VECTORS AND METHODS FOR REGENERATIVE THERAPY
20180117125 ยท 2018-05-03
Assignee
Inventors
Cpc classification
C12N9/0071
CHEMISTRY; METALLURGY
A01K67/0275
HUMAN NECESSITIES
A61K48/0058
HUMAN NECESSITIES
C12Y114/11
CHEMISTRY; METALLURGY
C12N2750/14144
CHEMISTRY; METALLURGY
A61P43/00
HUMAN NECESSITIES
A61K9/0019
HUMAN NECESSITIES
A61P21/00
HUMAN NECESSITIES
A61K35/34
HUMAN NECESSITIES
A61P9/02
HUMAN NECESSITIES
International classification
A61K48/00
HUMAN NECESSITIES
A61K35/34
HUMAN NECESSITIES
Abstract
An expression vector capable of disrupting the silencing of cell cycle genes in adult cells, such as adult cardiac myocytes and other quiescent cells in terminally differentiated tissues, comprising: (a) a nucleic acid sequence encoding lysine-specific demethylase 4D (KDM4D); (b) a promoter that induces or effects overexpression of KDM4D, wherein the promoter is operably linked to the nucleic acid sequence; and (c) a regulatory element that inducibly represses the overexpression of KDM4D. The vector can be administered to a subject in a method for inducing tissue-specific hyperplasia in a mammal, including cardiomyocyte proliferation. The method provides for regenerative therapy, including improving cardiac function after myocardial infarct and other forms of cardiac damage.
Claims
1. An expression vector comprising: (a) a nucleic acid sequence encoding lysine-specific demethylase 4D (KDM4D); (b) a promoter that effects overexpression of KDM4D, wherein the promoter is operably linked to the nucleic acid sequence; and (c) a regulatory element that inducibly represses the overexpression of KDM4D.
2. The expression vector of claim 1, wherein the promoter of (b) is a tissue-specific promoter.
3. The expression vector of claim 2, wherein the tissue-specific promoter is specific to cardiac tissue, skeletal muscle, neurons, pancreatic islet cells, or hepatocytes.
4. The expression vector of claim 1, wherein the regulatory element is a tetracycline responsive element.
5. A method for inducing tissue-specific hyperplasia in a mammal comprising: administering the expression vector of claim 2 to the mammal.
6. A method for inducing cardiac myocyte (CM) hyperplasia in a mammal comprising: administering the expression vector of claim 3 to the mammal.
7. A method for inducing cardiac myocyte (CM) hyperplasia in a mammal comprising: grafting CMs to the heart of the mammal, wherein the CMs contain the expression vector of claim 3.
8. A method for inducing CM hyperplasia comprising administering KDM4D to CMs.
9. A method of improving cardiac function in a mammal comprising grafting CMs to the heart of the mammal, wherein the CMs contain the expression vector of claim 3.
10. A method of improving cardiac function in a mammal comprising administering the expression vector of claim 3 to the mammal.
11. A method of improving cardiac function in a mammal comprising administering KDM4D to the mammal.
12. A method of proliferating CM comprising culturing CM with KDM4D under conditions effective to induce CM hyperplasia.
13. The method of claim 12, wherein the CM are adult CM (ACM).
14. A method of promoting cardiac regeneration comprising reducing lysine 9 of histone H3 (H3K9me3) levels in CMs.
15. The method of claim 14, wherein the reducing comprises administering the expression vector of claim 3 to a subject in need of cardiac regeneration.
16. The method of claim 15, wherein the expression vector is administered by administering CMs that contain the expression vector.
17. The method of claim 14, wherein the reducing comprises administering KDM4D.
18. The method of claim 5, wherein administration is systemic.
19. The method of claim 5, wherein administration is intravenous.
20. The method of claim 5, wherein administration is by intra-myocardial injection.
Description
DESCRIPTION OF THE DRAWINGS
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
DETAILED DESCRIPTION OF THE INVENTION
[0039] The invention is based on the unexpected finding that terminally differentiated cells can be induced to proliferate via epigenetic manipulation. The invention thus provides materials and methods for reversibly inducing proliferation in quiescent cells based on discovery of the role of H3K9me3 demethylases in regulating ACM cell cycle gene silencing.
[0040] Before the discovery of histone demethylases (HDMs).sup.40, H3K9me3, and histone methylation in general, was thought to be a permanent mark.sup.41. However, the dynamic nature of histone methylation is beginning to be appreciated.sup.42-44, though little is known about the functions of HDMs in the heart. Interestingly, members of the KDM4 family of H3K9me3 demethylases are upregulated in several forms of cancer and are thought to promote cell proliferation and survival.sup.45-48. A member of the KDM4 family, KDM4A, has been studied in the heart.sup.17, 49. CM-specific overexpression of KDM4A in mice exacerbated TAC-induced hypertrophy and fetal CM gene expression, while CM-specific KDM4A deletion diminished the effects of pressure-overload, though neither manipulation had an effect at baselines.sup.49. Mechanistic studies demonstrated KDM4A knockdown in neonatal CMs increases H3K9me3 levels at the ANP promoter and modestly downregulates ANP expression.sup.17. H3K9me3 and HP1 enrichment on the ANP promoter was reduced in an isolated-working heart model of elevated preload that induces ANP expression.sup.17. However, KDM4A expression and enrichment on the ANP gene promoter were not changed in this model.sup.17. Thus, it is not clear how KDM4A regulates fetal CM gene expression in ACMs. Complicating the interpretation of these results further is the fact that KDM4A has dual-substrate specificity; KDM4A can demethylate repressive H3K9me3, but also activating H3K36me3.sup.50-52. We also found that global levels of both these modifications were reduced in ACMs with adenovirus-mediated KDM4A overexpression. One KDM4 family member, KDM4D, has robust and specific H3K9-demethylase activity.sup.50, 52, giving it particular usefulness as an experimental tool to study H3K9me3 specifically. Until this study, KDM4D has not been explored.
Definitions
[0041] All scientific and technical terms used in this application have meanings commonly used in the art unless otherwise specified. As used in this application, the following words or phrases have the meanings specified.
[0042] As used herein, lysine-specific demethylase 4D or KDM4D means a specific member of the KDM4 family of lysine-specific demethylases that exhibits demethylase activity specific to the methylated lysine residue at position 9 (H3K9) of heterochromatin protein 1 (HP1). In one embodiment, the KDM4D has the amino acid sequence shown in SEQ ID NO: 1. The amino acid sequence optionally further includes tags, such as, for example, a MYC tag and/or a FLAG tag, as shown in SEQ ID NO: 2.
[0043] As used herein, inducibly represses or inducible repression refers to regulation of gene expression whereby expression of the gene can be repressed upon introduction of an inducing condition. The inducing condition can be administration of or contact with an agent that effects the repression. The agent can be a corepressor, such as is found in repressible gene regulation wherein expression is on except when the corepressor is present to suppress gene expression. Alternatively, the agent can be an inducer, such as is found in inducible gene regulation wherein expression is off except when the inducer is present to allow for gene expression.
[0044] As used herein, a regulatory element refers to an element that regulates gene expression. The regulatory element may induce or repress gene expression in response to the presence or absence of a condition.
[0045] As used herein, a tetracycline responsive element refers to a regulatory element that reduces expression from a tet-inducible promoter in the presence of tetracycline or a derivative thereof, e.g., doxycycline. One example of a tetracycline responsive element is a tetracycline-controlled transactivator (tTA), created by fusion of the tetracycline repressor (tetR) with a transcriptional activation domain, such as the C-terminal domain of VP16 of herpes simplex virus (HSV).
