Factor XII inhibitors for the treatment of neurological inflammatory disorders

09957329 ยท 2018-05-01

Assignee

Inventors

Cpc classification

International classification

Abstract

This application relates to neurological inflammatory diseases, such as multiple sclerosis, and to methods of administering a Factor XII inhibitor to prevent, treat, or otherwise ameliorate the effects of a neurological inflammatory disease, such as multiple sclerosis. Agents and pharmaceutical compositions comprising agents which inhibit the activity of FXII are also provided.

Claims

1. A method for treatment and/or amelioration of multiple sclerosis comprising administering to a subject in need thereof a therapeutically effective amount of a direct inhibitor of Factor XII (FXII), wherein the direct inhibitor of FXII contacts FXII to inhibit the activity and/or activation of FXII in the subject.

2. The method of claim 1, wherein the direct inhibitor of FXII comprises the wild type infestin-4 polypeptide sequence (SEQ ID NO: 2), or a variant thereof, wherein the variant comprises: (a) the N-terminal amino acids 2-13 of SEQ ID NO: 2 and at least one and up to five amino acid mutations outside said N-terminal amino acids that result in differences from the wild type infestin-4 sequence; and/or (b) the six conserved cysteine residues of the wild type Infestin-4 polypeptide sequence (SEQ ID NO: 2) and homology of at least 70% to the wild type Infestin-4 polypeptide sequence.

3. The method of claim 1, wherein the direct inhibitor of FXII comprises wild-type SPINK-1 sequence (SEQ ID NO: 3), which is mutated to include the N-terminal amino acids 2-13 of SEQ ID NO: 2, or a variant of said mutated SPINK-1, wherein the variant comprises: (a) the N-terminal amino acids 2-13 of SEQ ID NO: 2 and at least one and up to five amino acid mutations outside said N-terminal amino acids that result in differences from the wild type SPINK-1 sequence and which increase the homology of the variant to the wild type infestin-4 sequence; and/or (b) the six conserved cysteine residues of the wild-type SPINK-1 sequence (SEQ ID NO: 3) and homology of at least 70% to the wild type SPINK-1 sequence.

4. The method of claim 3, wherein the direct inhibitor of FXII comprises wild type SPINK-1 (SEQ ID NO: 3), SPINK-1 mutant K1 (SEQ ID NO: 4), SPINK-1 mutant K2 (SEQ ID NO: 5) or SPINK-1 mutant K3 (SEQ ID NO: 6).

5. The method of claim 1, wherein the direct inhibitor of FXII comprises an anti-FXII antibody or antigen binding fragment.

6. The method of claim 5, wherein the anti-FXII antibody or antigen binding fragment thereof comprises (a) a VH region comprising heavy chain CDR1 as set forth in SEQ ID NO: 9, heavy chain CDR2 as set forth in SEQ ID NO: 11, and heavy chain CDR3 as set forth in SEQ ID NO: 13; and/or (b) a VL region comprising light chain CDR1 as set forth in SEQ ID NO: 14, light chain CDR2 as set forth in SEQ ID NO: 15, and light chain CDR3 as set forth in SEQ ID NO: 17.

7. The method of claim 5, wherein the anti-FXII antibody or antigen-binding fragment thereof comprises (a) a VH region comprising heavy chain CDR1 as set forth in SEQ ID NO: 9, heavy chain CDR2 as set forth in SEQ ID NO: 10, and heavy chain CDR3 as set forth in SEQ ID NO: 12; and/or (b) a VL region comprising light chain CDR1 as set forth in SEQ ID NO: 14, light chain CDR2 as set forth in SEQ ID NO: 15, and light chain CDR3 as set forth in SEQ ID NO: 16.

8. The method of claim 5, wherein the anti-FXII antibody or antigen-binding fragment thereof comprises a VH region comprising SEQ ID NO: 7 and a VL region comprising SEQ ID NO: 8.

9. The method of claim 5, wherein the anti-FXII antibody is an IgG.

10. The method of claim 1, wherein the direct inhibitor of FXII is linked to a half-life enhancing polypeptide that is albumin, afamin, alpha-fetoprotein, vitamin D binding protein, human albumin or a variant thereof, an immunoglobulin or a variant thereof, or an Fc of an IgG.

11. The method of claim 10, wherein the half-life enhancing polypeptide is linked to the direct inhibitor of FXII via a linker.

12. The method of claim 11, wherein the linker is (a) cleavable; (b) cleavable by a coagulation protease of the intrinsic, extrinsic, or common coagulation pathway; and/or (c) cleavable by Factor XIIa.

13. The method of claim 10, wherein the half-life enhancing polypeptide is human albumin or a variant thereof.

14. The method of claim 1, wherein the multiple sclerosis is relapsing remitting multiple sclerosis or primary progressing multiple sclerosis.

Description

DESCRIPTION OF THE DRAWINGS

(1) FIG. 1 presents the amino acid sequence of infestin (SEQ ID NO: 1).

(2) FIG. 2 compares the amino acid sequences of infestin-4 (SEQ ID NO: 2), SPINK-1 (SEQ ID NO: 3) and three SPINK-1 variants (K1 (SEQ ID NO: 4), K2 (SEQ ID NO: 5), and K3 (SEQ ID NO: 6)). * denotes identical amino acids, and | denotes similar amino acids with regard to the Infestin-4 sequence. The underlined sequence of infestin-4 was used to replace 15 amino acids of SPINK-1 to generate K1. Variants K2 and K3 were generated by additional point mutations (amino acids underlined) on the K1 sequence.

(3) FIG. 3 presents the amino acid sequence of human albumin (SEQ ID NO: 19).

(4) FIG. 4A-D depict the EAE score of mice as a function of time. FIG. 4A presents FXII.sup./ mice compared to control mice (Con). FIG. 4B presents FXI.sup./ mice compared to control mice (Con). FIGS. 4C and 4D present scores for mice treated with the FXII inhibitor PCK compared to controls starting from the day of immunization (FIG. 4C) or from day 12 (FIG. 4D).

