKPLCDLLIRCINCQKPLCPEEKQ RHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQLGENBANK:U34135.1(SEQID NO:331) HPVType16L1E6 GenBank:U34135.1 HSVgB GenBank:M14923.1 ATGTTTCAGGACCCACAGGAGCGACCCGGAAAGTTACCACAGTTATGCAC AGAGCTGCAA ACAACTATACATGATATAATATTAGAATGTGTGTACTGCAAGCAACAGTT ACTGCGACGT GAGGTATATGACTTTGCTTTTCGGGATTTATGCATAGTATATAGAGATGG GAATCCATAT GCTGTATGTGATAAATGTTTAAAGTTTTATTCTAAAATTAGTGAGTATAG ACATTATTGT TATAGTGTGTATGGAACAACATTAGAACAGCAATACAACAAACCGTTGTG TGATTTGTTA ATTAGGTGTATTAACTGTCAAAAGCCACTGTGTCCTGAAGAAAAGCAAAG ACATCTGGAC AAAAAGCAAAGATTCCATAATATAAGGGGTCGGTGGACCGGTCGATGTAT GTCTTGTTGC AGATCATCAAGAACACGTAGAGAAACCCAGCTGTAA(SEQIDNO:332) VNGPLFDHSTHSFAQPPNTALYYSVENVGLLPHLKEELARFIMGAGGSGADWAVSEF QKFYCFDGVSGITPTQRAAWRYIRELIIATTLFASVYRCGELELRRPDCSRPTSEGLYR YPPGVYLTYNSDCPLVAIVESGPDGCIGPRPVVVYDRDVFSILYSVLQHLAPRLAGGG TDAPPGENBANK:M14923.1(SEQIDNO:333) MRGGGLICALVVGALVAAVASAAPAAPAAPRASGGVAATVAANG GPASRPPPVPSPATTKARKRKTKKPPKRPEATPPPDANATVAAGHATVRAHLREIKV E NADAQFYVCPPPTGATVVQFEQPRRCPTRPEGQNYTEGIAVVFKENIAPYKFKATMY Y KDVTVSQVWFGHRYSQFMGIFEDRAPVPFEEVIDKINAKGVCRSTAKYVRNNMETT AF HRDDHETDMELKPAKVATRTSRGWHTTDLKYNPSRVEAFHRYGTTVNCIVEEVDA RSV YPYDEFVLATGDFVYMSPFYGYREGSHTEHTTYAADRFKQVDGFYARDLTTKARAT SP TTRNLLTTPKFTVAWDWVPKRPAVCTMTKWQEVDEMLRAEYGGSFRFSSDAISTTF TT NLTEYSLSRVDLGDCIGRDAREAIDRMFARKYNATHIKVGQPQYYQATGGFLIAYQP L LSNTLAELYVREYMREQDRKPRNATPAPLREAPSANASVERIKTTSSIEFARLQFTYN HIQRHVNDMLGRIAVAWCELQNHELTLWNEARKLNPNAIASATVGRRVSARMLGD VMA VATCVPVAPDNVIVQNSMRVSSRPGTCYSRPLVSFRYEDQGPLIEGQLGENNDVRLT R DALEPCTVGHRGYFIFGGGYVYFEEYAYSHQLSRADVTTVSTFIDLNITMLEDHEFVP LEVYTRHEIKDSGLLDYTEVQRRNQLHDLRFADIDTVIRADANAAMFAGLCAFFEGM G DLGRAVGKVVMGVVGGVVSAVSGVSSFMSNPFGALAVGLLVLAGLVAAFFAFRYV LQL QRNPMKALYPLTTKELKTSDPGGVGGEGEEGAEGGGFDEAKLAEAREMIRYMALVS AM ERTEHKARKKGTSALLSSKVTNMVLRKRNKARYSPLHNEDEAGDEDEL AAA66440.1(SEQIDNO:334) GTCAACGGGCCCCTGTTCGACCACTCCACCCACAGCTTCGCCCAGCCCCC CAACACCGCG CTGTACTACAGCGTCGAGAACGTGGGGCTCCTGCCGCACCTCAAGGAGGA ACTCGCCCGC TTCATCATGGGCGCGGGGGGTTCGGGCGCTGATTGGGCCGTCAGCGAGTT TCAAAAGTTC TACTGTTTTGACGGTGTTTCCGGAATCACGCCCACCCAGCGCGCCGCCTG GCGATATATT CGCGAGCTCATTATCGCCACCACACTCTTTGCGTCGGTCTACCGGTGCGG GGAGCTTGAG TTGCGCCGCCCCGACTGCAGCCGCCCGACCTCCGAAGGTCTGTACCGCTA CCCGCCGGGC GTGTACCTCACGTACAACTCCGACTGTCCGCTGGTGGCCATCGTCGAGAG CGGCCCCGAC GGCTGCATCGGACCCCGTCCGGTCGTGGTTTACGACCGAGACGTTTTTTC CATCCTCTAC TCGGTCCTGCAGCACCTCGCCCCCAGACTAGCGGGCGGCGGGACGGACGC GCCCCCGTAG GCCCGCCATGCGCGGGGGGGGCTTGATTTGCGCGCTGGTCGTGGGGGCGC TGGTGGCCGC GGTGGCGTCGGCGGCCCCGGCGGCCCCGGCGGCCCCCCGCGCCTCGGGCG GCGTGGCCGC GACCGTCGCGGCGAACGGGGGTCCCGCCTCCCGGCCGCCCCCCGTCCCGA GCCCCGCGAC CACCAAGGCCCGGAAGCGGAAAACCAAAAAGCCGCCCAAGCGGCCCGAGG CGACCCCGCC CCCCGACGCCAACGCGACCGTCGCCGCCGGCCACGCCACCGTGCGCGCGC ACCTGCGGGA AATCAAGGTCGAGAACGCCGATGCCCAGTTTTACGTGTGCCCGCCCCCGA CGGGCGCCAC GGTGGTGCAGTTTGAGCAGCCGCGCCGCTGCCCGACGCGCCCGGAGGGGC AGAACTACAC GGAGGGCATCGCGGTGGTCTTCAAGGAGAACATCGCCCCGTACAAATTCA AGGCCACCAT GTACTACAAAGACGTGACCGTGTCGCAGGTGTGGTTCGGCCACCGCTACT CCCAGTTTAT GGGGATATTCGAGGACCGCGCCCCCGTTCCCTTCGAGGAGGTGATCGACA AGATTAACGC CAAGGGGGTCTGCCGCTCCACGGCCAAGTACGTGCGGAACAACATGGAGA CCACCGCGTT TCACCGGGACGACCACGAGACCGACATGGAGCTCAAGCCGGCGAAGGTCG CCACGCGCAC GAGCCGGGGGTGGCACACCACCGACCTCAAGTACAACCCCTCGCGGGTGG AGGCGTTCCA TCGGTACGGCACGACGGTCAACTGCATCGTCGAGGAGGTGGACGCGCGGT CGGTGTACCC GTACGATGAGTTTGTGCTGGCGACGGGCGACTTTGTGTACATGTCCCCGT TTTACGGCTA CCGGGAGGGGTCGCACACCGAGCACACCACGTACGCCGCCGACCGCTTCA AGCAGGTCGA CGGCTTCTACGCGCGCGACCTCACCACGAAGGCCCGGGCCACGTCGCCGA CGACCCGCAA CCTGCTGACGACCCCCAAGTTTACCGTGGCCTGGGACTGGGTGCCGAAGC GACCGGCGGT CTGCACCATGACCAAGTGGCAGGAGGTGGACGAGATGCTCCGCGCCGAGT ACGGCGGCTC CTTCCGCTTCTCCTCCGACGCCATCTCGACCACCTTCACCACCAACCTGA CCGAGTACTC GCTCTCGCGCGTCGACCTGGGCGACTGCATCGGCCGGGATGCCCGCGAGG CCATCGACCG CATGTTTGCGCGCAAGTACAACGCCACGCACATCAAGGTGGGCCAGCCGC AGTACTACCA GGCCACGGGGGGCTTCCTCATCGCGTACCAGCCCCTCCTCAGCAACACGC TCGCCGAGCT GTACGTGCGGGAGTACATGCGGGAGCAGGACCGCAAGCCCCGGAATGCCA CGCCCGCGCC ACTGCGGGAGGCGCCCAGCGCCAACGCGTCCGTGGAGCGCATCAAGACCA CCTCCTCGAT CGAGTTCGCCCGGCTGCAGTTTACGTATAACCACATACAGCGCCACGTGA ACGACATGCT GGGGCGCATCGCCGTCGCGTGGTGCGAGCTGCAGAACCACGAGCTGACTC TCTGGAACGA GGCCCGCAAGCTCAACCCCAACGCCATCGCCTCCGCCACCGTCGGCCGGC GGGTGAGCGC GCGCATGCTCGGAGACGTCATGGCCGTCGCCACGTGCGTGCCCGTCGCCC CGGACAACGT GATCGTGCAGAACTCGATGCGCGTCAGCTCGCGGCCGGGGACGTGCTACA GCCGCCCCCT GGTCAGCTTTCGGTACGAAGACCAGGGCCCGCTGATCGAGGGGCAGCTGG GCGAGAACAA CGACGTGCGCCTCACCCGCGACGCGCTCGAGCCGTGCACCGTGGGCCACC GCGGCTACTT CATCTTCGGCGGGGGCTACGTGTACTTCGAGGAGTACGCGTACTCTCACC AGCTGAGTCG CGCCGACGTCACCACCGTCAGCACCTTCATCGACCTGAACATCACCATGC TGGAGGACCA CGAGTTTGTGCCCCTGGAGGTCTACACGCGCCACGAGATCAAGGACAGCG GCCTGCTGGA CTACACGGAGGTCCAGCGCCGCAACCAGCTGCACGACCTGCGCTTTGCCG ACATCGACAC GGTCATCCGCGCCGACGCCAACGCCGCCATGTTCGCGGGGCTGTGCGCGT TCTTCGAGGG GATGGGGGACTTGGGGCGCGCGGTCGGCAAGGTAGTCATGGGAGTAGTGG GGGGCGTGGT GTCGGCCGTCTCGGGCGTGTCCTCCTTTATGTCCAACCCCTTCGGGGCGC TTGCCGTGGG GCTGCTGGTCCTGGCCGGCCTGGTCGCGGCCTTCTTCGCCTTCCGCTACG TCCTGCAACT GCAACGCAATCCCATGAAGGCCCTGTATCCGCTCACCACCAAGGAACTCA AGACTTCCGA CCCCGGGGGCGTGGGCGGGGAGGGGGAGGAAGGCGCGGAGGGGGGCGGGT TTGACGAGGC CAAGTTGGCCGAGGCCCGAGAAATGATCCGATATATGGCTTTGGTGTCGG CCATGGAGCG CACGGAACACAAGGCCAGAAAGAAGGGCACGAGCGCCCTGCTCAGCTCCA AGGTCACCAA CATGGTTCTGCGCAAGCGCAACAAAGCCAGGTACTCTCCGCTCCACAACG AGGACGAGGC CGGAGACGAAGACGAGCTCTAAGGGAGGGGAGGGGAGCTGGGCTTGTGTA TAAATAAAAA GACACCGATGTTCAAAAATACACA(SEQIDNO:335)

    FDA Approved Vaccines.