[0046] The term nucleic acid or polynucleotide or oligonucleotide refers to a sequence of nucleotides, a deoxyribonucleotide or ribonucleotide polymer in either single- or double-stranded form, and unless otherwise limited, encompasses known analogs of natural nucleotides that hybridize to nucleic acids in a manner similar to naturally occurring nucleotides.
[0047] The term primer, as used herein, means an oligonucleotide designed to flank a region of DNA to be amplified. In a primer pair, one primer is complementary to nucleotides present on the sense strand at one end of a polynucleotide fragment to be amplified and another primer is complementary to nucleotides present on the antisense strand at the other end of the polynucleotide fragment to be amplified. A primer can have at least about 11 nucleotides, and preferably, at least about 16 nucleotides and no more than about 35 nucleotides. Typically, a primer has at least about 80% sequence identity, preferably at least about 90% sequence identity with a target polynucleotide to which the primer hybridizes.
[0048] As used herein, the term probe refers to an oligonucleotide, naturally or synthetically produced, via recombinant methods or by PCR amplification, that hybridizes to at least part of another oligonucleotide of interest. A probe can be single-stranded or double-stranded.
[0049] As used herein, the term active fragment refers to a substantial portion of an oligonucleotide that is capable of performing the same function of specifically hybridizing to a target polynucleotide.
[0050] As used herein, hybridizes, hybridizing, and hybridization means that the oligonucleotide forms a noncovalent interaction with the target DNA molecule under standard conditions. Standard hybridizing conditions are those conditions that allow an oligonucleotide probe or primer to hybridize to a target DNA molecule. Such conditions are readily determined for an oligonucleotide probe or primer and the target DNA molecule using techniques well known to those skilled in the art. The nucleotide sequence of a target polynucleotide is generally a sequence complementary to the oligonucleotide primer or probe. The hybridizing oligonucleotide may contain nonhybridizing nucleotides that do not interfere with forming the noncovalent interaction. The nonhybridizing nucleotides of an oligonucleotide primer or probe may be located at an end of the hybridizing oligonucleotide or within the hybridizing oligonucleotide. Thus, an oligonucleotide probe or primer does not have to be complementary to all the nucleotides of the target sequence as long as there is hybridization under standard hybridization conditions.
[0051] The term complement and complementary as used herein, refers to the ability of two DNA molecules to base pair with each other, where an adenine on one DNA molecule will base pair to a guanine on a second DNA molecule and a cytosine on one DNA molecule will base pair to a thymine on a second DNA molecule. Two DNA molecules are complementary to each other when a nucleotide sequence in one DNA molecule can base pair with a nucleotide sequence in a second DNA molecule. For instance, the two DNA molecules 5-ATGC and 5-GCAT are complementary, and the complement of the DNA molecule 5-ATGC is 5-GCAT. The term complement and complementary also encompasses two DNA molecules where one DNA molecule contains at least one nucleotide that will not base pair to at least one nucleotide present on a second DNA molecule. For instance the third nucleotide of each of the two DNA molecules 5-ATTGC and 5-GCTAT will not base pair, but these two DNA molecules are complementary as defined herein. Typically two DNA molecules are complementary if they hybridize under the standard conditions referred to above. Typically, two DNA molecules are complementary if they have at least about 80% sequence identity, preferably at least about 90% sequence identity.
[0052] As used herein, a or an means at least one, unless clearly indicated otherwise.
[0053] As used herein, to prevent or protect against a condition or disease means to hinder, reduce or delay the onset or progression of the condition or disease.
[0054] As used herein, the term isolated means that a naturally occurring DNA fragment, DNA molecule, coding sequence, or oligonucleotide is removed from its natural environment, or is a synthetic molecule or cloned product. Preferably, the DNA fragment, DNA molecule, coding sequence, or oligonucleotide is purified, i.e., essentially free from any other DNA fragment, DNA molecule, coding sequence, or oligonucleotide and associated cellular products or other impurities.
Vectors
[0055] In one embodiment, the expression vector comprises: (a) a nucleic acid sequence encoding lysine-specific demethylase 4D (KDM4D); (b) a promoter that induces or effects overexpression of KDM4D, wherein the promoter is operably linked to the nucleic acid sequence; and (c) a regulatory element that inducibly represses the overexpression of KDM4D. Optionally, the vector further comprises (d) a tissue-specific promoter operably linked to the nucleic acid sequence. In some embodiments, the tissue-specific overexpression of KDM4D is be achieved through selection of a tissue-specific promoter in (b). In some embodiments, tissue-specific expression is provided through both (b) and an additional promoter (d). The KDM4D is capable of specifically removing the histone modification H3K9me3 by demethylating the lysine residue at position 9 of histone 3 (H3K9).
[0056] While the promoter of (b) can be a tissue-specific promoter, and in some embodiments, separate promoters serve the functions described in (b) and (d) above, the selection of a tissue-specific promoter is designed to optimize preferential expression in the target tissue while minimizing unintended expression elsewhere. Representative examples of tissue-specific promoters include, but are not limited to, promoters specific to cardiac tissue (myosin heavy chain, troponin I or T), skeletal muscle (myogenein, MyoD, muscle creatine kinase), neurons, pancreatic islet cells, or hepatocytes. A promoter that is tissue-specific promotes expression of the gene encoded by the nucleic acid sequence predominantly in the particular tissue. In one embodiment, the tissue-specific promoter is specific to cardiac tissue. An -myosin heavy chain (MHC) promoter is one example of a cardiac-specific promoter. In another embodiment, the tissue-specific promoter is specific to liver tissue, or hepatocytes. A CBA promoter is one example of a liver-specific promoter. Other examples of tissue-specific promoters known in the art include the neuron-specific enolase (NSE) and tubulin 1 promoters for neurons, 1-antitrypsin and albumin (ALB) promoters for hepatocytes, and troponin, CMV, or myosin light chain-2 (MLC2) for cardiac myocytes.
[0057] Representative examples of a regulatory element capable of inducibly repressing expression (or overexpression) include, but are not limited to, tetracycline responsive elements and hormone responsive proteins. Those skilled in the art will appreciated alternative methods of controlled gene expression that can be adapted for use in a similar manner to regulate the expression of KDM4D, both temporally and histologically. For example, in one embodiment, the regulatory element enables positive regulation of KDM4D expression, while in another embodiment, the regulatory element enables negative regulation of KDM4D expression. In another example, the regulatory element enables tissue-specific and/or condition-specific regulation of KDM4D expression. While the ability to turn off expression of KDM4D is desirable, it is not essential to all embodiments. In one embodiment, the invention provides a vector comprising a nucleic acid sequence encoding lysine-specific demethylase 4D (KDM4D) and a promoter that induces or effects overexpression of KDM4D, wherein the promoter is operably linked to the nucleic acid sequence.
[0058] Vectors for use in the methods described herein include viral vectors, as well as non-viral vectors, virus-like particles, bacterial vectors, bacteriophage vectors, and other vectors known in the art. In one embodiment, the vector is a viral vector. In a particular embodiment, the viral vector is an adeno-associated virus (AAV) vector, or other vector suited for infecting quiescent cells. Representative examples of an AAV vector include, but are not limited to, AAV6 and AAV9.