(5) FIG. 5A-5E summarize histologic and in vitro functional data. FIG. 5A depicts the number of inflammatory foci, FIG. 5B the demyelinated area/slice, and FIG. 5C the axon counts in control (left bar), PCK treated (middle bar), and FXII.sup./ mice (right bar). Examples of histologic comparisons between control (Con) and PCK-treated mice are presented for each bar graph. FIG. 5D presents proliferation of splenocytes in response to CD3/CD28 or MOG stimulation. FIG. 5E summarizes cytokine secretion in splenocytes from control (left bar), PCK treated (middle bar), and FXII.sup./ mice (right bar).

(6) FIG. 6A presents the EAE scores as a function of time for mice treated with the FXII inhibitor, rHA-Infestin-4. FIG. 6B compares the levels of the cytokine IL-17 in control (left bar) versus rHA-Infestin-4-treated (right bar) mice.

(7) FIG. 7 presents the paralysis score as a function of time for mice treated with an anti-Factor XII antibody (filled diamonds) or with an isotype control antibody (open squares).

(8) FIG. 8 presents the cytokine levels in the blood of anti-FXII treated and control mice for the cytokines GM-CSF, IFN, TNF and, IL-.

DETAILED DESCRIPTION

(9) The embodiments of the application pertain to methods comprising administering at least one Factor XII (FXII) inhibitor to a patient to prevent, treat, or otherwise ameliorate the effects of a neurological inflammatory disease.

(10) One advantage of the embodiments of the application is that FXII inhibitors may have an improved safety profile compared to other drugs, since they are expected to be well-tolerated. In addition, since FXII is involved in several physiological cascades, one or more of which may be involved in inflammatory demyelinating diseases such as MS, FXII inhibitors may have a better efficacy profile compared to single target therapies.

(11) I. Inflammatory Demyelinating Diseases

(12) One aspect the invention relates to methods of preventing, treating, or otherwise ameliorating the effects of an inflammatory demyelinating disease, comprising administering to a subject in need thereof at least one Factor XII (FXII) inhibitor, to thereby prevent, treat, or ameliorate the effects of the neurological inflammatory disease. Accordingly, the invention also provides pharmaceutical compositions comprising a Factor XII inhibitor and a pharmaceutically acceptable excipient or carrier for use in preventing, treating, or ameliorating the effects of an inflammatory demyelinating disease.

(13) As used here, the terms treat and treating do not require a complete elimination of symptoms, and these terms are not equivalent to cure or curing. Instead, treat and treating mean that at least one sign or symptom of the disease has been reduced, inhibited, lessened, or delayed. In some embodiments, the signs or symptoms are one or more of the primary or secondary endpoints described below. In certain embodiments, treat or treating can also include ameliorating the effects of the disease. In general, however, ameliorating the effects means that some aspect of the disease that reflects an impairment of the patient's function is improved. Functional assessments can be made using well-established criteria for the disease, including the use of the Kurtzke Expanded Disability Status Score (EDSS) (Kurtzke J F, Neuroepidemiol. 2008; 31:1-9) for multiple sclerosis (MS), as described below. Preventing, as used here, means either administration of therapy to a subject that is known to be at risk for developing an inflammatory demyelinating disease or, in those diseases that remit and then relapse, preventing can mean inhibiting relapse in a patient who is in remission. As noted below for MS, preventing also means that a patient that satisfies some, but not all, of the diagnostic criteria for MS but does not progress to overt disease fully meeting the diagnostic criteria.

(14) The terms neurological inflammatory disease and inflammatory demyelinating disease are used essentially interchangeably to refer to a condition in a human patient, or in an animal, in which there is inflammation of one or more areas of brain or spinal cord. The terms are not fully equivalent, however, and the skilled artisan will appreciate that a neurological inflammatory disease does not necessarily require demyelination, although demyelination often develops following the inflammation. Multiple sclerosis is one example of an inflammatory demyelinating disease in humans. In a variety of animals, including mice, rats, and monkeys, inflammatory demyelination can be induced experimentally by several different immunization strategies that are well-known and are accepted as models of human disease. (Reviewed in Krishnamoorthy & Wekerle, Eur. J. Immunol 2009; 39:2031-35.) Two different immunization strategies are presented in the Examples. The resulting induced disease, experimental autoimmune encephalomyelitis (EAE), is another example of an inflammatory demyelinating disease, albeit an experimental disease and accordingly confined to non-human subjects.

(15) In some embodiments, the inflammatory demyelinating disease is a disease of the central nervous system (CNS). Exemplary diseases include, but are not limited to, multiple sclerosis, idiopathic inflammatory demyelinating diseases, transverse myelitis, and neuromyelitis optica (Devic's disease).

(16) In some embodiments, the inflammatory demyelinating disease is a disease of the peripheral nervous system. Exemplary diseases include, but are not limited to, Guillain-Barr syndrome, chronic inflammatory demyelinating polyneuropathy, Miller Fisher syndrome, and anti-MAG peripheral neuropathy.

(17) In certain embodiments, the invention provides methods of preventing, treating, or ameliorating the effects of multiple sclerosis, comprising administering to a subject in need thereof a therapeutically effective amount of at least one Factor XII inhibitor, thereby preventing or treating multiple sclerosis or ameliorating the effects of multiple sclerosis. Accordingly, the invention also provides pharmaceutical compositions comprising a Factor XII inhibitor and a pharmaceutically acceptable excipient or carrier for use in preventing or treating multiple sclerosis, or for ameliorating the effects of multiple sclerosis.