    [0101] The vaccines approved by the FDA were used to engineer AVEC as AVEC vaccine domains and to use as the references: Engerix, Recombivax, Gardasil, Cervarix.

    Linkers

    [0102] The AVEC functional domains are integrated with the aid of three methods: bifunctional chemical linkers aka spacers, and amino acid (AA) linkers and spacers by recombinant expression from DNA sequences coding for AA linkers.

    Bifunctional Chemical Linkers.

    [0103] Linkers facilitating integration of the aforementioned antibodies and vaccines are listed below. They are used as homo- or hetero-specific linkers depending if the functional groups aimed at docking the linkers are the same in the antibody and the vaccine or different, i.e., choosing from the combinations of NH2-, SH, COOH. The specific protocols of using them are provided by their manufacturers, while some of them as are outlined including, but not limited, as shown below in Examples and References. [28, 31, 32]. [0104] A Linker SMBC [0105] B Linker SMCC [0106] C Linker EDC [0107] D Linker PTAD [0108] E Linker BMC [0109] F Linker NHS ester [0110] G Linker isothiocyanate [0111] H Linker benzoyl fluorides I Linker maleimide [0112] J Linker iodoacetamide K Linker thiopyridines [0113] L Linker arylopropiolonitrile [0114] M Linker diazonia

    Amino Acid (AA) Linkers

    [0115] The AA linkers are incorporated into AVEC by two main biomolecular strategies: either after synthesis of transgenic expression of the AA oligopeptide they are modified with the bifunctional linkers described above, or the DNA coding sequences are designed to be inserted into the DNA constructs between the coding sequences for the antibody and the vaccine, if the AVEC are expressed as the fusion proteins. The AA linkers' functions', in addition to integrating, involve creating a flexible spacer, changing hydrophobicity/hydrophilicity of AVEC, altering half-life of AVEC, promoting or reducing immunogenicity of AVEC. In some DNA constructs coding for AVEC as fusion proteins, the DNA sequences were omitted altogether; thus resulting in AVEC as the fusion protein comprising directly connected domains: the antibody and the vaccine. Some of the linkers tested are listed below, while the specific details of the methods are provided in References and Examples. The AA sequences are provided in the one letter code with p,q,r,s,t,u being the numbers: 1-1000. [0116] A Linker (SmSnSoGp)q [0117] B Linker PEG 0-100 kDa [0118] C Linker 6-aminohexanoic acid: H2N(CH2)p-COOH [0119] D Linker H2n-(CH2)q-NH2 [0120] E Linker COOH(CH2)r-NH2 [0121] F Linker COOH(CH2)s-COOH [0122] G Linker COOH(CH2)t-SH [0123] H Linker SH(CH2)u-NH2

    DNA Sequences Coding for AA Linkers

    [0124] DNA sequences were synthesized as oligonucleotides. They were either expressed in the human expression systems outlined above as oligopeptides and used as linkers as described above or incorporated in the antibody and vaccine expression vectors described above according to the standard detailed protocols in References and Examples.

    Reporters

    [0125] The molecules having specific features facilitating their detection with the dedicated instruments were incorporated into AVEC as to report their presence, location, concentration, absorption, distribution, metabolism, clearance in/by cells and in the patients' bodies. They are incorporated directly into AVEC or through binding domains (e.g., metal binding domains, or chelating domains) relying upon the standard detailed protocols as outlined in the manufacturers' recommendations, published in the peer-reviewed journals, cited in References, and described in Examples. In some embodiments, they comprise the fluorochromes, magnets, noble metals, radionuclides, and bubbles.

    Reporters Comprising Magnets for Magnetic Activation Cell Sorting (MACS), Nuclear Magnetic Resonance (NMR), Magnetic Resonance Imaging (MRI)

    [0126] A Reporter domain comprising Gd, [0127] B Reporter domain comprising Eu, [0128] C Reporter domain comprising Fe, [0129] D Reporter domain comprising Ni, [0130] E Reporter domain comprising Co.
    Reporters Comprising Fluorochromes for Detection with Flow Cytometry (FCM), Fluorescence Activated Cell Sorting (FACS), Whole Body Fluorescent Imaging [0131] A Reporter domain comprising FITC, B Reporter domain comprising RITC, [0132] C Reporter domain comprising rhodamine(s), D Reporter domain comprising TR, [0133] E Reporter domain comprising indocyanin green, [0134] F Reporter domain comprising phycoerythrins, [0135] G Reporter domain comprising Alexa(s), H Reporter domain comprising BODIPYs, I Reporter domain comprising DRAQs, [0136] J Reporter domain comprising CYTRAK, K Reporter domain comprising coumarins, L Reporter domain comprising Pacific(s), M Reporter domain comprising Cy(s), [0137] N Reporter domain comprising IRD(s), O Reporter domain comprising Tb [0138] P Reporter domain comprising Eu [0139] P Reporter domain comprising Green fluorescent proteins and their modifications.

    Reporters Comprising Noble Metals for Energy Dispersion X-Ray Spectroscopy (EDX), Total Reflection X-Ray Fluoroscopy (TXRF), X-Ray Imaging, Raman, Mass Spectroscopy, Computed Tomography (CT)

    [0140] A Reporter domain comprising Au, [0141] B Reporter domain comprising Pt, [0142] C Reporter domain comprising Pd, [0143] D Reporter domain comprising Ag.

    Reporters Comprising Radionuclides for Gamma-Scintigraphy, Single Photon Emission Tomography (SPECT), Positron Emission Tomography (PET)

    [0144] A Reporter domain comprising Tc99m, [0145] B Reporter domain comprising I125, [0146] C Reporter domain comprising I131, [0147] D Reporter domain comprising F18, [0148] E Reporter domain comprising Cu64.

    Utility of AVEC for Therapy

    [0149] The two types of studies are conducted to demonstrate safety and efficacy of AVEC in therapy of cancer patients: in vitro ex vivo and in vivo.

    [0150] In vitro ex vivo studies are conducted by establishing tissue cultures as models of in vivo tissues being encountered by AVEC. As reported above, in the peer-reviewed articles, Examples, and References, these human artery and vein endothelial cells, human normal breast tissues, human normal ovary surface cells, human normal prostate tissue, white blood cells, erythrocytes, platelets, etc. For the biopsies of these cells from the specific patients, the results of these studies can be included into the diagnostic process, while designing the dose and regimens of therapy, as the precision, personalized medicine.

    [0151] In vivo studies involve procedures considered to be minimally invasive surgery: subcutaneous injections and intravenous infusions. They are always preceded by presenting the Patient Bill of Rights, by receiving the Patient Informed Consent, and being conducted by the physician.

    EXAMPLES

    [0152] Having described the invention with reference to the embodiments and illustrative examples, those in the art may appreciate modifications to the invention as described and illustrated that do not depart from the spirit and scope of the invention, which is fully original, not occurring in nature, and not obvious, as disclosed in the specification. The examples are set forth to aid in understanding the invention, but are not intended to, and should not be construed to limit its scope in any way. The examples do not include detailed descriptions of conventional methods, instruments, sequences, and reagents, which are referenced to the published literature describing previous art. Such methods are well known to those of ordinary skill in the art and are described in numerous publications referenced herein. Further, all references cited above and in the examples below are hereby incorporated by reference in their entirety, as if fully set forth herein.

    Example 1: Patients

    [0153] Blood and cancer biopsies were acquired from the ten patients suffering from the advanced breast, ovarian, colorectal, prostate, and lung cancers, from the Acute and Chronic Infection with Hepatitis B virus, Herpes Simplex virus, Human Papilloma virus, Epstein Barr virus, Cytomegalovirus, and from the healthy volunteers having various titers of antibodies induced by standard HBV or HPV vaccinations. All biopsies were acquired in accordance with the Declaration of Helsinki, Institutional Review Board approval, and with Patients' Informed Consent (PIC), who were first presented with the Patient Bill of Rights. In each and every example described herein, the aforementioned procedure was thoroughly pursued. All the procedures were in strict compliance to the standards of Good Medical Practice and conducted by physicians serving under the Hippocratic Oath.

    Example 2: Generation of Antibodies as Antibody Domains of AVEC

    [0154] For generating of anti-HBsAg, anti-HBcAg, anti-HBcAg antibodies the B cell were acquired from the patients suffering from the Acute and Chronic Hepatitis B. The protocol was identical to that published [21, 22, 31, 32]. Dane particles and HBV, isolated from the patients' blood by PEG gradients precipitation or from liver biopsies by CsCl gradient centrifugations, were rapidly frozen, lyophilized and stored.

    [0155] Biotechnology of human anti-HER-2 antibodies synthesis was pursued by adaptation of that originally described, either as new antibodies or as biosimilars to the FDA approved trastuzumab, pertuzumab, cetuximab, panitumumab, alemtuzumab, rituximab. The FDA approved: trastuzumab, pertuzumab, cetuximab, panitumumab, alemtuzumab, rituximab were included into the project as the references. For designing of the DNA plasmid constructs for the aforementioned biosimilar antibodies the coding sequences were imported from the ImMunoGeneTics antibody sequences' bank (IMGT, Paris, F, EU).

    [0156] HBsAg, gB, gH, gD, gL, HER-2, EGFR, EpCAM, p350, VP16, VP18 were produced in human hepatoma or myeloma cells transfected with plasmid DNA. Prior to selection, during in vitro evolution, they were reconstituted with buffer and served as the molecular baits. They also served as the negative controls for antibodies.

    [0157] For generating of anti-HSVgB and anti-HSVgD antibodies the B cell were acquired from the patients suffering from the Herpes Simplex. The protocol was identical to that described above.

    [0158] For generating of anti-HPV-VP 16 and 18 antibodies the B cell were acquired from the patients suffering from the Human Papilloma Virus. The protocol was identical to that described above.

    [0159] Designing, engineering, and manufacturing such AVEC marker binding domains may be accomplished as follows. IgG, scFv, dsFvs, sdFvs, and CDRs against were constructed by generating combinatorial display libraries using HEK293 cell and mRNA displays according to published protocols (31, 32).