[0059] KDM4D amino acid sequence (SEQ ID NO: 1):
TABLE-US-00001 MetETMetKSKANCAQNPNCNIMetIFHPTKEEFNDFDKYIAYMet ESQGAHRAGLAKIIPPKEWKARETYDNISEILIATPLQQVASGRAG VFTQYHKKKKAMetTVGEYRHLANSKKYQTPPHQNFEDLERKYWK NRIYNSPIYGADISGSLFDENTKQWNLGHLGTIQDLLEKECGVVIE GVNTPYLYFGMetWKTTFAWHTEDMetDLYSINYLHLGEPKTWYVV PPEHGQRLERLARELFPGSSRGCGAFLRHKVALISPTVLKENGIP FNRITQEAGEFMetVTFPYGYHAGFNHGFNCAEAINFATPRWIDYG KMetASQCSCGEARVTFSMetDAFVRILQPERYDLWKRGQDRAVVD HMetEPRVPASQELSTQKEVQLPRRAALGLRQLPSHWARHSPWP MetAARSGTRCHTLVCSSLPRQSAVSGTATQPRAAAVHSSKKPSS TPSSTPGPSAQIIHPSNGRRGRGRPPQKLRAQELTLQTPAKRPLL
[0060] Optional additional amino acid sequence with myc (underlined) and flag (shaded) tags (SEQ ID NO: 2):
##STR00001##
Compositions & Kits
[0061] The invention provides compositions, which can be provided as kits and/or used for the methods described herein. Compositions of the invention comprise vectors, nucleic acid molecules, and cells as described herein. Compositions and kits of the invention can include additional containers, agents, and materials to facilitate practice of the invention.
Methods of the Invention
[0062] The invention provides methods for inducing tissue-specific hyperplasia in a mammal comprising administering an expression vector as described herein to the mammal. The method can be tailored to any organ or tissue in which proliferation or regeneration of quiescent cells is of interest. Examples of tissues in which regeneration or proliferation may be of interest include, but art not limited to, heart, muscle, brain, nervous system, pancreas and liver. Also provided is a method for inducing cardiac myocyte (CM) hyperplasia in a mammal comprising administering an expression vector of the invention to the mammal. The invention further provides a method for inducing cardiac myocyte (CM) hyperplasia in a mammal. The method comprises grafting CMs to the heart of the mammal, wherein the CMs contain an expression vector of the invention.
[0063] The invention additionally provides a method for inducing CM hyperplasia comprising administering KDM4D to CMs. The KDM4D can be administered using a modification of the peptide and/or a delivery means that protects the activity of KDM4D. Administration can be systemic, localized, oral, intravenous, subcutaneous, or transdermal.
[0064] In one embodiment, the invention provides a method of improving organ function in a mammal comprising grafting cells genetically modified with an expression vector of the invention to the organ. The organ can be, for example, heart, muscle, brain, pancreas, or liver. In one embodiment, the invention provides a method of improving cardiac function in a mammal comprising grafting CMs to the heart of the mammal, wherein the CMs contain an expression vector of the invention. In another embodiment, the invention provides a method of improving cardiac function in a mammal comprising administering an expression vector of the invention to the mammal. Also provided is a method of improving cardiac function in a mammal comprising administering KDM4D to the mammal.
[0065] The invention further provides a method of proliferating CM comprising culturing CM with KDM4D under conditions effective to induce CM hyperplasia In one embodiment, the CM are adult CM (ACM). In addition, the invention provides a method of promoting cardiac regeneration comprising reducing lysine 9 of histone H3 (H3K9me3) levels in CMs. In one embodiment, the reducing comprises administering an expression vector of the invention to a subject in need of cardiac regeneration. In a particular embodiment, the expression vector is administered by administering CMs that contain the expression vector. In another embodiment, the reducing comprises administering KDM4D.
[0066] The methods of the invention can involve administration to the subject by any of a variety of means understood by those skilled in the art to be suitable for particular circumstances. In some embodiments, the administration is systemic. In other embodiments, the administration is intravenous. In some embodiments, the administration is by intra-myocardial injection. The subject is typically a mammal. In one embodiment, the mammal is human. In other embodiments, the mammal is a veterinary subject. Examples of veterinary subjects include, but are not limited to, equine, canine, bovine, porcine, ovine, and feline subjects.
EXAMPLES
[0067] The following examples are presented to illustrate the present invention and to assist one of ordinary skill in making and using the same. The examples are not intended in any way to otherwise limit the scope of the invention.
Example 1
Epigenetic Regulation of Cardiac Myocyte Cell Cycle Arrest
[0068] This example demonstrates that trimethylation of Lysine 9 of Histone H3 (H3K9me3), a histone modification associated with heterochromatin, is required for the silencing of cell cycle genes in adult CMs (ACMs). To test this, we developed a transgenic (BiTg) mouse model where H3K9me3 is specifically removed by histone demethylase KDM4D In CMs. Loss of H3K9me3 in CMs disrupts ACM cell cycle gene silencing preferentially and results in increased CM cycling. Normalized heart mass was increased by postnatal day 14 (P14) and continued to increase until 9-weeks of age. ACM number, but not size, was significantly increased in BiTg hearts, suggesting CM hyperplasia accounts for the increased heart mass. Challenging H3K9me3-depleted hearts with a hypertrophic growth signal stimulated ACM mitotic activity. Thus, we demonstrated that H3K9me3 is required for cell cycle gene silencing in ACMs and depletion of H3K9me3 allows hyperplastic growth in viva.
Methods
[0069] Mouse Studies. The MHC-tTA mice used to control transgene expression was generated by the Robbins lab (60). We used the previously published responder construct, which possesses a tetracycline responsive element upstream of an attenuated MHC promoter to drive KDM4D expression (60). Plasmid containing FLAG- and MYC-tagged human KDM4D cDNA (origene RC212600) had a NotI restriction site present in the cDNA sequence, which we destroyed by inducing a silent mutation (Agilent 200521). The resulting cDNA was subcloned into the responder construct, then freed of vector backbone, purified, and injected into mouse pronuclei (University of Washington transgenic core facility). The resulting tet transgenic was bred to the MHC-tTA line to generate the CM-specific KDM4D induction model. Littermate controls were used for all experiments involving transgenic mice. TAC and sham operations were performed on 10 to 12 week old littermates from breeders backcrossed 8 generations to the C57/B6 strain. Mice were anesthetized using ketamine (130 mg/kg i.p.) and xylazine (8.8 mg/kg i.p.) and subjected to transverse aortic constriction using a 26-gauge needle as described (103).
[0070] CM cell isolation and culture. Heparinized mice were euthanized with isoflurane and hearts were extracted and arrested in KB buffer (mmol/L: KCl 20, KH2PO4 10, K+-glutamate 70, MgCl2 1, glucose 25, taurine 20, EGTA 0.5, HEPES 10, 0.1% albumin, pH 7.4 with KOH). For purified ACM preparations, the aorta was cannulated and the heart was washed with Tyrodes solution (pH 7.4. supplemented with 25 uM Blebbistatin /) and digested for 7 minutes with collagenase II (Worthington 4176) and Protease Streptomyces griseus XIV (Sigma P5147) using Langendorf perfusion. Ventricles were dissociated and the resulting cell suspension was filtered through a 100 m mesh. Three rounds of low speed centrifugation, where ACMs are loosely pelleted and non-CMs in suspension are aspirated, density purify the ACM population, resulting in >90% rod-shaped ACMs. For embryonic and postnatal CM preparations, hearts were washed in Ads buffer (mmol/L: NaCl 116, HEPES 20, NAH2PO4 10.8, glucose 5.5, KCl 5.4, MgSO4 0.83) and incubated with enzyme solution (Collagenase II, Pancreatin (Sigma P3292)) with rotation. Freed cells were collected into serum (stopping digestion) every 20 minutes, resulting in dissociation of the entire heart within 2 hours. The resulting cell suspension was fractionated using a percoll (Sigma P4937) gradient, and the CM layer and non-CM layer were each collected. Quality and purity of CM preparations were verified by immunostaining, flow cytometry, and RNA expression of cell-type-specific markers.