(18) In those embodiments involving multiple sclerosis, subjects with MS can be diagnosed using the McDonald criteria, which rely on magnetic resonance imagining (MRI) coupled with the clinical presentation. (Polman et al., Ann Neurol 2011; 69:292-302.) Generally, a patient presenting with two or more attacks or with two or more objective clinical lesions is considered to have MS without need for additional clinical evidence. In patients with fewer attacks or fewer demonstrable lesions, diagnosis is based on objective demonstration of dissemination of lesions in space and/or time by clinical or clinical and diagnostic (MRI) findings. Clinical evidence of dissemination of lesions in space is demonstrated by one or more T2 lesions in at least two of four of the following areas of the central nervous system: periventricular, juxtacortical, infratentorial, or spinal cord. Dissemination of lesions in time is demonstrated by either a new T2 and/or gadolinium-enhancing lesion on follow-up MRI or the simultaneous presence of asymptomatic gadolinium-enhancing and non-enhancing lesions at any time. Primary progressive MS is diagnosed in subjects with one year of disease progression (including retrospective), plus two or more of: A) evidence of dissemination in space based on one or more T2 lesions in the brain in at least one area characteristic of MS (periventricular, juxtacortical, or infratentorial), or B) evidence for dissemination in space in the spinal cord based on greater that two T2 lesions, and C) the presence of oligoclonal bands and/or elevated IgG index in the cerebrospinal fluid. (Polman et al., Ann Neurol 2011; 69:292-302.)

(19) In some embodiments, the patient has, or has had, at least one clinical attack or at least one objective clinical lesion, but has not presented with a sufficient number of clinical attacks and objective clinical lesions to establish a diagnosis of multiple sclerosis using the McDonald criteria. Such a patient is a patient at risk for multiple sclerosis and administering a FXII inhibitor to a patient that is at risk for MS can be used to prevent MS in the sense that the subject does not progress to the point that a diagnosis of MS can be made under the McDonald criteria. Accordingly, in one embodiment there is provided a method of preventing multiple sclerosis comprising administering at least one FXII inhibitor to a subject at risk for multiple sclerosis, thereby preventing multiple sclerosis. Likewise, the invention also provides pharmaceutical compositions comprising a Factor XII inhibitor and a pharmaceutically acceptable excipient or carrier for use in preventing multiple sclerosis in a subject at risk for multiple sclerosis.

(20) In those embodiments involving a subject that has been diagnosed with multiple sclerosis, the subjects may be further categorized based on the disease course into subjects with (1) relapsing remitting, (2) secondary progressive, (3) primary progressive, and (4) progressive relapsing MS.

(21) Thus, the invention provides in certain embodiments methods of preventing, treating, or ameliorating the effects of multiple sclerosis, comprising administering to a patient diagnosed with relapsing remitting MS a therapeutically effective amount of at least one Factor XII inhibitor, thereby preventing or treating the relapsing remitting MS or ameliorating the effects of the relapsing remitting MS. In addition, the invention provides pharmaceutical compositions comprising a Factor XII inhibitor and a pharmaceutically acceptable excipient or carrier for use in preventing, treating, or ameliorating the effects of relapsing remitting multiple sclerosis.

(22) In additional embodiments, the invention provides methods of preventing, treating or ameliorating the effects of multiple sclerosis, comprising administering to a patient diagnosed with secondary progressive MS a therapeutically effective amount of at least one Factor XII inhibitor, thereby preventing or treating the secondary progressive MS or ameliorating the effects of the secondary progressive MS. In addition, the invention provides pharmaceutical compositions comprising a Factor XII inhibitor and a pharmaceutically acceptable excipient or carrier for use in preventing, treating, or ameliorating the effects of secondary progressive multiple sclerosis.

(23) In still other embodiments, the invention provides methods of preventing, treating, or ameliorating the effects of multiple sclerosis, comprising administering to a patient diagnosed with primary progressive MS a therapeutically effective amount of at least one Factor XII inhibitor, thereby preventing or treating the primary progressive MS or ameliorating the effects of the primary progressive MS. In addition, the invention provides pharmaceutical compositions comprising a Factor XII inhibitor and a pharmaceutically acceptable excipient or carrier for use in preventing, treating, or ameliorating the effects of primary progressive multiple sclerosis.

(24) In further embodiments, the invention provides methods of preventing, treating, or ameliorating the effects of multiple sclerosis, comprising administering to a patient diagnosed with progressive relapsing MS a therapeutically effective amount of at least one Factor XII inhibitor, thereby preventing or treating the progressive relapsing MS or ameliorating the effects of the progressive relapsing MS. In addition, the invention provides pharmaceutical compositions comprising a Factor XII inhibitor and a pharmaceutically acceptable excipient or carrier for use in preventing, treating, or ameliorating the effects of progressive relapsing multiple sclerosis.

(25) One example of ameliorating the effects of or treating any of the types of MS is a reduction in the disability status of the subject or an increase in the time to disability progression. The disability status can be evaluated (or scored) using the Kurtzke Expanded Disability Status Score (EDSS). (Kurtzke J F, Neuroepidemiol 2008; 31:1-9.) For example, an inhibitor reduces the disability score if it reduces the time to onset of sustained increase in disability, defined as an increase of at least 1 point on the EDSS from baseline EDSS1.0 that was sustained for 12 weeks, or at least a 1.5 point increase on the EDSS from baseline EDSS=0 that was sustained for 12 weeks. Other examples of ameliorating the effects of or treating any of the types of MS can be measured by MRI: for example, a decrease in the median number of new or newly enlarging T2-hyperintense lesions over a defined period, e.g., 12, 24, 36, or 48 months; or a decrease in the number of T1 gadolinium-enhancing lesions over a defined period, e.g., 12, 24, 36, or 48 months.