    [0160] The cancer patients' blood was drawn as small aliquots under the informed consent based upon the IRB approved protocol. To 2 ml of anticoagulant-treated blood, 2 ml of balanced salt solution were added and mixed. Unto the top of 3 ml of the Ficoll-Paque Plus in Falcon tube, 4 ml of diluted blood were layered without mixing. The samples were centrifuged at 400 g for 30-40 minutes at 18-20 C. This led to separation of the sample into four layers: 1. plasma (top), 2. lymphocytes, 3. Ficoll-Paque Plus, and 4. granulocytes, erythrocytes. After discarding the plasma, the lymphocyte layer was transferred to the new Falcon tube, to which at least 3 volumes of balanced salt solution were added and mixed. The sample was centrifuged at 400 g for 10 minutes at 18-20 C. The supernatant was removed. The lymphocytes were resuspended in 6-8 ml balanced salt solution. The cells were counted on the Beckman Coulter cell counter with forward scattering indicative of cells' sizes and side scattering indicating their viability granularity.

    [0161] The B cells were isolated by negative selection. Non-B cells, i.e., T cells, NK cells, monocytes, dendritic cells, granulocytes, platelets, and erythroid cells depletion was performed with antibodies against CD2, CD14, CD16, CD36, CD43, and CD23 tagged with our magnetic beads. This left the sample with a pure population of untouched B cells. This was validated by labeling of B cells with CD19 and CD20. The samples were further processed or stored in liquid nitrogen.

    [0162] After extracting total RNA from the isolated lymphocytes Trizol (MRC) according to published protocols [22], RT-PCR was performed to amplify human antibody complementarity determining regions (CDRs) and framework regions (FRs). cDNA was prepared using SuperScript III First-Strand Synthesis System (Invitrogen). Alternatively, cDNA was obtained by Cells-To-cDNA kit from Qiagen. Approximately, 5 pg to 25 pg of RNA or mRNA was reverse transcribed into the first-strand cDNA.

    [0163] The CDR and FR cDNA was then amplified by PCR. The primers were selected from those published as listed above.

    [0164] Using the cDNA and combinations of these primers, the CDRs and FRs from cDNA samples were amplified using standard PCR protocols including preparing the following mixture in PCR multi well plates: ddH2O, 2 High Fidelity PCR Master, Forward primer, Reverse primer, and cDNA; and cycling on ABI 7900 or 7500 FAST: (a) 4 min at 94 C.; (b) 45 sec at 94 C.; 45 sec at 55 C.; 1 min at 72 C.30 cycles; (c) 5 min at 72 C.

    [0165] The amplicons were run on 2% agarose gel, stained with SybrGold, and imaged with Storm 840. These primers were either cloned under used for diversification after PCR introducing the following restriction sites: [0166] Sfi I: 5 GGCC NNNN*N GGCC . . . 3; and [0167] Sacll: 5 CCGC*GG . . . 3;
    and then assembled into single chain variable fragments (scFv), single domain variable fragments (sdFv), dual chain variable fragments (dcFvs), or complementary domain regions (CDRs) within the human IgG framework.

    [0168] HEK293, Phage, and mRNA Displays.

    [0169] The PCR amplicons digested with the sril and Sacll (New England Biolabs, Ipswich, Mass.), gel purified, and ligated into the pDisplay (Invitrogen), which contains a PDGFR anchor. The ligation mix was used to transform E. coli TOP10 cells (Invitrogen). Each transformation produced surface display library containing 10A6 clones. This was further diversified. DNA was recovered with Miniprep from Qiagen.

    [0170] HEK293T cells were grown in DMEM with DCS and were transfected using Lipofectamine Plus. After 72 h, they were labeled with antimyc and purified receptor protein ged with magnetic beads or fluorochromes. This allowed isolation of positive expressors from the medium. DNA was recovered from each clone in preparation for determination of affinity constant after HEK293T expression and for sequencing.

    [0171] Phagemid pComb3X cut with Sfil was used to clone CDR and FR after multiple rounds of PCR with overlap extension and to get CDRs and FRs together. The inserts were ligated into the vector with T4 ligase followed by desalting with Amicon Ultra-4. TG1 electroporation-competent cells were transfected with desalted ligations by electroporation and grown in 2YT medium. Qiagen HiSpeed Plasmid Maxi Kit was used for phagemid preparation. mRNA display and expression was performed as previously described. Selection of internalizing vs non-internalizing clones of scFv, dcFv, sdFv, IgG, Fab, (Fab)2 was performed as previously described.

    Example 3: Biomolecular Engineering of HBsAg

    [0172] HBsAg was isolated from the patients suffering from Acute and/or Chronic Hepatitis B: either from the blood by PEG fractionations or from the liver biopsies by CsCl gradient centrifugation. To assure exact immunogenic compatibility with the immunity induced by vaccinations with the FDA approved HBsAg, which were produced in yeast, the HBsAg in this project were also generated in yeast as originally described. Biotechnology of the recombinant HBsAg was pursued based upon the published DNA coding sequence. Hepatitis B virus like particles (VLP) were initially synthesized in yeastSaccharomyces cerevisiae as originally described. In particular, the expression plasmid pHBS-16 included the HBsAg surface antigen (HBsAg) controlled by the yeast alcohol dehydrogenase (ADHI) promoter through introduced by EcoRI restriction sites into the DNA construct of the pBR322 plasmid. That followed by yeast replication origin, yeast trp1 gene. This biotechnology was later modified to be pursued in Pichia pastoris. Briefly, yeast cultures of Pichia pastoris were grown at 30 C. in rich medium (YPD; 1% yeast extract, 2% bactopeptone, 2% glucose) initially and shifted either to synthetic media (YNM, 0.67% yeast nitrogen base supplemented with 0.5% (v/v) methanol) for immunoprecipitation and immunofluorescence experiments, or to mineral media (MMOT, 0.2% (v/v) oleate and 0.02% (v/v) Tween-40) for fractionation studies. All the protocols' productsHBsAg VLPs were referenced and validated to the FDA approved and the CDC recommended Engerix B and Recombivax and standard clinical diagnostics.

    Example 4: Biotechnology of Mimotopes

    [0173] Design of HER-2 cyclic mimotopes was initiated by importing the DNA from the GenBank and in vitro translation into amino acid sequences or direct amino acid sequences from SwissProt into the Peptide 3D or Laser-Gene software. That followed by determination of surface displayed domains. Further analysis led to selection of the most likely immunogenic domains. The 12-40 amino acids long sequences were selected. The amino acid sequences were exported directly into the program of the peptide synthesizer (ABI, Foster City, Calif.). The selected sequences were altered by introducing glycine linkers with terminal cysteines at both amino and carboxyl terminus of the peptide designs. The designed peptides were synthesized as linear on the peptide synthesizer. After detachment from the cartridges, the peptides were converted into cyclics by means of the cysteines. The synthetic productsHER-2 mimotopes were selected on the high pressure liquid chromatography columns. The specificity of the mimotopes was validated by binding to trastuzumab and ant-HER-2 antibodies with the aid of MACS or FACS.

    Example 5: Biomolecular Engineering of AVEC: Anti-Her-2HBsAg

    [0174] The synthetic anti-HER-2 antibodies and synthetic HBsAg VLPs were linked with heterospecific, bifunctional linker: sulfo-m-maleimidobenzoyl-N-hydroxysuccinimide hydroxysuccinimide ester (SMBS). Briefly, the anti-HER-2 antibody was dialyzed against 0.15 M sodium chloride, 0.1 M sodium phosphate, at pH 7.2.

    [0175] Sulfo-MBS stock in DMSO was added to this solution up to the final 2% w/v concentration to assure at least 80 molar excess. After 1 h at room temperature, the reaction solution was rapidly applied to desalting columns. Performing chromatography with the 0.15 M sodium chloride, 0.1 M sodium phosphate, at pH 7.2 carrier solution was followed by pooling the activated anti-HER-2 antibodies 1 ml fractions. To this solution, the synthetic HBsAg diluted in the same carrier solution was promptly added to assure 1:1 ratio. The reaction continued for 1 h at room temperature. The effective anti-HER-2HBsAg clusters were isolated by chromatography. The specificity of the anti-HER-2HBsAg to label HER-2 receptors was validated by FCM on cells and by NMR and XRFS on mimotopes. The specificity of the anti-HER-2HBsAg to attract immune response was validated by labeling with anti-HBsAg antibodies rendered fluorescent for FCM or superparamagnetic for NMR.

    Example 6: Cell Cultures

    [0176] Many cell lines have been used described herein. Examples of such cell lines shown are shown in Table 1, and were grown in media recommended by ATCC in incubators (New Brunswick, Fisher, Napco) in saturated humidity, 37 deg C., 5% CO2. The cell lines were selected to cover the entire spectrum of lineages (including cancers of breast, ovary, colorectum, prostate, lymphoid, lung, testis, pancreas, cervix, liver, and brain), malignancy, metastasis, expression of receptors, and presence of mutations. On all these cell lines, the proof of concept was validated as described herein. All cell lines were obtained from ATCC unless otherwise noted.