[0071] Control ACM and dedifferentiated ACM cDNA was generated as described (57). In brief, ACMs were plated on laminin-coated dishes and cultured with growth factors for 10-14 days, resulting in a loss of sarcomere organization and increased CC activity.
[0072] RNA isolation and analysis. RNA was isolated from cells and tissue using TRISOL (Sigma T9424) phenol/chloroform purification, followed by column purification with DNase treatment (Qiagen 74004). For human gene expression studies, normal human heart sample was obtained from commercial vendors (Clontech 636532, lot 1206518A: and Agilent 540011, lot 6151000). Ischemic heart disease samples came from consenting male subjects in their 60's that underwent placement of a left ventricular assist device.
[0073] cDNA was synthesized as described in the manufacturers guidelines (Roche 04896866001). qPCR was performed using SYBR green (Life Technologies 4472908) on a real-time PCR machine (ABI 7900HT). Primers were validated by standard PCR with electrophoresis to confirm specific target band and lack of primer dimers. qPCR dissociation curves were consistent with a single specific product. Ct values were assigned using ABI's SDS 2.4 software with automated thresholding and baselines. The standard curve method or dCt method was used to quantify expression, and expression of each gene was normalized by GAPDH. However, in
[0074] Mouse (SEQ ID NOs: 3-50, respectively; individual SEQ ID Nos in parentheses below):
TABLE-US-00002 Gapdh F-CCAATGTGTCCGTCGTGGATCT(3), R-GTTGAAGTCGCAGGAGACAACC(4); ANP F-AGGATTGGAGCCCAGAGTGGA(5), R-TGATAGATGAAGGCAGGAAGC(6); bMHC F-GCGACTCAAAAAGAAGGACTTTG(7), R-GGCTTGCTCATCCTCAATCC(8); AMHC F-AGAAGCCCAGCGCTCCCTCA(9), R-GGGCGTTCTTGGCCTTGCCT(10); cTNIF F-GCAGCCCAGAGGAAACCCAACC(11), R-AGCCGCATCGCTGCTCTCATC(12); Ccnd1 F-TGCTGCAAATGGAACTGCTTCTGG(13), R-TACCATGGAGGGTGGGTTGGAAAT(14); Ccne1 F-GCTTCGGGTCTGAGTTCCAA(15), R-GGATGAAGAGCAGGGGTCC(16); Cdk4 F-GGGACCTGAAGCCAGAGAAC(17), R-CCACAGAAGAGAGGCTTCCG(18); Ccnb1 F-GCCTCACAAAGCACATGACTG(19), R-TCGACAACTTCCGTTAGCCT(20); Cdk1 F-GGCGAGTTCTTCACAGAGACTTG(21), R-CCCTATACTCCAGATGTCAACCGG(22); AurkB F-GCACCTGAAACATCCCAACAT(23), R-GGTCCGACTCTTCTGCAGTT(24); Pik1 F-GTATTCCCAAGCACATCAA(25), R-GTAGCCAGAAGTGAAGAAC(26); E2F1 F-TGCCAAGAAGTCCAAGAATCA(27), R-CTGCTGCTCACTCTCCTG(28); E2F4 F-TGTCCTTGGCAGCACTCA(29); R-TTCACCACTGTCCTTGTTCTCA(30); Rb F-CCTGATAACCTTGAACCTGCTTGT(31), R-GCTGAGGCTGCTTGTGTCT(32); p130 F-CACCGAACTTATGATGGACAG(33), R-ATGGCTTCTGCTCTCACT(34); p107 F-GCAGAGGAGGAGATTGGAACA(35), R-GCTACAGGCGTGGTGACT(36); p21 F-GCAGACCAGCCTGACAGATTT(37), R-CTGACCCACAGCAGAAGAGG(38); p53 F-CAGTGGGAACCTTCTGGGAC(39), R-CGCGGATCTTGAGGGTGAAA(40); KDM4A F-CTGCTAGGGCTTTAGGCTCC(41), R-TTTGGGAGGAACGACCTTGG(42); KDM4B F-CAGAGAGCATCACGAGCAGA(43), R-CTCTTGGGCAGCTCCTCTTC(44); KDM4C F-GCGGGTTCATGCAAGTTGTT(45), R-GTTTCAGAGCACCTCCCCTC(46); KDM4D(endogenous) F-TCTGAGTCTGCCTTCTTCTG(47), R-GCCAGGGTTCACAAGTCCTGAG(48); KDM4D(transgene) F-TTGATGGACAAGCCTGTACC(49), R-TCATTTGCTGCCAGATCCTC(50).
[0075] Mouse: TaqMan (Life Technologies) reagents were used for the following genes: KDM2B (Mm01194587_m1), KDM4A (Mm00605000_m1), KDM6B (Mm01332680_m1), KDM8 (Mm00513079_m1), GAPDH (Mm99999915_g1).
[0076] Human (SEQ ID NOs: 51-54, respectively; individual SEQ ID Nos in parentheses below):
TABLE-US-00003 GAPDH F-CCTCAACGACCACTTTGTCA(51), R-TTACTCCTTGGAGGCCATGT(52); KDM4D F-AAGCCCAGCTCAACTCCATC(53), R-TGTCCATCAAAGCCCCATCC(54).
[0077] RNAseg library construction (Illumina Tru-Seq) and paired-end RNA-sequencing (ABI3730XL) was performed by the Stam Lab's University of Washington core facility. Read alignment was performed using Bowtie/Cufflinks package. Partek Genomic Suites was used for mRNA quantification, differential expression analysis, and gene ontology.
[0078] 2-D Echocardiography. Under 0.5% isoflurane, mice EKG and heart function was assessed using Visual Sonics Vevo 2100. Parasternal short axis images at the plane of the papillary muscle were collected in B- and M-Modes. Images were collected with heart rates ranging from 400-500 BPMs. Imaging and analysis was performed by a single operator who was blinded to the genotypes. Quantification of images was performed using Vevo Labs 1.7.0, according to the manufacturer's guidelines.
[0079] Protein extraction and Western Blotting. Isolated ACMs were pelleted and resuspended in lysis buffer (0.5% NP-40, 25 mM KCI, 5 mM MgCl2, 10mM Tris-HCl, pH 8.0) and homogenized (Wheaton 358103), releasing soluble cytoplasmic proteins. Nuclear-enriched pellets were processed to release chromatin-associated proteins from DNA; including sonication, MNase treatment, and addition of 1% SDS, 600 mM NaCl, and 20 mM pME. The nuclear proteins were quantified using a BOA assay (Thermo Scientific 23252) and were loaded on polyacrylamide gels for electrophoresis, subsequently transferred onto PVDF membrane, and probed with the indicated antibodies: KDM4D (Abcam ab93694). H3K9me3 (Abcam ab8898), pan H3 (Millipore 05-928), H3K36me3 (Active Motif 61101), H3K9me2 (Millipore 07-441). and H4K20me3 (Abcam ab9053). HRP-conjugated secondary antibodies (Santa Cruz) and ECL-detection (Thermo Scientific 34095) were used.