(26) In general, criteria that can be used to show that a FXII inhibitor according to the invention is treating MS or ameliorating the effects of MS include the following outcomes, either alone or in any subcombination: a decrease in extent of number of contrast-enhancing MRI lesions; a decrease in the Sustained Accumulation of Disability (SAD) rating; a decrease in the occurrence of relapse; an increase in the time to relapse; an increase in the proportion of patients who are relapse-free at, for example, 1, 2, 3, or more years after initial treatment; a decrease in the rate of cerebral atrophy on brain scan; a decrease in MRI T2 lesion volume; change in cerebrospinal fluid (CSF) osteopontin levels; improvement in expanded disability status scale (EDSS); improvement in Timed 25-foot Walk (T25FW) test; improvement in Multiple Sclerosis Impairment Score (MSIS); improvement in Multiple Sclerosis Functional Composite Short Form 36 Health Survey (SF36); an improvement in the levels of neurofilament heavy chain in the cerebrospinal fluid; an improvement in the levels of myelin basic protein in cerebrospinal fluid; an improvement in normalized brain volume (NBV), grey matter volume (GMV), and/or white matter volume (WMV); an improvement in Magnetization transfer ratio (MTR) in whole brain, lesions, normal-appearing grey matter (NAGM), or normal-appearing white matter (NAWM); an improvement in Diffusion transfer imaging (DTI) in FA and ADC in lesions, GM and NAWM; an improvement in CSF cell count; an improvement in in IgG-index; an improvement in CSF nitrogen oxide metabolites; an improvement in the CSF-serum albumin concentration quotient; an improvement in CSF CXCL13 levels; an improvement in Matrix metalloproteinase-9 (MMP-9) levels; a decrease in new Gadolinium-enhancing lesions (GdEL); a decrease in volume of lesions on T2-weighted MRI images, a decrease in the number of new or enlarging lesions on T2-weighted MRI images; any combination of these criteria; or any subcombination of these criteria. For any of the criteria, the criteria can be judged relative to the time at which treatment began.

(27) In those embodiments involving a relapsing form of MS, a FXII inhibitor according to the invention also treats or ameliorates MS if it reduces the annualized relapse rate or increases the percentage of patients remaining relapse-free for a defined period, such as, 6 months, 12 months, 18 months, 24 months, 36 months, 48 months, or 60 months (or for any time in between).

(28) The EAE model can be used to determine whether a particular FXII inhibitor will prevent, treat, or ameliorate multiple sclerosis. EAE models are accepted animal models of MS and have been used to develop drugs approved by the FDA for treatment of multiple sclerosis. (E.g., Stve et al., Arch. Neurol. 2010; 67:1307-15; Yednock et al., Nature 1992.) Accordingly, if a particular FXII inhibitor shows activity in one or more EAE model, such as those described in the examples, the skilled artisan would expect that a FXII inhibitor also shows activity in preventing, treating, or ameliorating the effects of multiple sclerosis. It is worth noting, however, that inactivity in an EAE model does not preclude activity in multiple sclerosis. For example, one early treatment for MS, interferon beta, was not very effective in the EAE model. (Stve et al., Arch. Neurol. 2010; 67:1307-15.)

(29) II. FXII Inhibitors

(30) The terms Factor XII and FXII each refer to either or both of Factor XII and activated Factor XII (FXIIa). Thus FXII inhibitor includes inhibitors of either or both of FXII and FXIIa. Further, anti-FXII antibodies include antibodies that bind to and inhibit either or both of FXII and FXIIa. The term FXII inhibitor is also meant to include an inhibitor of FXII that is linked to a half-life extending polypeptide, which in some embodiments includes a linker.

(31) In some embodiments, the FXII inhibitor is a direct inhibitor of FXII. The term direct inhibitor means an inhibitor that acts via contact (e.g., binding) with FXII (or FXIIa). In contrast, an indirect inhibitor may act without contacting FXII (or FXIIa) protein; for example, an antisense RNA can be used to decrease expression of the FXII gene, but it does not interact directly with FXII protein. Thus, an indirect inhibitor, in contrast to a direct inhibitor, acts upstream or downstream from the FXII protein. Some examples of direct inhibitors are presented below. The FXII inhibitors are generally non-endogenous inhibitors; that is, they are not inhibitors that occur naturally in the body of a subject with inflammatory demyelinating disease.

(32) A. Infestin-4

(33) In one embodiment, the application provides a FXII inhibitor comprising infestin domain 4, infestin-4. Recently, infestin-4 was reported to be a novel inhibitor of activated FXII (FXIIa). Infestins are a class of serine protease inhibitors derived from the midgut of the hematophagous insect, Triatoma infestans, a major vector for the parasite Trypanosoma cruzi, known to cause Chagas disease. (Campos I T N et al. 32 Insect Biochem. Mol. Bio. 991-997, 2002; Campos I T N et al. 577 FEBS Lett. 512-516, 2004.) This insect uses these inhibitors to prevent coagulation of ingested blood. The full length precursor polypeptide sequence of infestin is provided in FIG. 1 (SEQ ID NO: 1). The infestin gene encodes 4 domains that result in proteins that can inhibit different factors in the coagulation pathway. In particular, domain 4 encodes a protein (infestin-4) that is a strong inhibitor of FXIIa. Infestin-4 has been administered in mice without bleeding complications. (WO 2008/098720; Hagedorn et al., Circulation 2010; 121:1510-17.)

(34) Accordingly, in one embodiment, there is provided a FXII inhibitor that comprises a variant of infestin-4. In another embodiment, FXII inhibitors comprise infestin domain 4, and optionally infestin domains 1, 2, and/or 3. These proteins are known to be potent inhibitors of FXII. (See WO 2008/098720; also see Campos I T N et al. 577 FEBS Lett. 512-516, 2004.) In one embodiment, the FXII inhibitor is a (His).sub.6-tagged infestin-4 construct. In another embodiment, the FXII inhibitor is a fusion protein consisting of albumin-linker-infestin-4. In one embodiment, the albumin-linker-infestin-4 is the rHA-Infestin-4 protein described in Hagedorn et al. Circulation 2010; 121:1510-17. Examples of infestin inhibitors of FXII are described in WO 2008/098720 and Hagedorn et al. Circulation 2010; 121:1510-17.

(35) As used here, the term variant of infestin refers to a polypeptide with an amino acid mutation, wherein the mutation is defined as a substitution, a deletion, or an addition, to the wild type infestin-4 sequence, wherein such changes do not alter the functional ability of the polypeptide to inhibit FXII. The term variant includes fragments of the wild type or mutated infestin-4 sequence. Further examples of such variants are provided below.