    TABLE-US-00006 TABLE 1 AVEC TESTED CELL LINES INDEXED AT ATCC Cell Lines that SKBR3 from ATCC as HTB30 (overexpressed strongly) Overexpress UACC893 (20x gene amp) HER2 UACC812 (15x gene amp) CRL2338 from ATCC with designation HCC1954 (overexpressed strongly) AU565 from ATCC as CRL2351 (overexpressed strongly) MAC117 (gene amp 7x) MDA-MB453 (a bit more than MCF7, just above base ~3x) BT474 from ATCC as CRL CRL2340 from ATCC HCC2157 HCC2218 from ATCC as CRL2343 BT483 Cell Lines that HTB22 from ATCC with designation MCF7 (base) express a Basal HBL100 Levels of HER2 MB231 HCC202 (basal or overexpressed) CRL 2320 HCC1008 from ATCC as (basal or overexpressed) metastatic NCI-H23 (basal or overexpressed) lung cancer Cell Lines that CRL2314 from ATCC with designation HCC38 are negative for CRL2315 HCC70 from ATCC HER2 CRL2321 HCC1143 from ATCC CRL2322 HCC1187 from ATCC CRL2324 HCC1395 from ATCC CRL2326 HCC1419 from ATCC CRL2327 HCC1428 from ATCC CRL2329 HCC1500 from ATCC CRL2330 HCC1569 from ATCC CRL2331 HCC1599 from ATCC CRL2336 HCC1937 from ATCC as (BRCA mut) CRL2343 HCC2218 from ATCC Cell Lines that HBE135-E6E7 from ATCC as CRL2741 (also high TGF) bronchial ducts Overexpress A431 EGFR Cell Lines that CRL2918 from ATCC designation Nm2C5 EGFR pos (basal or over) express a Basal CRL2919 from ATCC designation Nm2C5 gfp EGFR pos (basal or over) Levels of EGFR M4A4 (basal or over) NCI-H23 (basal or over) Mutation A750del in EGFR CRL2868 adenocarcinoma Mutation A751del in EGFR CRL2869 adenocarcinoma Mutation A751del in EGFR CRL2871 adenocarcinoma HTB127 from ATCC with designation MDA-MB-330 (basal or over) HTB132 from ATCC with designation MDA-MB-468 (basal or over) HTB26 from ATCC designated MDA_MB_231 (basal or over) Reference Cell EGFR A431 2-6 10receptors per cell Lines HER2 BT474 6-10 10receptor per cell EGFR Normal breast primary culture 8% of A431 HER2 Normal breast primary culture 3% of A431 Cell Line with a UG87mutant Mutation of EGFRvIII

    [0177] The cell line CRL-2340 HCC2157 was derived from the ductal carcinoma of the mammary gland tumor classified as TNM se lilA, grade 2, with lymph node metastasis. The cells were grown in a 1:1 mixture of Ham's F12 medium with 2.5 mM L-glutamine and Dulbecco's Modified Eagle's Medium adjusted to contain 1.2 gIL sodium bicarbonate with additional supplements (ATCC).

    [0178] The cell line MCF7 HTB-22. The cells are positive for estrogen receptor and express WNT7B oncogene. The medium to culture this cell line is Eagle's Minimum Essential Medium (ATCC) with these added components: 0.01 mg/ml bovine insulin; donor bovine serum to a final concentration of 10%.

    [0179] The cell line 184A1 CRL-8798 was originally established from normal mammary tissue and was transformed to benzopyrene. The line appears to be immortal, but is not malignant. The line grows in Mammary Epithelial Growth Medium (MEGM) (Clonetics) supplemented with 0.005 mg/ml transferrin and 1 ng/ml cholera toxin.

    [0180] Several of the cell lines used in the experiments described herein are further described in more details. The cell lines TOV-112D CRL-11731 and CRL-11732 OV-90 were derived from primary malignant adenocarcinomas of the ovary at grade 3, se IIIC. They were cultured in a 1:1 mixture of MCDB 105 medium and Medium 199, 85%; donor bovine serum 15% (ATCC). The cells were tumorigenic in nude mice. They formed colonies and spheroids when cultured in soft agar. The cells tested positive for HER2/neu and p53 mutation.

    [0181] The cell line NIH OVCAR-3 HTB-161 was derived from the cells in ascites of a patient with malignant adenocarcinoma of the ovary. The cell line was grown in RPMI-1640 Medium (ATCC) supplemented with 0.01 mg/ml bovine insulin and donor bovine serum to a final concentration of 20%. The epithelial cells were positive for estrogen and progesterone receptor. They formed tumors in nude mice.

    [0182] The normal, adherent fibroblast cell line Detroit 573 CCL-117 was derived from skin. It is grown in Minimum essential medium (Eagle) in Earle's BSS with nonessential amino acids (ATCC), sodium pyruvate (1 mM) and lactalbumin hydrolysate (0.1%), 90%; fetal bovine serum, 10%. The cells were grown into spheroids within a synthetic extracellular matrix.

    [0183] Viability Tests and Doubling Times.

    [0184] The cells were stained with Hoechst vs PI and counted on Beckman Coulter flow cytometer to determine ratios between total number of cells and dead cells at 24 hour intervals to determine doubling times and viability.

    [0185] Selection of Clones with High Metastatic Potential.

    [0186] For the in vitro studies described herein, cell lines described above were grown as described above. They were resuspended and spilled over the endothelial cells grown over extracellular basement membrane as described in the details previously (22). After short incubation at 37 deg. C., the cells cultures were rinsed with media, while removing non-adherent cancer cells. The attached cells were resuspended again and split into single clones grown in multiwell plates. These enriched clones were used for further studies because they imitated the metastatic clones of the lines derived from the primary tumor.

    [0187] Immunolabeling.

    [0188] Cell spheroids grown in the culture were spun down at 300g. The cells were resuspended in the donor serum or whole blood to which superparamagentic scFv were added. Upon completion of labeling, the cells were rinsed with PBS. They were studied with CT, MRI, USG, FL, RSI, PET, SPECT, or NMR or alternatively processed by freezing in preparation for laser scanning confocal microscopy (LSCM) or EDXSI or EELS. Alternatively, cell lysates electrotransferred onto PVDF membranes were immunolabeled with scFv with or without chelated metal atoms.

    [0189] Freezing and Freeze-Substitution of Cell Spheroids.

    [0190] The details of cryoimmobilization of cultures of cell spheroids by freezing are described previously and are only briefly presented here (21). Briefly, cells were injected into chambers were rapidly frozen in nitrogen slurry down to down to 196 C. The frozen samples were placed into methanol that was precooled to 90 C. in the freezer (ThermoNoran).

    [0191] Temperatures were maintained at 90 C., 35 C., and 0 C. for 48 hours. Infiltration with Lowicryl preceded polymerization with UV at 35 C. and ultramicrotomy. Alternatively, critical point drying was followed by fast atom beam sputter coating (lonTech).

    [0192] Native Electrophoresis.

    [0193] A 2% agarose gel was poured using a 10 mM Tris, 31 mM NaCl buffer of varying pH that did not contain any denaturing agents. The samples in their native state were loaded after being mixed with glycerol to add density without denaturing the proteins. The gel was run in the same buffer used for pouring the agarose at 60 mAmps until the desired separation was reached as determined by the presence of fluorescent markers with a molecular weight higher and lower than the scFv tested. The gel was then stained for 30 minutes in Sypro Tangerine Gel Stain (Invitrogen) diluted in the running buffer before imaging using a FluorImager (Molecular Dynamics).

    [0194] SDS-PAGE.

    [0195] Electrophoresis was run on 12% polyacrylamide gel. Several 0.75 thick combs with the 2 mm lanes were loaded with standard, cell culture Iysates. The samples, after mixing with SDS and DTT containing sample buffers (Sigma) were loaded into the wells. The gels were run using a Tris/Glycine/SDS/DTT running buffers. After the run, the gels were stained with colloidal silver or Sypro Tangerine for imaging using Storm 840 or FluorImager (Molecular Dynamics).

    [0196] Electrotransfer.

    [0197] After electrophoresis, the samples were immediately transferred onto PVDF. The immunoblotting was performed with the Mini Trans-Blot Cell (Bio-Rad) within CAPS: 10 mM 3-[Cyclohexylamino]-1-propanesulfonic acid (CAPS), Tris/glycine transfer buffer 25 mM Tris base, 192 mM glycine, pH 8.3. Prior to the transfer, the cooling units were stored with deionized water at 20 C. Immediately after electrophoresis the gel, membrane, filter papers and fiber pads were soaked in transfer buffer for 5-10 minutes. The pre-cooled transfer units were filled with cooled transfer buffer. Alternatively, magnetic field generator was approached by the tube or plate containing an aliquot of the patient's blood supplemented with AVEC. The labeled cells were retained, while the blood withdrawn. After rinsing with PBS, the labeled cancer cells were retained for further studies on the counting chamber, fluorometer, and/or confocal.

    [0198] Laser Scanning Confocal Microscopy.

    [0199] (LSCM) The three-dimensional stacks of the cells labeled with AVEC were imaged with the Olympus or Leica laser scanning confocal systems. Excitation wavelengths were used: 337, 488, 543, and 588 nm. Alternatively, reflected or Raman optics were used. Images were acquired with Kernel filtration and deconvolution of the data was followed by 3D or cascade display for analysis.

    [0200] Spectral Mapping Using Energy Dispersive X-Ray Analysis Spectroscopic Imaging (EDXDI) and Electron Energy Loss Spectroscopic Imaging (EELSI).

    [0201] Supramolecular architecture analysis of the AVEC was performed with Field Emission Scanning Electron Microscope with Energy Dispersive X-Ray Spectral Imaging System (EDXSI)Hitachi 3400. Complete elemental spectra were acquired for every pixel of the scans to create the elemental databases. From them, after selecting an element specific energy window, the map of this element atoms distribution was extracted and ZAF correction calculated (NIST). As AVEC were ged with superparamagnetic metal particles (nanoclusters or core-shell nanoparticles) or noble metal nanoparticles were ged or incorporated into their structures, their location was determined based upon spectral elemental maps superimposed over molecular architecture with zero loss or carbon edge tuning (21). Purity of elemental composition and geometry of gold nanoparticles were evaluated with EOXSI using Vacuum Generators 501, Hitachi 5900, and JEOL 1540 instruments under control of Gatan, Voyager software.

    [0202] X-Ray, Atomic Absorption Spectroscopic, Surface Plasmon Resonance Detection, Centrifugation, and Selection.

    [0203] One molecule of AVEC with one gold nanoparticle having about 100-1000 atoms of gold with the diameter 1.59 A and mass 197 amu each increased mass of scFv ged up to 19,9660a and that is made of about 1000 atoms up to 196,6670a. Separation of AVEC markers from blood via centrifugation in response to gravity during centrifugation at low g, compared to unlabeled ones. This did lead to very simple and rapid separation of AVEC markers from the aliquot of the patient's blood.

    [0204] CTComputed X-Ray Tomography.

    [0205] For evaluating relative contrast agents in CT, solutions of 1M, 0.1 M, 0.01 M, and 0.001 M, 0.0001 M sodium iodide, calcium chloride, gold chloride, and gold nanoparticles of various sizes in deionized water were dispensed into the wells of microarray plates. Additional rows contained blood, physiological saline, while an additional row was left empty, i.e., to contain air. Computed tomography was pursued with Toshiba Aquilion 64-slice clinical scanner. Initial settings were as follows: vole 120 peak kV, current 40 mA, exposure time of 0.6 s, slice setting 0.5 mm (the slices that were thereafter compressed into 2 mm display images), (modifications of these settings were indicated in the figure legends). ImageQuantTL version 1.1.0.1 was used to evaluate relative peak pixel intensity of the samples on the computed tomography images utilizing a 0 to 255 level grayscale. The Aquilion scanner may also record phantoms for use in detecting biomarker density by measuring the signal intensity of the AVEC in Haunsfield units.

    [0206] Nuclear Magnetic Resonance and Selection.