[0080] Histological studies and quantification CM dimensions and CM number. For histological analysis, arrested P14 or 9 week hearts were fixed with 4% PFA. Paraffin sections were stained with H&E, Masson Trichrome, or immunostained using standard protocol with FLAG (Sigma F7425) -actinin (Sigma A7811), cardiac Troponin T (Thermo Scientific MS-295-P), Ki67 (Abcam ab15580) and phospho-H3 (Abcam ab5176) antibodies, and Hoechst (Life Technologies H3570) to visualize nuclei. Images were acquired with confocal microscopy (Nikon A1R). To assess ACM transverse area, sections were stained with Wheat Germ Agglutinin (WGA, Life Technologies W6748), a marker for plasma membrane. Stitched-images of the whole left ventricle were acquired on a Nikon Ti-E scope. We chose several regions in each section at random, though we excluded large vessels, epicardium and endocardium, and >1000 cells per animal were analyzed using Image J's analyze particle function (negative image of WGA stain), resulting in direct measurement of transverse area. For ACM longitudinal area and length measurements, isolated ACMs were fixed with 4% PFA and imaged. The area and long-axis of hundreds of ACMs for each animal were manually traced and quantified using Image J's measure function. We calculated CM volume using the formula: (mean ACM lengthmean ACM transverse area). CM number was estimated from the following formula: [mean Heart Volume (Heart mass/1.06, the density of muscle tissue(106))/mean ACM volume0.75 (the proportion of adult murine heart volume occupied by CMs(106))] The number of nuclei per ACM was counted manually for >100 cells per animal.
[0081] Imaging of thick sections. For unambiguous determination of cell type in our phospho-H3 staining assays in operated mice, we developed a method for generating, staining, and imaging 100 m-thick heart sections, which will be described in detail in a methodologies article. Briefly, hearts were arrested in KB buffer, perfused with KB, then perfusion fixed with methanol cooled to 20 C. The hearts were rehydrated in Methanol:PBS gradients (100:0, 80:20, 60:40), then washed with PBS and mounted in 5% low-melt agarose. 100 m-thick sections were cut from a Leica 1200s vibratome and were stained in suspension, with reagents listed above as well as with Phalloidin (ThermoFisher Scientific A22287). The stained sections were mounted to glass coverslips coated with 0.01% poly-L-lysine. To increase the transparency of the sections, which is needed to view the interior of the thick sections, they were cleared: sections were incubated in an isopropanol series (70%, 85%, 95%, 100%) followed by incubations in a 1:2 solution of benzyl alcohol and benzyl benzoate. The samples were prepared, imaged with confocal microscopy, and analyzed by a single operator blinded to the genotypes. We calculated the number of pH3+ ACMs using the formula: [(pH3+ ACM nuclei/mm3))/(nuclei #LACM)/(ACM/mm3)] We note that transverse area measurements in the sham-operated hearts were 19.2% less than at baseline, which we attribute to differences in fixation procedure, consistent with other reports comparing cell shrinkage after formaldehyde or alcohol fixation (107). Because of this, transverse area in all groups was corrected by multiplying by a constant factor of 1.192, when calculating ACM number in the post-operation methanol-fixed samples: [mean Heart Volume (Heart mass/1.06, the density of muscle tissue(106))/mean ACM volume (mean ACM baseline lengthmean ACM post-operation transverse area)0.75 (the proportion of adult murine heart volume occupied by CMs (106))].
[0082] Statistics. All results are displayed as meanstandard error of means. Graphpad Prism was used for one-way-ANOVAs and Tukey's post hoc tests performed on studies comparing more than two groups. Graphpad Prism was used for two-way-ANOVAs and Tukey's post hoc tests performed on studies with two independent variables. Microsoft Excel F-test and two-tailed T-test functions were used to analyze studies comparing two groups. For outcomes where different basic measurements were combined for calculations (
[0083] Study approval. All animal studies were performed in accordance with an approved Institutional Animal Care and Use Committee (IACUC protocol #4290-01), the University of Washington institutional guidelines, and the National Institute of Health Guide for the Care and Use of Laboratory Animals. Human ischemic heart disease samples came from participants that gave written and informed consent; the use of human samples was approved by the University of Washington's Institutional Review Board (IRB #35358).
[0084] Adenoviral studies. Adenoviruses for KDM4A and LacZ were generated according to manufacturers guidelines (Agilent 240082), isolated ACMs were plated on laminin coated wells in M199 medium supplemented with 1 ITS, 1 PS, 5 mM Taurine, 1 mM Na-pyruvate, 5 mM Creatine, 2 mM L-carnitine, and 25 mM Blebistatin, with the presence of 5% FBS. After 1 hour, media was changed to 2% FBS containing media and 150 moi of viruses were added. ACMs were maintained in media containing 2% FBS until harvesting. Beta-galactosidase staining was performed on 4% PFA-fixed ACMs that were incubated in 5 mM K+ fend-cyanide, 5 mM K+ferro-cyanide, 2 mM MgCl2, and 1 mg/mL X-gal for 4 hours.
[0085] Temporally-controlled KDM4D induction. Doxycycline-containing chow (Harlan TD.00502) was administered ad lib for the indicated times. Note that the Dox 2 weeks-9 weeks group includes mice that received dox ranging from P14-9w to P18-9w.
[0086] Myocardium and LV area quantification. Vibratome sections were cut from the mid-papillary muscle plane of hearts and imaged. Myocardium area and LV chamber area were manually traced in ImageJ and area was calculated using the measure tool.
[0087] Quantification of apoptosis. Apoptosis was visualized in vibratome sections by using a TUNEL staining kit (Life Technologies C10618) according to the manufacturer's guidelines. Following TUNEL labeling, we stained for WGA, Hoechst, and phalloidin, and imaged as described in the procedures for vibratome sections.
Results
Characterization of H3K9me3 Histone Demethylase Expression in CMs.
[0088] To better understand the role of H3K9me3 in regulating cell cycle gene expression, we characterized the relationship between cell cycle and H3K9me3-HDM gene expression in CMs through cardiac development (
[0089] To screen for HDMs that might be involved in CM proliferation, we looked for HDMs that were upregulated during CM dedifferentiation, as dedifferentiation appears to be a requisite for CM proliferation in the zebrafish and neonatal mouse heart regeneration models (1-3). Dedifferentiation of mammalian ACMs can be achieved in vitro by long-term culture with growth factors, resulting in disassembly of sarcomeres and restoration of proliferative potential (57). From a panel of diverse HDMs, KDM4D was the most highly upregulated (401-fold) during dedifferentiation (
Generation of a Transgenic Mouse Model to Deplete H3K9me3 Specifically in CM
[0090] To explore the role of H3K9me3 in ACM cell cycle gene silencing in vivo, we chose to overexpress KDM family member 4D because: 1) KDM4D is the most specific H3K9me3 demethylase (50-52) (
H3K9me3 is Required for ACM Cell Cycle Gene Silencing In Vivo.