(36) In one embodiment, an infestin-4 variant comprises the amino acid sequence VRNPCACFRNYV (residues 2-13 of SEQ ID NO: 2) from the amino terminal of the wild type infestin-4 sequence (see underlined sequence in FIG. 2), and at least one and up to five amino acid mutations outside the N-terminal amino acids that result in differences from the wild type infestin-4 sequence, and/or six conserved cysteine residues, and/or homology of at least 70% to the wild type infestin-4 sequence. Therefore in some embodiments, a variant of infestin-4 comprises the conserved N-terminal region of amino acids 2-13 of the wild type infestin-4 sequence, and at least one and up to five amino acid mutations outside these conserved N-terminal amino acids that result in differences from the wild type infestin-4 sequence. As used here, the term outside the N-terminal amino acids of an infestin variant refers to any amino acid along the polypeptide chain of the variant other than the contiguous stretch of amino acids that comprises the sequence VRNPCACFRNYV, i.e., amino acids 2-13 from SEQ ID NO: 2. In another embodiment, an infestin-4 variant comprises six conserved cysteine residues and has homology of at least 70% to the wild type infestin-4 sequence. In one embodiment, the six conserved cysteine residues are amino acids at positions 6, 8, 16, 27, 31, and 48 of the wild type infestin-4 sequence, SEQ ID NO: 2 (see FIG. 2). In one embodiment, the variant comprises the final conserved cysteine at position 48. In other embodiments, the exact positions of the cysteine residues, and relative positions to each other, may change from positions 6, 8, 16, 27, 31, and 48 of the wild type infestin-4 sequence due to insertions or deletions in the infestin-4 variant. Nevertheless, in these embodiments, an infestin-4 variant comprises all six cysteines and may share 70%, 75%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%, or any percentage in between homology to the wild type infestin-4 sequence.

(37) In one embodiment, the FXII inhibitor comprises a variant of the wild type infestin-4 polypeptide sequence (SEQ ID NO: 2), wherein the variant comprises the N-terminal amino acids 2-13 of SEQ ID NO: 2; at least one and up to five amino acid mutations outside said N-terminal amino acids that result in differences from the wild type Infestin-4 sequence; six conserved cysteine residues; and homology of at least 70% to the wild type Infestin-4 sequence.

(38) In infestin-4 variant embodiments, a variant of infestin-4 is characterized in that it inhibits FXII. The functional activity of inhibiting FXII may be assessed for example, through in vitro and/or in vivo characterization, including direct assays to test inhibition of FXII enzyme activity, prolonged coagulation time, i.e. activated partial thromboplastin time (aPTT; a clinical clotting test that addresses the intrinsic pathway of coagulation), or in vivo methods that evaluate coagulation.

(39) Further examples of infestin-4 variants are SPINK-1 mutants, which are described below.

(40) B. SPINK-1 Mutants

(41) One embodiment involves FXII inhibitors for therapeutic use in humans. A human protein with high similarity to infestin-4 may be employed. For example, the human protein with the highest similarity to Infestin-4 is SPINK-1, a Kazal-type serine protease inhibitor expressed in the pancreas (also known as pancreatic secretory trypsin inhibitor, PSTI). The Kazal-type serine protease inhibitor family is one of numerous families of serine protease inhibitors. Many proteins from different species have been described. (Laskowski M and Kato I, 49 Ann. Rev. Biochem. 593-626, 1980.)

(42) Based on the wild type SPINK-1 sequence (SEQ ID NO: 3) different variants may be generated in order to increase homology of the SPINK-1 sequence to Infestin-4. In one embodiment, SPINK-1 is mutated to comprise the N-terminal amino acids 2-13 of SEQ ID NO: 2, which is thought to be important for FXII inhibitory function. The polypeptide sequence, referred to as K1, is given in SEQ ID NO: 4 and FIG. 2.

(43) In one embodiment, a variant of the mutated SPINK-1 also comprises N-terminal amino acids 2-13 of the wild type Infestin-4 sequence (SEQ ID NO: 2), and at least one and up to five amino acid mutations outside said N-terminal amino acids that result in differences from the wild type SPINK-1 sequence and which increase the homology of the variant to the wild type infestin-4 sequence. In another embodiment, a variant of mutated SPINK-1 comprises six conserved cysteine residues and has homology of at least 70% to the wild type SPINK-1 sequence. A mutation may be a substitution, a deletion, or an addition. As defined above, the term outside the N-terminal amino acids refers to any amino acid along the polypeptide chain of the variant other than the contiguous stretch of amino acids that is comprised of the sequence VRNPCACFRNYV, i.e., amino acids 2-13 of SEQ ID NO: 2. The term variant includes fragments of said mutated SPINK-1 sequence. In one embodiment, the six conserved cysteine residues may be amino acids at positions 9, 16, 24, 35, 38, and 56 of the wild type SPINK-1 sequence (SEQ ID NO: 3, see FIG. 2). In one embodiment, the variant comprises the final conserved cysteine. In another embodiment, the exact positions of the cysteines, and relative positions to each other, may change from positions 9, 16, 24, 35, 38, and 56 of the wild type SPINK-1 sequence due to insertions or deletions in the SPINK-1 variant. Nevertheless, in these embodiments, a SPINK-1 variant comprises all six cysteines. In embodiments, a SPINK-1 variant is also characterized in that it inhibits FXII.

(44) In one embodiment, the FXII inhibitor comprises a variant of SPINK-1 (SEQ ID NO: 3), wherein the SPINK-1 variant comprises the N-terminal amino acids 2-13 of SEQ ID NO: 2; at least one and up to five amino acid mutations outside said N-terminal amino acids that result in differences from the wild type SPINK-1 sequence and which increase the homology of the variant to the wild type infestin-4 sequence; six conserved cysteine residues; and homology of at least 70% to the wild type SPINK-1 sequence.