    [0207] The wide-bore nuclear magnetic resonance (NMR) spectrometer operated at 9T (Brucker) with a mouse-cage resonator was used to evaluate relative relaxivity of the samples based upon T1 measurements. T1 spin lattice relaxation time calculated using inversion recovery pulse sequence was measured using inversion recovery imaging with Tl=50-4000 ms in 100 ms increments. T1 was also calculated from T1-weighted fluid-attenuated inversion recovery (T1-FLAIR) sequence (TrITe/Flip=2210/9.6/90), as well as standard T1 weighted imaging sequences (TrITe/Flip=400/6/90). For studies of labeling in vitro, a small table top NMR spectrometer was used at 0.5T. After labeling with superparamagnetic scFv, the blood sample containing labeled cancer cells was injected into microfluidic channel of 20 micron in diameter, which was placed with the field. Passage of the single cell, which was labeled with superparamagnetic scFv, was determined by the spectral response and recorded.

    Reporter Domains

    [0208] Reporter domains that may be used in accordance with the embodiments described herein may include, but are not limited to ions and nanoparticles, radioactive substances (e.g., radioisotopes, radionuclides, radiolabels or radiotracers), dyes, contrast agents, fluorescent compounds or molecules, bioluminescent compounds or molecules, enzymes and enhancing agents (e.g., paramagnetic ions), or a fluorochrome or a microbubble or a radionuclide.

    [0209] In one embodiment, the reporter component is a metal nanoparticle. The metal nanoparticles may be formed from a single suitable solid metal or from a combination of two or more suitable metals.

    [0210] In some embodiments, the metal nanoparticle may comprise a nanoparticle derived from a noble metal, including, but not limited to, Gold (Au), Platinum (Pt), Palladium (Pd) and Silver (Ag).

    [0211] In other embodiments, the metal nanoparticle may comprise a superparamagnetic metal, including, but not limited to, Europium (Eu), Gadolinium (Gd), Iron (Fe), Nickel (Ni) or Cobalt (Co).

    [0212] In other embodiments, the metal nanoparticle may comprise a nanoparticle derived from a fluorescent metal, including, but not limited to, Europium (Eu) and Terbium (Tb).

    [0213] Some metal nanoparticles can be made as chelated nanoclusters or as coreshell nanoparticles, which have a superparamagnetic, heavy metal or fluorescent metal core that is sealed inside a noble metal layer These metals include ions of Cr, Va, Mn, Fe, Co, Ni, Cu, La, Ce, Pr, Nd, Pm, Sm, Eu, Gd, Tb, Dy, Ho, Er, Tm, Yb, Ru, and Lu.

    [0214] Other nanoparticles may be made as a microbubble nanoparticle, having a noble metal outer layer, with a hollow core.

    [0215] In addition, it should be noted that some nanoparticles, for example, quantum dots, may also be suitable for use as a detection agent.

    [0216] Radioactive substances that may be used as a reporter component in accordance with the embodiments of the disclosure include, but are not limited to, .sup.18F, .sup.32P, .sup.33P, .sup.45Ti, .sup.47Sc, .sup.52Fe, 59Fe, .sup.62Cu, .sup.64Cu, .sup.67Cu, .sup.67Ga, .sup.68Ga, .sup.75Sc, .sup.77As, .sup.86Y, .sup.90Y. .sup.89Sr, .sup.89Zr, .sup.94Tc, .sup.94Tc, .sup.99mTc, .sup.99mMo, .sup.105Pd, .sup.105Rh, .sup.111Ag, .sup.111In, .sup.123I, .sup.124I, .sup.125I, .sup.131I, .sup.142Pr, .sup.143Pr, .sup.149Pm, .sup.153Sm, .sup.154158Gd, .sup.161Tb, .sup.166Dy, .sup.166Ho, .sup.169Er, .sup.175Lu, .sup.177Lu, .sup.186Re, .sup.188Re, .sup.189Re, .sup.194Ir, .sup.198Au, .sup.199Au, .sup.211At, .sup.211Pb, .sup.212Bi, .sup.212Pb, .sup.213Bi, .sup.223Ra and .sup.225Ac.

    [0217] Paramagnetic ions that may be used as reporter components in accordance with the embodiments of the disclosure include, but are not limited to, ions of transition and lanthanide metals (e.g. metals having atomic numbers of 6 to 9, 21, 29, 42, 43, 44, 57, 71). These metals include ions of Cr, V, Mn, Fe, Co, Ni, Cu, La, Ce, Pr, Nd, Pm, Sm, Eu, Gd, Tb, Dy, Ho, Er, Tm, Yb, Ru, and Lu.

    Example 7: Generation of Reporters by Incorporating Noble Metals

    [0218] To ensure the bio-safety, sensitivity, and accuracy of AVEC used in vivo as described herein, a stable link between AVEC and a reporter molecule such as a noble metal atom was accomplished by designing and engineering various metal binding domains (MBD).

    [0219] They include binding domains of noble metals (e.g., Au, Ag, Pd, Pt) and paramagnetic and/or their salts (e.g., Gd, Eu, Fe, Co, Ni, iron oxides, or other suitable metals) and for nanoparticles assembled into the core-shell suitable for EDX, XRTFS, CT, Mass Spec., are listed below where n: 0-1000:

    TABLE-US-00007 MAP16-B (SEQIDNO:336) (Gly-)n-CyS (SEQIDNO:337) (Gly-Arg-)n-Cys (SEQIDNO:338) (Gly-Lys-)n-CyS (SEQIDNO:339) (Gly-Asp-Gly-Arg)n-Cys (SEQIDNO:340) (Gly-Glu-GlyArg)n-Cys (SEQIDNO:341) (Gly-Asp-Gly-Lys)n-Cys (SEQIDNO:342) (Gly-Glu-Gly-Lys)n-CyS
    Gd or Eu binding domains suitable for MRI and NMR, as well as MACS are listed below:

    TABLE-US-00008 (SEQIDNO:343) (Glu-Glu-Glu-Glu-Glu)n (SEQIDNO:344) (Glu-Glu-Glu-Glu-Glu-Glu)n (SEQIDNO:345) (Asp-Asp-Asp-Asp-AsP)n (SEQIDNO:346) (Asp-Asp-Asp-Asp-Asp-AsP)n (SEQIDNO:347) Phe-His-Cys-Pro-Tyr-Asp-Leu-Cys-His-Ile-Leu NiandCobindingdomainsaa: (SEQIDNO:348) (Gly-Asp-Gly-Arg)n-(His)5,6 (SEQIDNO:349) (Gly-Glu-GlyArg)n-(His)5,6 (SEQIDNO:350) (Gly-Asp-Gly-Lys)n-(His)5,6 (SEQIDNO:351) (Gly-Glu-Gly-Lys)n-(His)5,6 (SEQIDNO:352) (Gly-Arg-)n-(His)5,6 (SEQIDNO:353) (Gly-Lys-v-(His)5,6

    [0220] Beckman BIOMEK FX Span-8 and 96 Channel Robotic System was loaded with each of the domains within a separate channel. In particular one of the channels contained the noble metal nanoparticles (e.g., gold) or superaparamagnetic, or core shell nanoparticles. Each of these domains contained metal binding domain at the amino or carboxyl terminus as detailed below. The sequence of the processing allowed addition of the single domain to a single particle at a time. Alternatively, a microfluidic system was used with the identical aim. As a result, heterospecific mono-, di-, tri-, poly-mer scFv, sdFv, CDR AVEC domains were easily assembled and tested, while firmly anchored to the nanoparticles as the core structure. Some constructs led to expression of fusion proteins, but their MBD at the carboxyl or amino terminus served as the anchors to the nanoparticles.

    [0221] Manufacturing of Pure Noble Metal Nanoparticles.

    [0222] Nanoparticles derived from noble metals Au, Pt, Pd and Ag were generated by laser ablation of 99.99% purity metal foils in a chamber filled with deionized water under continuous flow as described previously [21, 22]. Some variability in sizes was compensated by gradient ultracentrifugation, which also resulted in their condensation.

    [0223] Reporters with Noble Metals and Guided by Targeting Domains.

    [0224] Plasmid constructs were generated as described previously [21, 22]. Briefly, molecular probe constructs having coding sequences comprising CDR, scFv, sdFv, CD anti-ssDNA and/or anti-dsDNA (i.e., AVEC marker binding domain) as fusions with MBD were selected from surface display libraries as described above.

    [0225] The extended coding sequences were then cloned into pM vectors designed with the following: CMV immediate early promoter, SV40 poly(A) termination, and neomycin-resistance. Constructs for these scFv were then electroporated into human myelomas for expression of the scFv. The myelomas were cultured in modified roller bottles according to protocols published in the details [21, 22]. Expression of the constructs by the myeloma resulted in the production and secretion of scFv, sdFv, CDR, CD, IgM, IgG, Fab.

    [0226] Alternatively, selection of molecular probe constructs were conducted via in vitro evolution involving phage display, yeast display, myeloma display, and/or ribosomal display. The selection method had no implication for the choice of expression, which was conducted in CHO and HEK293 cells according to established protocols. Alternatively, cell free expression systems were used according to the standard protocols.

    [0227] Chelating sites fused with AVEC marker binding domains were then covalently bound to gold nanoparticles to form gold-linked AVEC. While the current examples provide for the production of gold nanoparticles, nanoparticles using other noble metals (e.g., Pt, Pd, Ag) may be successfully manufactured according to previously developed methods well known to the technicians skilled in the art [21, 22]. Purification of the gold-charged AVEC was accomplished using affinity and size exclusion chromatography columns.

    [0228] Determination of Noble Metal Atoms Per Nanoparticle and Number of Nanoparticles Per AVEC.

    [0229] The number of atoms per nanoparticle was determined by measuring the diameter with FEEFTEM (Titan) or EFTEM (LE0912) or FESTEM (HB501) at zero loss followed by measuring MDN with EDX and/or EELS of the beam parked over the nanoparticle using the Si drifted detector or ccd chip (Noran, Zeiss or Gatan, respectively). The ratios of nanoparticles to scFv, sdFv, CDR, CD, IgM, IgG, Fab was determined by ratios between the noble metal nanoparticle and carbon counts from EDX and EELS in Zeiss 912 or Titan or VG equipped with Zeiss or Gatan software.