[0091] To assess the impact of depleting H3K9me3 on global gene expression in vivo we performed RNA-sequencing on 9-week ACMs. Control ACM samples were grouped since NonTg and single transgenic mice showed no differences in gene expression, with the unconstrained slope correlation test showing R2=0.9764 when comparing the whole-genome transcriptome. RNA-seq analysis revealed that BiTg ACMs had increased expression of genes involved in 16 of 138 cellular processes and 16 of 142 cell cycle processes (
CM-Specific H3K9me3 Depletion Promotes CM Hyperplasia without Altering Cardiac Function.
[0092] BiTg mice had visibly larger hearts (
TABLE-US-00004 TABLE 1 Normal cardiac function and morphology in BiTg mice at 7 months. Echocardiography results in 7 month old mice. HR: Heart Rate, EF: Ejection Fraction, CO: Cardiac Output, LVEDD: Left Ventricular End-Diastolic Dimension, LV Mass: Left Ventricular Mass. Mean and SEM values are shown. Sample Number: N = 3 for each genotype. Statistics: One-way ANOVA/Tukey's test, * P < 0.05 vs NonTg, P < 0.05 vs tet, P < 0.05 vs tTA. NonTg tet tTA BiTg HR (BPM) 440 10 461 16 452 6 404 3 EF (%) 74.5 3.7 80.9 1.6 83.8 2 80.2 4.6 FS (%) 42.7 3.2 48.9 1.6 52.3 2.2 48.8 4.9 CO (mL/min) 16.4 1.4 20.5 1 17.4 1.5 19.1 0.7 LVEDD (mm) 3.47 0.06 3.61 0.02 3.35 0.15 3.73 0.07
[0093] To assess cell cycle activity, we immunostained P14 and 9 week myocardial sections for phosphorylated histone H3 serine-10 (pH3), a marker of mitosis. We observed pH3+ CMs only in BiTg mice at both time points (
[0094] Cardiac mass increased up to 9-weeks of age in BiTg mice (
Hypertrophic Signals Stimulate Proliferation of H3K9me3-Depleted ACMs.
[0095] Although highly upregulated compared to controls, late cell cycle gene expression in BiTg ACMs is much less than in wildtype embryonic and postnatal CMs (compare
TABLE-US-00005 TABLE 2 Cardiac function and morphology in TAC-operated mice. Echocardiography results in 12 week old mice, 10 days post-operation. HR: Heart Rate, EF: Ejection Fraction, CO: Cardiac Output, LVEDD: Left Ventricular End-Diastolic Dimension, LV Mass: Left Ventricular Mass. Mean and SEM values are shown. Sample Number: Sham, Control = 4, BiTg = 4; TAC, Control = 9, BiTg = 8. Statistics: Two-tailed T-test, control vs. BiTg, *P < 0.05. Sham TAC Control BiTg Control BiTg HR (BPM) 428 17 416 7.6 430 11 406 10 EF (%) 71.1 4.2 72.4 3.7 75.5 4.4 51.2 3.7* FS (%) 39.5 3.5 40.8 3.4 43.7 3.5 25.9 2.3* CO 11.6 2.4 12.4 1.5 9.8 0.9 10.9 0.7 (mL/min) LVEDD 3.04 0.14 3.19 0.11 2.83 0.09 3.57 0.10* (mm)
Discussion
[0096] Since the discovery that neonatal mammalian hearts can regenerate by CM proliferation (2,3) and that ACMs retain some, though very limited, capacity to divide (7), interest in the regulation of ACM cell cycle has been reignited (4,69-71). Many strategies that can promote proliferation in mammalian neonatal CMs have been ineffective in ACMs (72,73) highlighting the fact that strong barriers to proliferation exist in ACMs. Recently, epicardial paracrine factor FSTL1 (70), miR-15 inhibition (3), and the NRG1 co-receptor Erbb2 (74) were suggested to promote ACM proliferation, though the molecular mechanisms and relevant targets in ACMs remain elusive. We previously found that the heterochromatin marker H3K9me3 was enriched on G2/M and cytokinesis genes in ACMs compared to fetal CMs implicating this mark as a barrier to ACM proliferation (9). This example characterizes the expression of H3K9me3-demethylases in development, dedifferentiation, and disease and shows that KDM4D was expressed in fetal CMs and was the primary H3K9me3-specific demethylase upregulated in dedifferentiating ACMs. CM-specific KDM4D overexpression depleted H3K9me3 specifically and led to increases in ACM expression of G2/M and cytokinesis genes, cardiac mass, ACM number, and ACM mitotic activity.
[0097] The renewed interest in CM proliferation has also called attention to the need of improved methodologies for detecting ACM proliferation (75). The standard indicator of ACM proliferation has been indirect in situ histology of phase-specific or general cell cycle markers. However, it has been suggested these results are often equivocal because it can be difficult to determine if the marker is present in a CM or non-CM (75,76). Most studies are performed in cardiac sections less than 10 m thick, which is significantly thinner than even the shortest axis of mammalian ACMs, and are further confounded by the dense myocardial vasculature and non-CMs that are the majority of cardiac cells (77). We addressed this limitation by developing a novel sample preparation and imaging technique that yields high-resolution 3D image reconstructions of cleared thick sections with several layers of whole ACMs, allowing unambiguous identification of mitotic ACMs in KDM4D overexpressing mice (
[0098] This example confirms that H3K9me3 is required for ACM cell cycle gene silencing in vivo but that H3K9me3 is not sufficient by itself to explain the stable silencing of cell cycle genes in ACMs since it was maintained on G2/M and cytokinesis genes even after they were derepressed by Rb/p130 double knockout (9). In that study, HP1, whose chromodomain specifically binds H3K9me3, was displaced from late cell cycle gene promoters. This study suggested that stable silencing of cell cycle genes in ACMs required recruitment of HP1 and that H3K9me3, though required, was not sufficient to silence genes (9). Since Rb and H3K9me3 are both required for HP1 binding in many systems it is possible that KDM4D overexpression derepressed late cell cycle genes in ACMs by removing HP1's binding-substrate from chromatin. Regardless, since Rb and H3K9me3 are present on numerous genes it remains unclear why late cell cycle genes are preferentially derepressed. It may perhaps be related to particular combinations of E2F- and Rb-family members forming distinct complexes and targeting specific subsets of genes (33,34). In BiTg ACMs, this example showed that the E2F/Rb-family members most increased by H3K9me3-depletion were E2F1 and p107 (
[0099] This example demonstrated that ACMs can tolerate moderate levels of G2/M and cytokinesis gene expression without deleterious effects on heart function (
[0100] We have suggested that there is a transition in heterochromatin structure during postnatal differentiation in ACMs (9) from limited heterochromatin organized into many small foci within the nucleus of embryonic CM, to few, large foci with additional heterochromatin at the nuclear lamina in postnatal CM nuclei (