(45) Examples of SPINK-1 variants are given and are named K1, K2, and K3 (SEQ ID NOS: 4, 5 and 6, respectively). In SPINK-1 variants K2 and K3, further amino acid substitutions outside of the N-terminus were made relative to K1 in order to increase homology to infestin-4, wherein the variants are also characterized in that they inhibit FXII activity. See WO 2008/098720. FIG. 2 shows the amino acid sequence of these variants and the degree of changes to the SPINK-1 wild type sequence. In the case of the SPINK-1 variant K3, five amino acid substitutions increase homology to infestin-4. Thus in embodiments, a SPINK-1 variant may share 70%, 75%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% or any percentage in between homology with the wild type SPINK-1 sequence.

(46) C. Other FXII Inhibitors

(47) Other inhibitors of FXII, including inhibitors of both FXII and FXIIa, are described in WO2006/066878. Accordingly, in some embodiments the FXII inhibitor is antithrombin 111 (AT 111), angiotensin converting enzyme inhibitor, C1 inhibitor, aprotinin, alpha-1 protease inhibitor, antipain ([(S)-1-carboxy-2-phenylethyl]-carbamoyl-L-Arg-L-Val-Arginal), Z-Pro-proaldehyde-dimethyl acetate, DX88 (Dyax Inc., 300 Technology Square, Cambridge, Mass. 02139, USA; cited in: Williams A and Baird L G, 29 Transfus Apheresis Sci. 255-258, 2003), leupeptin, inhibitors of prolyl oligopeptidase such as Fmoc-Ala-Pyr-CN, corn-trypsin inhibitor, mutants of the bovine pancreatic trypsin inhibitor, ecotin, yellowfin sole anticoagulant protein, Cucurbita maxima trypsin inhibitor-V including Curcurbita maxima isoinhibitors, or Hamadarin (as disclosed by Isawa H et al., 277 J. Biol. Chem. 27651-27658, 2002).

(48) In still other embodiments, the FXII inhibitor is H-D-Pro-Phe-Arg-chloromethylketone (PCK). (Tans et al., Eur. J. Biochem. 1987; 164:637-42; Kleinschnitz et al., J Exp Med. 2006; 203:513-8.)

(49) In yet other embodiments, the FXII inhibitor is an analogue of Kunitz Protease Inhibitor domain of amyloid precursor protein as disclosed in U.S. Pat. No. 6,613,890 in columns 4 through 8.

(50) D. FXII Antibodies

(51) In other embodiments, the FXII inhibitor is an anti-FXII antibody that binds to FXII and inhibits FXII activation and/or activity. Anti-FXII antibodies have been described, for example in WO 2006/066878, and in Rayon et al., 1 Blood 4134-43, 1995. Other monoclonal antibodies (mAbs) to human Factor XII include the B7C9 mAb described by Pixley et al (J Biol Chem 1987; 262, 10140-45), a mAb described by Small et al (Blood 1985; 65:202-10); the mAbs F1 andF3 described by Nuijens et al (J. Biol. Chem. 1989; 264:12941-49); the B6F5, C6B7, and D2E10 mAbs against the light chain of FXII described in WO89/11865; a mAb that selectively binds FXIIa- over FXII described in WO90/08835; and the anti-FXII antibody OT-2 described in WO91/17258.

(52) Additional anti-Factor XII/FXIIa monoclonal antibodies and antigen-binding fragment thereof are described in U.S. provisional application No. 61/510,801, filed Jul. 22, 2011, which is incorporated herein by reference. Those antibodies have a more than 2 fold higher binding affinity to human Factor XIIa-beta than to human Factor XII and are capable of inhibiting the amidolytic activity of human Factor XIIa. In some embodiments, the antibody or antigen-binding fragment has one or more of the following features: (a) binds murine FXII/FXIIa; (b) comprises a heavy chain variable (VH) region which is more than 85% identical to the sequence of SEQ ID NO: 7; (c) comprises a light chain variable (vL) region which is more than 85% identical to the sequence of SEQ ID NO: 8; (d) comprises heavy chain CDR1 at least 80% identical to the sequence of SEQ ID NO: 9, and/or heavy chain CDR2 at least 60% identical with SEQ ID NO: 10, and/or heavy chain CDR3 at least 80% identical to the sequence of SEQ ID NO: 12; (e) comprises light chain CDR1 at least 50% identical with SEQ ID NO: 14, and/or light chain CDR2 of SEQ ID NO: 15, and/or light chain CDR3 with the sequence A-X.sub.1-W-X.sub.2-X.sub.3-X.sub.4-X.sub.5-R-X.sub.6-X.sub.7 wherein X.sub.1 can be A or S, X.sub.5 can be L or V, the other X.sub.ns can be any amino acid (SEQ ID NO: 17); (f) binds human Factor XIIa-beta with a K.sub.D of better than 10.sup.8M; (g) competes with infestin-4, for binding to human Factor XIIa-beta; or (h) is a human IgG or variant thereof, preferably human IgG4 or variant thereof.

(53) In other embodiments, the anti-FXII antibody is an IgG antibody that binds human FXII and comprises (a) a VH region comprising heavy chain CDR1 as set forth in SEQ ID NO: 9, heavy chain CDR2 as set forth in SEQ ID NO: 11, and heavy chain CDR3 as set forth in SEQ ID NO: 13; and/or (b) a VL region comprising light chain CDR1 as set forth in SEQ ID NO: 14, light chain CDR2 as set forth in SEQ ID NO: 15, and light chain CDR3 as set forth in SEQ ID NO: 17. A heavy chain CDR2 comprising SEQ ID NO: 11 comprises the sequence GIX.sub.1X.sub.2X.sub.3X.sub.4X.sub.5X.sub.6TVYADSVKG, wherein X.sub.1 is R, N or D, X.sub.2 is P, V, I, or M; X.sub.3 is S, P, or A; X.sub.4 is G, L, V, or T; X.sub.5 can be any amino acid, preferably X.sub.5 is G, Y, Q, K, R, N, or M; and X.sub.6 is T, G, or S. A heavy chain CDR3 comprising SEQ ID NO: 13 comprises the sequence ALPRSGYLX.sub.1X.sub.2X.sub.3X.sub.4YYYYALDV, wherein X.sub.1 is I, M or V; X.sub.2 is S or K; X.sub.3 is P, K, T, or H; and X.sub.4 is H, N, G, or Q. A light chain CDR3 comprising SEQ ID NO: 17 comprises the sequence AX.sub.1WX.sub.2X.sub.3X.sub.4X.sub.5RX.sub.6X.sub.7, wherein X.sub.1 is A or S; X.sub.2 is D, Y, E, T, W, E, or S; X.sub.3 is A, N, I, L, V, P, Q, or E; X.sub.4 is S, D, P, E, Q, or R; X.sub.5 is L or V; X.sub.6 is G, L, or K; and X.sub.7 is V, A, D, T, M, or G.