    Example 8. Generation of Reporters by Incorporating Superparamagnetic Molecules

    [0230] To ensure the bio-safety, sensitivity, and accuracy of the AVEC reporters in vitro and in vivo using nuclear magnetic resonance techniques as described herein, a stable link between AVEC marker targeting domain and a reporter molecule such as a superparamagnetic atom was accomplished by designing and engineering various specific metal binding domains (MBD). [22]

    [0231] Plasmid constructs were described above and in the peer-reviewed articles. Coding sequences for ssDNA and dsDNA were selected from the surface displayed libraries cloned into pM vectors designed with CMV immediate early promoter, SV40 poly(A) termination, and neomycin-resistance. The constructs were electroporated or lipofected into human myelomas, CHO and/or HEK293. Expression of these constructs resulted in the secretion of ready fusion proteins. In some cases, these proteins were exposed to a couple of rounds of de- and re-naturation processes by exposing them to high pressure freezing at 3000 mbar, 196 deg C. Chelating sites were saturated with metal ions: Gd, Eu, Fe, Ni and Co. Alternatively, the iron oxide nanoparticles were coated with shells of noble metals. They were linked to fusion proteins involving protocols identical to those as used for noble metals. Purification from non-bound metal was performed on affinity columns. The myelomas were cultured in modified roller bottles (Sigma) or bioreactors (New Brunswick) according to standard protocols. Alternatively, cell free expression systems were used according to standard protocols.

    [0232] Determination of Metal Atoms Incorporated into Chelating Sites.

    [0233] The chelating sites of MBD were saturated with Gd or other superparamagnetic ions. Subsequently, these samples were purified on the affinity columns. Finally, they were analyzed with electron energy loss spectral imaging (EELS) and x-ray dispersive spectroscopy to determine total C to Gd metal atom ratio or in other words, the number of incorporated atoms per AVEC molecule.

    [0234] Alternatively, the AVEC were altered through amine or carboxyl terminus modification with Iodine. Subsequently, these samples were purified on the gels. They were analyzed using ratios between Iodine and Carbon using EDX and EELS.

    [0235] Alternatively, the AVEC were altered through amine or carboxyl terminus modification involving insertion of MBD and linked with noble gold metal clusters. Subsequently, these samples were purified on the size exclusion chromatography columns. They were analyzed using ratios between I and C using EDX and EELS.

    Example 9: Generation of Reporters by Incorporating Fluorochromes

    [0236] Bioluminescent and fluorescent compounds or molecules and dyes that may be used as reporter components in accordance with the embodiments of the disclosure include, but are not limited to, fluorescein, fluorescein isothiocyanate (FITC), Oregon Green, rhodamine, Texas red, tetrarhodimine isothiocynate(TRITC), Cy3, Cy5, etc.), fluorescent markers (e.g., green fluorescent protein (GFP), phycoerythrin, etc.), autoquenched fluorescent compounds that are activated by tumor associated proteases, enzymes (e.g., luciferase, horseradish peroxidase, alkaline phosphatase, etc.), nanoparticles, biotin, digoxigenin, fluorescent metals including, but not limited to Eu, Tb, Ru, fluorescent amino acids (e.g., Tyrosine), or combination thereof.

    [0237] According to some embodiments described herein, a fluorescent reporter may be used to measure by flow cytometry (FCM) and/or sort cells targeted by the AVEC described herein using fluorescent flow cytometry methods known in the art including, but not limited to, fluorescence activated cell sorting (FACS). Enzymes that may be used as reporter components in accordance with the embodiments of the disclosure include, but are not limited to, horseradish peroxidase, alkaline phosphatase, acid phosphatase, glucose oxidase, beta.galactosidase, beta.glucoronidase or beta.lactamase. Such enzymes may be used in combination with a chromogen, a fluorogenic compound or a luminogenic compound to generate a detectable signal.

    [0238] According to some embodiments, the AVEC reporter binding domain provide a binding site for the reporter compound. The reporter binding domain may be a metal binding domain (MBD), a chelating site or an organic functional group (e.g., amino, carboxyl, thiol or azide groups) or a synthetic chelate (e.g., DTPA or DOTA). For example, when the reporter component is a metal (e.g., a noble metal or superparamagnetic metal) or paramagnetic ion, the AVEC may include a metal binding domain. In such case, the reporter component may be reacted with a reagent having a long tail with one or more chelating groups attached to the long tail for binding these ions. The long tail may be a polymer such as a polylysine, polysaccharide, or other derivatized or derivatizable chain having pendant groups to which may be bound to a chelating group for binding the ions. Examples of chelating groups that may be used according to the disclosure include, but are not limited to, ethylenediaminetetraacetic acid (EDTA), EGTA, diethylenetriaminepentaacetic acid (DTPA), DOTA, NOTA, NETA, TETA, porphyrins, polyamines, crown ethers, bisthiosemicarbazones, polyoximes, and like groups. The chelate is normally linked to the antibody or functional antibody fragment by a group which enables formation of a bond to the molecule with minimal loss of immunoreactivity and minimal aggregation and/or internal crosslinking. The same chelates, when complexed with nonradioactive metals, such as manganese, iron and gadolinium are useful for MRI, when used along with the antibodies and carriers described herein. Macrocyclic chelates such as NOTA, DOTA, and TETA are of use with a variety of metals and radiometals including, but not limited to, radionuclides of gallium, yttrium, gadolinium, iodine, and copper, respectively. In certain embodiments, chelating moieties may be used to attach a PET imaging agent, such as an sup.18F complex, to a targeting molecule for use in PET analysis.

    [0239] According to some embodiments, a metal binding domain (MBD) that is part of AVEC described herein may include, but is not limited to, the listed sequences, or any functional fragment thereof:

    TABLE-US-00009 TABLE (Gly)nCys(SEQIDNO:336); (GlyArg)nCys(SEQIDNO:337); (GlyLys)nCyS(SEQIDNO:338); (GlyAspGlyArg)nCys(SEQIDNO:339); (GlyGluGlyArg)nCys(SEQIDNO:340); (GlyAspGlyLys)nCys(SEQIDNO:341); (GlyGluGlyLys)nCys(SEQIDNO:342); MAP16B; (GluGluGluGluGlu)n(SEQIDNO:343); (GluGluGluGluGluGlu)n(SEQIDNO:344); (AspAspAspAspAsp)n(SEQIDNO:345); (AspAspAspAspAspAsp)n(SEQIDNO:346); PheHisCysProTyrAspLeuCysHisIleLeu(SEQIDNO:347); (GlyAspGlyArg)n(His)5,6(SEQIDNO:348); (GlyGluGlyArg)n(His)5,6(SEQIDNO:349); (GlyAspGlyLys)n(His)5,6(SEQIDNO:350); (GlyGluGlyLys)n(His)5,6(SEQIDNO:351); (GlyArg)n(His)5,6(SEQIDNO:352); (GlyLysv(His)5,6(SEQIDNO:353).

    Example 10: Validation of AVEC Antibody Domains' Specificity and Sensitivity by Nuclear Magnetic Resonance

    [0240] The following materials and methods are used for the validation experiments described herein, but also apply to the experiments described in Examples below as reported in FIG. 2A, FIG. 5A, FIG. 5B.

    Results.

    [0241] The primers used for amplification are listed below.

    TABLE-US-00010 TABLE OLIGO length tmelting gc% any 3 seq ERBB1 LEFTPRIMER 20 60.01 50.00 6.00 1.00 cagcgctaccttgtcattca (SEQIDNO:1) RIGHTPRIMER 20 60.00 5500 7.00 2.00 tgcactcagagagctcagga (SEQIDNO:2) HYBOLIGO 20 60.08 4500 800 3.00 gaatgcatttgccaagtcct (SEQIDNO:3) OLIGO len tm gc% any 3 seq ERBB2 LEFTPRIMER 20 59.99 55.00 2.00 0.00 ccataacacccacctctgct (SEQIDNO:19) RIGHTPRIMER 20 59.95 5500 600 3.00 actggctgcagttgacacac (SEQIDNO:20) HYBOLIGO 20 60.06 55.00 4.00 1.00 accaagctctgctccacact (SEQIDNO:39) OLIGO len tm gc% any 3 seq ERBB3 LEFTPRIMER 20 59.95 6000 3.00 3.00 gagcccagaggagaagact (SEQIDNO:67) RIGHTPRIMER 20 59.99 5500 600 0.00 tctgatgcgacagacactcc (SEQIDNO:68) HYBOLIGO 20 59.83 60.00 3.00 0.00 gagtctgagtgttcggaggg (SEQIDNO:69) OLIGO len tm gc% any 3 seq ERBB4 LEFTPRIMER 20 60.04 45.00 3.00 0.00 tttcgggagtttgagaatgg (SEQIDNO:85) RIGHTPRIMER 20 59.97 50.00 7.00 2.00 gaaactgtttgccccctgta (SEQIDNO:86) HYBOLIGO 20 60.04 50.00 4.00 4.00 aagatggaagatggcctcct (SEQIDNO:87)

    [0242] We measured sensitivity of detection of HER-2 on cancer cells by labeling cells with superparamagnetic antibodies and measuring relaxivities by nuclear magnetic resonance (NMR) (FIG. 2A, FIG. 5A). For this purpose, the SK-BR-3, MCF-7, patients' breast cancer cells, and human breast epithelial cells were labeled with trastuzumab, anti-HER-2.sub.001, anti-HER-2.sub.004, anti-HER-2.sub.001HBsAg, and anti-HER-2.sub.004HBsAg and anti-HBsAg. As the control, the MCF-7 cells, which do not overexpress HER-2, were labeled with the same antibodies. As the control, these cells were also labeled with the isotype antibodies. The measurements revealed statistically significant differences between the HER-2+SK-BR-3 and patients' HER-2+ breast cancer cells, which were heavily labeled with therapeutics: trastuzumab, anti-HER-2.sub.001, anti-HER-2.sub.004, anti-HER-2.sub.001HBsAg, and anti-HER-2.sub.004HBsAg versus the HER-2-MCF-7 and human breast epithelial cells, which were practically not labeled. These measurements revealed also statistical differences between these therapeutics and the isotypes. Therefore, we validated efficient targeting of the HER-2+SK-BR-3 and the patients' HER-2+ breast cancer cells (the measurements included are representative for all 10 patients' biopsies studied) breast cancer cells by the AVEC: anti-HER-2.sub.004HBsAg and AVEC: anti-HER-2.sub.001HBsAg.

    [0243] Breast and ovarian cancer cells were grown and treated as above. Specificity and sensitivity were validated in NMR. For this purpose, the cells were labeled with superparamagnetic reporters.

    [0244] Labeling of cancer cells with AVEC having magnetic reporters changed their properties, while making them susceptible to magnetic field. The more cells were labeled, the higher relaxivity and brighter signal

    Example 11: Validation of AVEC Antibody Domains' Specificity and Sensitivity by Flow Cytometry

    Results.