[0101] The results can be compared to findings in studies of another major cell proliferation regulation signaling pathway, the organ-size-controlling Hippo/Yap pathway. This pathway has been intensely studied with several CM-specific loss of function and gain of function mouse models through CM development and adulthood (71,93). Though Yap1 gain of function in adults increased ACM proliferation, the levels were 20-fold less than NonTg neonatal CMs (76). The authors postulated Yap activation alone is insufficient to overcome the multiple barriers blocking ACM proliferation. In several other systems Yap signaling fads to drive proliferation in the absence of E2F signaling (94-96). Interestingly, informatics and chromatin immunoprecipitation sequencing approaches found E2F- and Yap-binding sites neighbor each other on many cell cycle gene promoters (95-97), which suggests E2F and Yap might be parallel pathways. Indeed, in liver regeneration models enhanced E2F activation by triple knockout of the Rb-family members resulted in cell proliferation; however the increased proliferation declined over time due to dampening of Yap signaling (97). Forced Yap1 activation or reducing liver size by partial hepatectomy allowed the E2F-mediated increases in proliferation to persist. This suggests that the intrinsic Hippo/Yap pathway has a remarkable ability to sense and regulate normal organ size and that E2F-mediated increases in proliferation can be augmented by growth stimulation or Yap signaling. This is consistent with our finding that hemodynamic load, which increases active Yap levels (98) stimulated dramatic proliferation even in quiescent adult KDM4D hearts. Interestingly, endogenous Yap1 protein is expressed highly in postnatal CMs and is maintained at 8-weeks but lost by 20-weeks (99), which may account for the increases in HW/BW leveling out by 9-weeks in our model. The synergism of E2F and Yap activation is also consistent with a model of multiple blocks to ACM proliferation. Future studies examining the connectivity of the E2F/Rb-family and Hippo/Yap signaling pathways in CM cell cycle may clarify if H3K9me3 regulation of cell cycle genes is strictly E2F dependent. The relative importance of these pathways is speculative but growth signals that typically induce ACM hypertrophy caused re-induction of ACM proliferation in both H3K9me3-depleted ACMs and previously reported Yap1 mice (76). Although NonTg ACMs in the present example and these YAP-activated models had similar, very limited mitotic activity after growth stimulus (0.02% (76) vs 0.019%
[0102] In conclusion, CM-specific KDM4D induction and the subsequent H3K9me3-depletion is sufficient to maintain proliferation competence in ACMs. These results further the understanding of how cardiac growth is regulated and identify a new role for H3K9me3 and common effector pathway for regulation of CM cell cycling. The fact that KDM4D overexpression did not affect normal heart function but allowed hyperplasia in response to hypertrophic signals supports the use of KDM4D to improve the regenerative response in clinical settings. This strategy is very amenable to gene therapies with localized and temporally controlled KDM4D expression and provides regenerative cardiac therapies.
Example 2
Neonatal Mouse Regeneration Model
[0103] An animal model for regeneration of heart tissue is illustrated in
Example 3
Gene Therapy for Heart Regeneration
[0104] Vectors can be constructed for implementation and assessment of cardiac regeneration using gene therapy. The vectors can be constructed using AAV viruses, such as AAV6 or AAV9 or other hybrid AAV serotypes offering specificity for cardiac myocytes. A Troponin promoter is used for CM-specific expression. The AAV-KDM4D vector (expressing SEQ ID NO: 1 and optionally SEQ ID NO: 2) is injected into cardiac tissue at, or shortly after, the time of myocardial infarct. Assessment of heart function by echocardiography (ECHO) and cardiac magnetic resonance (CMR) is performed at subsequent time intervals to monitor recovery and regeneration. At the conclusion of the study, infarct size and ACM proliferation are assessed.
[0105] In one version of the construct, KDM4D can be shut off after a few weeks of regeneration to return KDM4D levels back to baseline, once lost CMs have been repopulated. Those skilled in the art will appreciate adjustments to the protocol that can be made to allow for alternative vectors and/or promoters that can achieve the same effect, as well as to allow for appropriate timing of the period of treatment before returning KDM4D levels back to baseline, taking into account individual circumstances such as the extent of damage and/or patient responsiveness.
REFERENCES
[0106] 1. Jopling, C., et al. 2010. Nature 464:606-609.
[0107] 2. Porrello, E. R., et al. 2011. Science 331:1078-1080.
[0108] 3. Porrello, E. R., et al. 2013. Proc. Natl. Acad. Sci. U.S.A 110:187-192.
[0109] 4. Xin, M., et al 2013. Proc. Natl. Acad. Sci. U.S.A 110:13839-13844.
[0110] 5. Laflamme, M. A., and Murry, C. E. 2011. Nature 473:326-335.
[0111] 6. Li, A. H., Liu, P. P., et al. 2014. Circ. Res. 1141916-927.
[0112] 7. Senyo, S. E., et al. 2013. Nature 493:433-436.
[0113] 8. Bergmann, O., et al 2009. Science 324:98-102.
[0114] 9. Sdek, P., et al. 2011. J. Cell Biol. 194:407-423.
[0115] 10. Angells, E., et al. 2008. Circ. Res. 102:1222-1229.
[0116] 11. Zhong, W., et al. 2006. EMBO J. 25:3869-3879.
[0117] 12. Ahuja, P., et al. 2007, Physiol Rev. 87:521-544.
[0118] 13. Neufeld, T. P., and Edgar, B. A. 1998. Curr. Opin. Cell Biol. 10:784-790.
[0119] 14. He, A., et al 2012. Circ. Res. 110:406-415.
[0120] 15. Oyama, K., et al. 2014. Front Genet. 5:375.
[0121] 16. Hohl, M., et al 2013. J. Clin. Invest 123:1359-1370.
[0122] 17. Lee, S., et al. 2012. Dev. Cell 22:25-37.
[0123] 18. Movassagh, M., et al 2011. Circulation 124:2411-2422.
[0124] 19. Eulalio, A., et al. 2012. Nature 492:376-381.
[0125] 20. Beisel, C., and Paro, R. 2011. Nat. Rev. Genet. 12:123-135.
[0126] 21. Musselman, C. A., et al. 2012. Nat. Struct. Mol. Biol. 19:1218-1227.
[0127] 22. Kouzarides, T. 2007, Cell 128:693-705.
[0128] 23. Filion, G. J., et al 2010. Cell 143:212-224.
[0129] 24. Margueron, R., et al. 2008. Mol. Cell 32:503-518.
[0130] 25. Tessarz, P., and Kouzarides, T. 2014. Nat. Rev. Mol. Cell Biol. 15:703-708.
[0131] 26. Simon, M., et al. 2011. Proc. Natl. Acad. Sci. U.S.A 108:12711-12716.
[0132] 27. Chandra, T., et al 2012. Mol. Cell 47:203-214.
[0133] 28. Solovei, I., et al. 2009. Cell 137:356-368.
[0134] 29. Zhang, R., et al. 2007. Mol. Cell Biol. 27:2343-2358.
[0135] 30. Giacinti, C., and Giordano, A. 2006. Oncogene 25:5220-5227.
[0136] 31. Blais, A., and Dynlacht, B. D. 2007. Curr. Opin. Cell Biol. 19:658-662.
[0137] 32. Gonzalo, S., et al 2005. Nat. Cell Biol. 7:420-428.
[0138] 33. Macaluso, M., et al. 2006. Oncogene 25:5263-5267.
[0139] 34. Bracken, A. P., et al. 2004. Trends Blochem. Sci. 29:409-417.
[0140] 35. Blais, A., et al. 2007. J. Cell Biol. 179:1399-1412.
[0141] 36. Xiao, G., et al. 2001. Circ. Res. 89:1122-1129.
[0142] 37. Dahiya, A., et al. 2001. Mol. Cell 8:557-569.
[0143] 38. Narita, M., et al. 2003. Cell 113:703-716.
[0144] 39. Nielsen, S. J., et al 2001. Nature 412:561-565.