(54) In other embodiments, the anti-FXII antibody antigen-binding fragment is a fragment of an IgG antibody that binds human FXII and comprises (a) a VH region comprising heavy chain CDR1 as set forth in SEQ ID NO: 9, heavy chain CDR2 as set forth in SEQ ID NO: 10, and heavy chain CDR3 as set forth in SEQ ID NO: 12; and/or (b) a VL region comprising light chain CDR1 as set forth in SEQ ID NO: 14, light chain CDR2 as set forth in SEQ ID NO: 15, and light chain CDR3 as set forth in SEQ ID NO: 16.

(55) In one embodiment, the anti-FXII antibody or antigen-binding fragment thereof is the antibody 3F7 used in Example 3. Sequences of the variable regions and CDRs of 3F7 are presented in Table 1.

(56) TABLE-US-00001 TABLE1 Region Aminoacidsequence VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSKYI MQWVRQAPGKGLEWVSGIRPSGGTTVYADSVKG RFTISRDNSKNTLYLQMNSLRAEDTAVYYCARA LPRSGYLISPHYYYYALDVWGQGTTVTVSS (SEQIDNO:7) VL QSELTQPPSASGTPGQRVTISCSGSSSNIGRNY VYWYQQVPGTAPKLLIYSNNQRPSGVPDRFSGS KSGTSASLVISGLRSEDEADYYCAAWDASLRGV FGGGTKLTVLG(SEQIDNO:8) HCDR1 KYIMQ(SEQIDNO:9) (Kabat31-35) HCDR2 GIRPSGGTTVYADSVKG(SEQIDNO:10) (Kabat50-65) HCDR3 ALPRSGYLISPHYYYYALDV (Kabat95-102) (SEQIDNO:12) LCDR1 SGSSSNIGRNYVY(SEQIDNO:14) (Kabat24-34) LCDR2 SNNQRPS(SEQIDNO:15) (Kabat50-56) LCDR3 AAWDASLRGV(SEQIDNO:16) (Kabat89-97)

(57) In still other embodiments, the anti-FXII antibody or antigen binding fragment is chosen from the affinity matured (relative to 3F7) antibodies VR115, VR112, VR24, VR110, VR119.

(58) TABLE-US-00002 mAb HCDR1 HCDR2 HCDR3 LCDR1 LCDR2 LCDR3 3F7 9 10 12 14 15 16 VR119 9 11 12 14 15 16 VR112 9 11 12 14 15 16 VR115 9 11 12 14 15 16 VR24 9 10 12 18 15 16 VR110 9 11 12 14 15 16

(59) As noted above SEQ ID NO: 11 is a degenerate sequence. VR119 comprises SEQ ID NO: 11 wherein X.sub.1 is N, X.sub.2 is V, X.sub.3 is P; X.sub.4 is L, X.sub.5 Y; and X.sub.6 is G. VR112 comprises SEQ ID NO: 11 wherein X.sub.1 is N, X.sub.2 is V, X.sub.3 is P, X.sub.4 is V, X.sub.5 is Q, and X.sub.6 is G. VR115 comprises SEQ ID NO: 11 wherein X.sub.1 is D, X.sub.2 is I, X.sub.3 is P, X.sub.4 is T, X.sub.5 is K, and X.sub.6 is G. VR110 comprises SEQ ID NO: 11 wherein X.sub.1 is D, X.sub.2 is M, X.sub.3 is P, X.sub.4 is T, X.sub.5 is K, and X.sub.6 is G. VR24 comprises a unique LCDR1: SGSSEMTVHHYVY (SEQ ID NO: 18).

(60) In embodiments involving antibody CDRs, CDR's are defined according to the KABAT numbering system. (Kabat E A, Wu T T, Perry H M, Gottesman K S, Foeller C (1991) Sequences of proteins of immunological interest, 5th edn. U.S. Department of Health and Human services, NIH, Bethesda, Md.)

(61) In some embodiments, the antibody or antigen-binding fragment thereof is an anti-Factor XII/FXIIa monoclonal antibody or antigen-binding fragment thereof that inhibits Factor XIIa-alpha by more than 40%, more than 50%, or more than 60%, when used at a molar ratio of FXIIa-alpha to antibody of 1:0.2. In some embodiments, the antibody or antigen binding fragment thereof inhibits Factor XIIa-alpha by more than 80%, more than 85%, or more than 90%, at a molar ratio of FXIIa-alpha to antibody of 1:0.5. In one embodiment, the antibody achieves complete inhibition of FXIIa-alpha at a molar ratio of 1:0.5. In one embodiments, the FXIIa-alpha is human Factor XIIa-alpha. In one embodiment, the antibody or antigen binding fragment thereof has an affinity for human FXIIa that is at least comparable to antibody 3F7.