    [0245] We determined specificity and sensitivity of the HER-2 domains' targeting by flow cytometry (FIG. 2D, FIG. 2E). Moreover, we performed tests of cross-blocking as shown in Table 1. While labeling with AVEC: anti-HER-2.sub.001HBsAg interfered on the statistically significant level with trastuzumab, labeling with AVEC: anti-HER-2.sub.004HBsAg did not. Therefore, we concluded that these antibodies: trastuzumab and AVEC: anti-HER-2.sub.001HBsAg target the same, but AVEC: anti-HER-2.sub.004HBsAg the different domains on the HER-2 receptors.

    TABLE-US-00011 TABLE 1 Cross-blocking of AVEC: anti-HER-2 trastuzumab anti-HER-2001 anti-HER-2004 anti-HER- trastuzumab + + + anti-HER- + + + 2001 anti-HER- + 2004 anti-HER- + + + anti-HER- + anti-HBsAg

    Example 12: Validation of AVEC Antibody Domains' Specificity and Sensitivity by Immunoblotting and Immunoprecipitation

    [0246] The cells and tissues were either frozen crushed in the rapid controlled rate freezer or native disintegrated with ultrasonicator (Branson Ultrasonic, Danbury, Conn., USA). After being homogenized within the sample buffer they were either stored in liquid nitrogen or lyophilized.

    [0247] Alternatively, the targeted molecules on cancer cells were expressed after amplification of the coding sequences for the targeted receptors using the primers listed below in the expression systems described above for the antibodies.

    [0248] They were electrophoresed in the native buffer (Invitrogen, Carlsbad, Calif., USA). They were vacuum- or electro transferred onto the PVDF membranes (Amersham, Buckinghamshire, UK, EU). The membranes carrying the transferred proteins were first soaked within human serum and thereafter labeled with the bioengineered, biosimilar, and referenced anti-HER-2 antibodies. The anti-HBsAg isotype antibodies served as the controls. The images of the blots were acquired and quantified with Fluoroimager (Molecular Dynamics, Sunnyvale, Calif., USA) or Storm 840 (Amersham, Buckinghamshire, The anti-HER-2 and anti-HBsAg antibodies were rendered magnetic or fluorescent by conjugating Au coated Fe3O4 nanoparticles or fluorochromes. The sera and liver biopsies' homogenates were mixed with these superparamagnetic antibodies. The targeted molecules rendered fluorescent were pulled out by the means of 1.5T magnet. The intensity of fluorescence was measured on the spectrofluorometer.

    Results.

    [0249] We measured specificity of targeting of the HBsAg by vaccinated and infected patients' antibodies, while measuring the concentration of this immunogen immunoprecipitated, which was electrophoresed and immunoblotted (FIG. 2B, FIG. 2C). All molecular baits used in this study were pulling out the same 150 kDa molecule, which was recognized by clinical diagnostics for Hepatitis B. By quantitative high gain scanning of the blots, we were able to determine that there were no other molecules pulled out from the sera. The same experiments conducted on the sera of not immunized patients resulted in empty lanes (FIG. 2B, FIG. 2C). Therefore, we concluded that anti-HER-2.sub.001HBsAg and anti-HER-2.sub.004HBsAg possess high sensitivity and high specificity towards HER-2 and HBV.

    Example 13. Antibody Dependent Redirected Accelerated Amplified VaccinationInducedImmunity Therapy (ADRAAVIT) to Inhibit Proliferation

    [0250] To study collective killing effects of the anti-HER-2 and anti-HER-2HBsAg upon the breast cancer cells, the patients' cell and serum fraction described below were pooled making erythrocytes-free blood (EFB). Anti-HER-2, anti-HER-2.sub.001HBsAg, and anti-HER-2.sub.004HBsAg were added to the EFB. So were, anti-HBsAg, anti-HPV, anti-HSV, EGFR1, and isotype antibodies as the controls. The incubation with the antibodies continued at the 37 C. incubators. The labeling continued for 1-24 h. It was terminated by washing with the cold buffer. To quantify the numbers of killed cells by flow cytometry (FCM) and fluorescent activated cell sorting (FACS) the samples were stained with propidium iodide (PI) (Sigma-Aldrich, Milwaukee, Wis., USA) used at 50 g/ml. To determine the numbers of apoptotic cells, they were labeled with anti-phosphatidylserine antibodies.

    Results.

    [0251] Treatment of the breast cancer cells with increasing concentrations of trastuzumab, anti-HER-2 biosimilars, and the novel AVEC: anti-HER-2.sub.001HBsAg biomolecules was followed by pulsing with thymidine marked with tritium. Growth inhibition was calculated as percentage of surviving cells compared to non-treated cells as the control (FIG. 3A). Growth inhibition was attained at much lower concentrations, when the cells were treated with anti-HER-2.sub.004HBsAg, over that attained with trastuzumab.

    Example 14. Antibody Dependent Cell Cytotoxicity (ADCC)

    [0252] To study toxicity to the breast cancer cells caused by the patients' cytotoxic cellsthe effectors triggered by the anti-HER-2 antibodies, the peripheral blood mononuclear cells were separated from the blood on Ficoll-Hypaque density gradients. The cells were washed by three cycles of spinning down and suspending in the PBS at pH 7.3. They were rendered fluorescent by adding the stock solution of the DiI membrane dye (Molecular Probes, Inc., Eugene, Oreg., USA) in DMSO for 10 min at 26 C. Small aliquots were washed with the buffer and the cells quantified on FCM as the way to determine the effector to target cells' ratios (ETR). These ratios varied: 10:1, 50:1, and 100:1. Incubations lasted 1-7 h in a 37 C., 5% CO2 incubator.

    [0253] The numbers of killed cells were determined due to staining with the PI at 50 g/ml and of surviving cells from the DiO staining counts and thymidine incorporation.

    Results.

    [0254] Clearly superior efficacy was obtained with AVEC: anti-HER-2.sub.004HBsAg, over that attained with trastuzumab. Trastuzumab and both new biomolecular clusters triggered apoptosis (FIG. 3B). The extent of apoptosis progressed rapidly, but the AVEC: anti-HER-2.sub.001HBsAg and AVEC: anti-HER-2.sub.004HBsAg induced apoptosis in much greater percentage than trastuzumab (40%). In all cases, this percentage was statistically much higher than in the MCF-7-HER-2-cells treated on the identical way (FIG. 3C). It was also statistically significantly higher than SK-BR-3 cells treated with the isotype antibody. Trastuzumab and both new biomolecular clusters of anti-HER-2.sub.001HBsAg caused necrosis (FIG. 3D). At the initial stages of apoptosis, many cells were only showing outer-membrane display of phosphatidylserine, but were not permeable for PI. At the more advanced stages, they were becoming leaky; thus adding to necrotic counts. Both clusters of anti-HER-2HBsAg caused massive necrosis of the SK-BR-3 and the patients' HER-2+ breast cancer cells in the percentages, which were statistically significantly much higher over those inflicted by trastuzumab.

    Example 15. Complement Dependent Cytotoxicity (CDC)

    [0255] To study toxicity to the breast cancer cells caused by the patients' complement systemthe effector, the serum was separated by gentle centrifugation from the freshly drawn blood. It was supplemented with the anti-HER-2 and anti-HER-2.sub.001. Incubations lasted 1-7 h in a 37 C., 5% CO2 incubator. The numbers of killed cells were determined due to staining with the PI at 50 g/ml and of surviving cells from the DiO staining counts and thymidine incorporation. Superior efficacy of AVEC: anti-HER-2.sub.001HBsAg and AVEC: anti-HER-2.sub.004HBsAg is clearly demonstrated in the figure over the naked antibodies. (FIG. 4A)

    Example 16. Factors Affecting Efficacy of AVEC

    [0256] The processes of breast cancer cells' AVECs are triggered by the specific elements of the patients' immune system: humoral and cellular. We aimed at defining the main factors triggering them. In particular, we were focused on effects of complement concentrations (FIG. 4A) and effector cells to target cells ratios (FIG. 4B). Concentrations of the complement systems' components (CS) determine the patients' ability to fight cancer by complement dependent cytotoxicity (CDC). Concentrations of the complement systems' components in our tests were adjusted within the ranges of healthy adults.

    Results

    [0257] Our measurements revealed that increasing the concentrations of the C1q and C3 resulted in the statistically significant increase in the efficacy of the HER-2+SK-BR-3 and the patients' HER-2+ breast cancer cells' killing by trastuzumab and anti-HER-2 antibodies as compared to labeling with the isotype antibodies or statistically significantly much higher, when the HER-2+SK-BR-3 and the patients' HER-2+ breast cancer cells were treated with anti-HER-2.sub.001HBsAg, and anti-HER-2.sub.004HBsAg. Numbers of natural killer cells and cytotoxic lymphocytes in the patient's circulation determine this patient's ability labeling of the HER-2-MCF-7 cells. The efficacy was to execute antibody dependent cell cytotoxicity (ADCC). The numbers of the immune cells were adjusted to clinical lab values. Trastuzumab and our anti-HER-2 biosimilar antibodies caused the cancer cells' AVECs through ADCC already at the ratio of 10:1, but with no statistical difference between them (FIG. 4B). Anti-HER-2.sub.001HBsAg, and anti-HER-2.sub.004HBsAg inflicted massive AVECs of breast cancer cells, which were at statistically significantly much higher levels, than those inflicted by trastuzumab and anti-HER-2 biosimilars. The isotype antibodies did not have any impact. The MCF-7 cells and the patients' breast epithelial cells did not show signs of responding to these immunotherapeutics in the conditions described. All the measurements were pursued in triplicates. All the data presented are representative for all studied. Treatment with the isotype antibodies did not have any statistically significant impact on the cancer cells' AVEC rates.

    Example 17. Pharmacokinetics, Pharmacodynamics, Pharmacogenomics in Mice and Rats

    [0258] Mice and rats were acquired from the studies, in which they were considered as surplus and sentenced for euthanasia. They were from either the control group, or from the study group having spontaneous or grafted tumors. The study was carried in the two phases. In the first phase, the blood was drawn through the tail vein and the concentration of the specific circulating vaccine, cancer antigen, and antibodies against them determined using the methods, instruments, and reagents described above (e.g., including but not limited: HBsAg, HBcAg, HBeAg, anti-HBsAg, anti-HBcAg, HER-2, EGFR1, anti-HER-2, anti-EGFR, etc). The mice and rats received AVEC by the vaccine type route of administration at the starting dose and escalated. The aforementioned molecules were measured initially in 24 h, and later weekly intervals. In the second phase, the blood was drawn and the concentration of the specific circulating vaccine, cancer antigen, and antibodies against them determined. The mice and rats received AVEC by the infusion type route of administration with the starting dose and escalated. The molecular imaging was performed as outlined above, while relying on the reporter domains of AVEC. The aforementioned molecules were measured initially in 24 h, and later weekly intervals. There were no adverse effects of the AVEC administration.