[0145] 40. Whetstine, J. R., et al 2006. Cell 125:467-481.
[0146] 41. Bannister, A. J., and Kouzarides, T. 2005. Nature 436:1103-1106.
[0147] 42. McManus, K. J., et al. 2006. J. Biol. Chem. 281:8888-8897.
[0148] 43. Mosammaparast, N., and Shi, Y. 2010. Annu. Rev. Biochem. 79:155-179.
[0149] 44. Shi, Y., and Whetstine, J. R. 2007. Mol. Cell 25:1-14.
[0150] 45. Berry, W. L., et al. 2012. J. Oncol. 41:1701-1706.
[0151] 46. Berry, W. L., and Janknecht, R. 2013. Cancer Res. 73:2936-2942.
[0152] 47. Kim, T. D., et al. 2012. PLoS. One. 7:e34618.
[0153] 48. Shin, S., and Janknecht, R. 2007. Biochem. Biophys. Res. Commun. 359:742-746.
[0154] 49. Zhang, Q. J., et al. 2011. J. Clin. Invest 121:2447-2456.
[0155] 50. Hillringhaus, L, et al. 2011. J. Biol. Chem. 286:41616-41625.
[0156] 51. Krishnan, S., and Trievel, R. C. 2013. Structure. 21:98-108.
[0157] 52. Shin, S., and Janknecht, R. 2007. Biochem. Biophys. Res. Commun. 353:973-977.
[0158] 53. Zhang, Y., et al. 2013. J. Regan. Med. 2:2.
[0159] 54. Siedner, S., et al. 2003. J. Physiol 548:493-505.
[0160] 55. Iwamori, N., et al. 2011. Biol. Reprod. 84:1225-1234.
[0161] 56. Zhu, Y., et al. 2012. Mol. Cell 46:408-423.
[0162] 57. Zhang, Y., et al. 2010. PLoS. One. 5:e12559.
[0163] 58. Kaistura, J., et al. 1998. Proc. Natl. Acad. Sci. U.S.A 95:8801-8805.
[0164] 59. Peters, A. H., et al 2001. Cell 107:323-337.
[0165] 60. Sanbe, A., et al. 2003. et al Circ. Res. 92:609-616.
[0166] 61. Schoeftner, S., and Blasco, M. A. 2009. EMBO 28:2323-2336.
[0167] 62. Lange, U. C., et al. 2013. Nat. Commun. 4:2233.
[0168] 63. Schotta, G., et al. 2004 Genes Dev. 18:1251-1262.
[0169] 64. Kikuchi, K., et al. 2010. Nature 464:601-605.
[0170] 65. Emde, B., et al. 2014. Eur. J. Histochem. 58:2448.
[0171] 66. Esposito, G., et al 2010. Hypertension 55:137-143.
[0172] 67. Qu, J., et a 2007. J. Mol. Cell Cardiol. 43:319-326.
[0173] 68. Okada, K., et al 2004. Circulation 110:705-712.
[0174] 69. Mahmoud, A. I., et al 2013. Nature 497:249-253.
[0175] 70. Wei, K., et al 2015. Nature 525:479-485.
[0176] 71. Zhou, Q., et al 2015. Circ. Res. 116:1431-1447.
[0177] 72. Novoyatleva, T., et al. 2010. Cardiovasc. Res. 85:681-690.
[0178] 73. Oh, H., et al. 2001. Proc. Natl. Acad. Sci. U.S.A 98:10308-10313.
[0179] 74. D'Uva, G., et al 2015. Nat. Cell Biol. 17:627-638.
[0180] 75. van Berlo, J. H., and Molkentin, J. D. 2014. Nat. Med. 20:1386-1393.
[0181] 76. Lin, Z., et al 2014. Circ. Res. 115:354-363.
[0182] 77. Zhou, P., and Pu, W. T. 2016. Circ. Res. 118:368-370.
[0183] 78. Ali, S. R., et al. 2014. Proc. Natl. Acad. Sci. U.S.A 111:8850-8855.
[0184] 79. Khidr, L., and Chen, P. L. 2006. Oncogene 25:5210-5219.
[0185] 80. Knudsen, E. S., and Wang, J. Y. 1998. Oncogene 16:1655-1663.
[0186] 81. Muramatsu, D., et al. 2013. J. Biol. Chem. 288:25285-25296.
[0187] 82. Peters, A. H., et al 2003 Mol. Cell 12:1577-1589.
[0188] 83. Black, J. C., et al 2010. Cell 40:736-748.
[0189] 84. Rea, S., et al 2000. Nature 406:593-599.
[0190] 85. Xu, D., et al. 2009. Cell Cycle 8:3688-3604.
[0191] 86. Ponnaluri, V. K., et al. 2009 Biochem. Biophys. Res. Commun. 390:280-284.
[0192] 87. Yang, L., et al. 2011. Cell 147:773-788.
[0193] 88. Munro, S., et al. 2010. Oncogene 29:2357-2367.
[0194] 89. Saddic, L. A., et al. 2010. J. Biol. Chem. 285:37733-37740.
[0195] 90. Khoury-Haddad, H., et al. 2014. Proc. Natl. Acad. Sci. U.S.A 111:E728-E737.
[0196] 91. Khoury-Haddad, H., et al. 2015. Cell Cycle 14:950-958.
[0197] 92. Puente, B. N., et al 2014. Cell 157:565-579.
[0198] 93. Lin, Z., and Pu, W. T. 2014. Stem Cell Res. 13:571-581.
[0199] 94. Dick, F. A., and Mymryk, J. S. 2011. Genes Dev. 25:889-894.
[0200] 95. Ehmer, U., and Sage, J. 2016. Mol. Cancer Res. 14:127-140.
[0201] 96. Nicolay, B. N., et al. 2011. Genes Dev. 25:323-335.
[0202] 97. Ehmer, U., et al. 2014. Cell Rep. 8:371-381.
[0203] 98. Wang, P., et al 2014. Basic Res. Cardiol. 109:435.
[0204] 99. von, G. A., et al 2012. Proc. Natl. Acad. Sci. U.S.A 109:2394-2399.
[0205] 100. Dong, J., et al. 2007. Cell 130:1120-1133.
[0206] 101. Esteve, P. O., et al. 2005. Proc. Natl. Acad. Sci. U.S.A 102:1000-1005.
[0207] 102. Choi, B. H., et al. 2015. Genes Cancer 6:371-377.
[0208] 103. Liu, Y., et al. 2010. Am. J. Physiol Heart Circ. Physiol 298:H2082-H2092.
[0209] 104. Brattelid, T., et al. 2010. BMC. Mol. Biol. 11:22.
[0210] 105. Kolwicz, S. C., Jr., et al. 2013. Circ. Res. 113:603-616.
[0211] 106. Anversa, P., et al. 1990. Circ. Res. 67:871-885.
[0212] 107. Schnell, U., et al. 2012. Nat. Methods 9:152-158.
[0213] Throughout this application various publications are referenced. The disclosures of these publications in their entireties are hereby incorporated by reference into this application in order to describe more fully the state of the art to which this invention pertains.
[0214] Those skilled in the art will appreciate that the conceptions and specific embodiments disclosed in the foregoing description may be readily utilized as a basis for modifying or designing other embodiments for carrying out the same purposes of the present invention. Those skilled in the art will also appreciate that such equivalent embodiments do not depart from the spirit and scope of the invention as set forth in the appended claims.