    Example 18. Pharmacokinetics, Pharmacodynamics, Pharmacogenomics in Humans

    [0259] Healthy volunteers are provided with the complete Bill of Rights according to the Declaration of Helsinki. All aspects of safety and absence conflict of interest are brought up. Only if they voluntarily decide to participate, they sign the Patient Informed Consent. The records conceal their identity. The study is carried in the two phases. In the first phase, the blood is drawn and the concentration of the specific circulating vaccine, cancer antigen, and antibodies against them determined the methods, instruments, and reagents described above (e.g., including but not limited: HBsAg, HBcAg, HBeAg, anti-HBsAg, anti-HBcAg, HER-2, EGFR1, anti-HER-2, anti-EGFR, etc). The volunteers receive AVEC by the vaccine type route of administration at the starting dose of 10 micrograms and escalated. The aforementioned molecules are measured initially in 24 h, and later weekly intervals. In the second phase, the blood is drawn and the concentration of the specific circulating vaccine, cancer antigen, and antibodies against them determined. The volunteers receive AVEC by the infusion type route of administration with the starting dose of 10 micrograms and escalated. The aforementioned molecules are measured initially in 24 h, and later weekly intervals.

    Results.

    [0260] The studies demonstrated the important primary results as the Phase I Clinical Trials presented in FIG. 9. First, there were no serious adverse effects in the sites of injections and infusions of AVEC. Second, the administration by subcutaneous injection resulted in primary lymphatic route of distribution of AVEC. Third, the administration by intravenous infusion resulted in significantly increased half-life of AVEC as compared to naked antibodies.

    Example 19. Statistical Analysis

    [0261] All the measurements were run in triplicates for each sample from six patients. The numbers were analyzed and displayed using GraphPad software (GraphPad Software, Inc, La Jolla, Calif.). Data were presented as mean of standard error of the mean (SEM). Statistical significance was calculated by t test for two groups.

    Additional Embodiments

    [0262] In some embodiments, any of the embodiments provided herein can involve a reporting technique(s) that is(are) radiography, CT, MRI, NMR, PET, SPECT, EDX, TRXRF, MassSpec, HPLC, FACS, MACS, FCM, gamma scintigraphy, fluorescence microscopy, electron microscopy, energy filtering transmission electron microscopy, electron energy loss spectroscopy, x-ray dispersion spectroscopy, or Raman spectroscopy.

    [0263] In some embodiments, any of the embodiments provided herein can involve a reporter(s) that can be used to detect pharmacokinetics of AVEC for research, diagnosis, and therapy, while conducted in vitro, in vivo, ex vivo.

    [0264] In some embodiments, a utility of AVEC and their methods of manufacturing and administration for predicting efficacy of therapy of patients suffering from cancer comprising detection utilizing AVEC featuring any of the embodiments provided herein.

    [0265] In some embodiments, a utility of AVEC and methods of their manufacturing and administration for therapy of patients suffering from cancer comprising administration to a patient an effective dose of AVEC utilizing AVEC featuring any of the embodiments provided herein, with the purpose of antibody dependent redirecting, accelerating, amplifying, vaccination-induced immune response (ADRAAVIR) for therapy of cancer.

    [0266] In some embodiments, a utility of AVEC and methods of their manufacturing and administration for evaluating efficacy of therapy of patients suffering from cancer comprising detection of reporters of any of the embodiments provided herein.

    REFERENCES

    [0267] The references listed below and all referenced cited above are hereby incorporated in their entirety by reference as if fully set forth herein. [0268] 1. Torre L A, Siegel R L, Ward E M, Jemal A (2016) Global cancer incidence and mortality rates and trendsan update. Cancer Epidemiol Biomarkers Prev. 25:16-27 [0269] 2. Slamon D J, Clark G M, Wong S G, Levin W J, Ulrich A et al (1987) Human breast cancer: correlation of relapse and survival with amplification of the HER-2/neu oncogene. Science 235:177-182 [0270] 3. Pietras R J, Pegram M D, Finn R S, Slamon D J (1998) Remission of human breast cancer xenografts of therapy with humanized monoclonal antibody to HER-2 receptor and DNA-reactive drugs. Oncogene 17:2235-2249 [0271] 4. Park J W, Stagg R, Lewis G D, Carter P, Maneval D, Slamon D J, Jaffe H, Shepard H M (1992) Anti-p185HER2 monoclonal antibodies: biological properties and potential for immunotherapy. Cancer Treat Res 61:193-211 [0272] 5. Figueroa-Magalhes M C, Jelovac D, Connolly R M, Wolff A C (2014) Treatment of HER2-positive breast cancer. Breast 23:128-136 [0273] 6. http://www.fda.gov/drugs/developmentapprovalporcess/howdrugsaredevelopedandapproved/approvalapplications/therapeuticbiologicapplications/ucm080591.htm [0274] 7. http://www.fda.gov/safety/medwatch/safetyinformation/safetyalertsforhumanmedicalproducts/ucm350817.htm; http://www.fda.gov/newsevents/newsroom/pressannouncements/ucm370393.htm [0275] 8. Mendes D, Alves C, Afonso N, Cardoso F, Passos-Coelho J L et al (2015) The benefit of HER2-targeted therapies on overall survival of patients with metastatic HER2-positive breast cancer. Breast Cancer Res 17:140-147 [0276] 9. Sliwkowski M X, Lofgren J A, Lewis G D, Hotaling T E, Fendly B M et al (1999) Nonclinical studies addressing the mechanism of action of Herceptin (Trastuzumab). Semin Oncol 26:60-70 [0277] 10. Clifford A, Hudis M D (2007) HerceptinMechanism of action and use in clinical practice. N Engl J Med 357:39-51 [0278] 11. Baselga J, Albanell J (2001) Mechanism of action of anti-HER2 monoclonal antibodies. Ann Oncol 12:S35-S41 [0279] 12. Ahmad S, Gupta S, Kumar R, Varshney G C, Raghava G P (2014) Herceptin resistance database for understanding mechanism of resistance in breast cancer patients. Sci Rep 4:4483 [0280] 13. Rosenberg S A, Yang J C, Restifo N P (2004) Cancer immunotherapy: moving beyond current vaccines. Nat Med 10:909-915 [0281] 14. Rosenberg S A (2004) Shedding light on immunotherapy for cancer. N Engl J Med 350:1461-1463 [0282] 15. Daniels D, Grytdal S, Wasley A (2009). Surveillance for Acute viral hepatitisUnited States, 2007. Morbidity and mortality weekly report. Surveillance summaries. 58:1-9. http://www.cdc.gov/mmwr/PDF/ss/ss5803.pdf [0283] 16. Wolters G L, Kuijpers L, Kacaki J, Schuurs A (1976) Solid-phase enzyme-immunoassay for detection of hepatitis B surface antigen. J Clin Pathol 29:873-879 [0284] 17. http://www.fda.gov/biologicsbloodvaccines/vaccines/approvedproducts/ucm398332.htm [0285] 18. http://wwwfda.gov/biologicsbloodvaccines/vaccines/approvedproducts/ucm376931.htm [0286] 19. SK-BR-3 http://www.atcc.org/Products/All/HTB-30.aspx [0287] 20. MCF-7 http://www.atcc.org/Products/All/HTB-22.aspx [0288] 21. Malecki M, Hsu A, Truong L, Sanchez S (2002) Molecular immune-labelling with recombinant single-chain variable fragment (scFv) antibodies designed with metal-binding domains. Proc Natl Acad Sci 99:213-218 [0289] 22. Malecki M, Szybalski W (2012) Isolation of single, intact chromosomes from single, selected ovarian cancer cells for in situ hybridization and sequencing. Gene 493:132-139 [0290] 23. http://www.imgt.org/3Dstructure-DB/cgi/details.cgi?pdbcode=7637&Part=Chain&Chain=7637L [0291] 24. http://www.imgt.org/3Dstructure-DB/cgi/details.cgi?pdbcode=7637&Part=Chain&Chain=7637H [0292] 25. Valenzuela P, Gray P, Quiroga M, Zaldivar J, Goodman H M et al (1979) Nucleotide sequence of the gene coding for the major protein of hepatitis B virus surface antigen. Nature 280:815-819 [0293] 26. Valenzuela P, Medina A, Rutter W J, Ammerer G, Hall B D (1982) Synthesis and assembly of hepatitis B virus surface antigen particles in yeast. Nature 298:347-350 [0294] 27. Hazra P P, Suriapranata I, Snyder W B, Subramani S (2002) Peroxisome remnants in Pex3 D cells and the requirement of Pex3p for interactions between the peroxisomal docking and translocation subcomplexes. Traffic 3:560-574 [0295] 28. Kitagawa T, Aikawa T (1976) Enzyme coupled immunoassay of insulin using a novel coupling reagent. J Biochem 79:233-236 [0296] 29. Heijtink R A, Bergen P, Melber K, Janowicz Z A, Osterhaus A D (2002) Hepatitis B surface antigen (HBsAg) derived from yeast cells used to establish an influence of antigenic subtype (adw2, adr, ayw3) in measuring the immune response after vaccination. Vaccine. 20:2191-2196 [0297] 30. Scheiblauer H, El-Nageh M, Diaz S, Nick S, Zeichhardt H et al (2010) Performance evaluation of 70 hepatitis B virus surface antigen (HBsAg) assays from around the world by a geographically diverse panel with an array of HBsAg genotypes and HBsAg subtypes. Vox Sang 98:403-414 [0298] 31. Barbas C F, 3rd, Burton D R, Scott J K, Silverman G J, (2001) Phage Display. CSHLP. [0299] 32. Martin A C. (1996) Accessing the Kabat antibody sequence database by computer. Proteins. May; 25(1):130-3. [0300] 33. Beerli R R1, Bauer M, Buser R B, Gwerder M, Muntwiler S, Maurer P, Saudan P, Bachmann M F. (2008) Isolation of human monoclonal antibodies by mammalian cell display. Proc Natl Acad Sci USA. 105(38):14336-41. [0301] 34. Plummer K A, Carothers J M, Yoshimura M, Szostak J W, Verdine G L. (2005) In vitro selection of RNA aptamers against a composite small molecule-protein surface. Nucleic Acids Res. 33(17):5602-10. [0302] 35. Stuve L L, Brown-Shimer S, Pachl C, Najarian R, Dina D, Burke R L. Structure and expression of the herpes simplex virus type 2 glycoprotein gB gene. J Virol. 1987 February; 61(2):326-35.