(62) As discussed above, an anti-FXII antibody includes antibodies that bind to and inhibit either or both of FXII and FXIIa. In one embodiment, the antibody may be in the form of a full length Ig, Fab, F(ab).sub.2, Fv, scFv, or other form or variant thereof. The antibody may be monoclonal or polyclonal. The antibody may be characterized in that the isotype is IgM, IgD, IgA, IgG, or IgE, or any subclass thereof, such as IgG.sub.1, or variants thereof. The antibody may be from a mammalian species, including, but not limited to human, mouse, rat, rabbit, goat, hamster, or monkey. The antibody may be humanized or CDR-grafted. The antibody maybe mutated or modified to alter immunogenicity, half-life, or to impart other advantageous properties associated with a therapeutic antibody. In one embodiment, the antibody is an anti-FXII antibody that binds to an epitope on the heavy chain or light chain of FXII (wherein, FXII includes FXII and FXIIa), such as a neutralizing epitope. The antibody may be high affinity and/or high avidity for binding to FXII. The antibody may be conjugated to a polypeptide, nucleic acid or small molecule.

(63) In another embodiment, the FXII inhibitor is a protein, peptide, nucleic acid, or small molecule. The term small molecule refers to a low molecular weight compound. A small molecule may be for example less than 1000 daltons, allowing diffusion across cell membranes. A small molecule may be characterized in that it binds with high affinity to FXII. A preferred small molecule is one which can be absorbed from the GI tract.

(64) E. FXII Inhibitors Linked to Half-Life Enhancing Polypeptides

(65) Another aspect of the application provides FXII inhibitors linked to a half-life enhancing polypeptide (HLEP). In one embodiment, FXII inhibitors are small proteins. Therefore a rapid renal clearance as published for other small proteins can be expected. (Werle M and Bernkop-Schnurch A, Amino Acids 2006; 30:351-367.) One way to address a short plasma half-life of a polypeptidic compound is to inject it repeatedly or via continuous infusion. Another approach is to increase the intrinsic plasma half-life of the polypeptide itself. For example, in one embodiment, FXII inhibitors are linked to half-life extending proteins.

(66) A half-life enhancing polypeptide increases the half-life of the FXII inhibitor in vivo in a patient or in an animal. For example, albumin and immunoglobulins and their fragments or derivatives have been described as half-life enhancing polypeptides (HLEPs). Ballance et al. (WO 2001/79271) described fusion polypeptides of a multitude of different therapeutic polypeptides which, when fused to human serum albumin, are predicted to have an increased functional half-life in vivo and extended shelf-life.

(67) The terms albumin and serum albumin encompass human albumin (HA) and variants thereof, the full mature form of which is given (SEQ ID NO: 19), as well as albumin from other species and variants thereof. As used herein, albumin refers to an albumin polypeptide or amino acid sequence, or an albumin variant, having one or more functional activities (e.g. biological activities) of albumin. As used herein, albumin is capable of stabilizing or prolonging the therapeutic activity of a FXII inhibitor. The albumin may be derived from any vertebrate, especially any mammal, for example human, monkey, cow, sheep, or pig. Non-mammalian albumins include, but are not limited to, albumin from hen and salmon. The albumin portion of the albumin-linked polypeptide may be from a different animal than the therapeutic polypeptide portion. See WO 2008/098720 for examples of albumin fusion proteins.

(68) In one embodiment, an albumin variant is at least 10, 20, 40, or at least 70 amino acids long or may include 15, 20, 25, 30, 50 or more contiguous amino acids from the human albumin (HA) sequence (e.g., the sequence set forth in FIG. 3, SEQ ID NO: 19 or may include part or all of specific domains of HA. An albumin variant may include an amino acid substitution, deletion, or addition, either conservative or non-conservative substitution, wherein such changes do not substantially alter the active site, or active domain, which confers the therapeutic activities of the half-life enhancing polypeptides. These variants may share 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% or any percentage in between homology.

(69) In one embodiment, the albumin variant includes fragments and may consist of or alternatively comprise at least one whole domain of albumin or fragments of said domains, for example domains 1 (amino acids 1-194 of SEQ ID NO: 19), 2 (amino acids 195-387 of SEQ ID NO: 19), 3 (amino acids 388-585 of SEQ ID NO 19), 1+2 (1-387 of SEQ ID NO: 19), 2+3 (195-585 of SEQ ID NO: 19) or 1+3 (amino acids 1-194 of SEQ ID NO: 19+amino acids 388-585 of SEQ ID NO: 19). Each domain is itself made up of two homologous subdomains namely residues 1-105, 120-194, 195-291, 316-387, 388-491 and 512-585, of SEQ ID NO: 19, with flexible inter-subdomain linker regions comprising residues Lys106 to Glu119, Glu292 to V1315 and Glu492 to A1511.

(70) In another embodiment, other proteins that are structurally or evolutionarily related to albumin may be used as HLEPs, including, but not limited to alpha-fetoprotein (WO 2005/024044; Beattie and Dugaiczyk, 20 Gene 415-422, 1982), afamin (Lichenstein et al. 269 J. Biol. Chem. 18149-18154, 1994), and vitamin D binding protein (Cooke and David, 76 J. Clin. Invest. 2420-2424, 1985). Their genes represent a multigene cluster with structural and functional similarities mapping to the same chromosomal region in humans, mice, and rats. The structural similarity of the albumin family members suggests that they can be used as HLEPs. For example, alpha-fetoprotein has been claimed to extend the half-life of an attached therapeutic polypeptide in vivo (WO 2005/024044). Such proteins, or variants thereof, that are capable of stabilizing or prolonging therapeutic activity may be used, and may be derived from any vertebrate, especially any mammal, for example human, monkey, cow, sheep, or pig, or non-mammal including but not limited to, hen or salmon. (See WO 2008/098720.) Such variants may be of 10 or more amino acids in length or may include about 15, 20, 25, 30, 50 or more contiguous amino acids of the respective protein sequence or may include part or all of specific domains of the respective proteins. Albumin family member fusion proteins may include naturally occurring polymorphic variants.

(71) In one embodiment, mono- or poly- (e.g., 2-4) polyethylene glycol (PEG) moieties may be used to extend half-lives. Pegylation may be carried out by any of the pegylation reactions available. Methods for preparing a pegylated protein product will generally include (a) reacting a polypeptide with polyethylene glycol (such as a reactive ester or aldehyde derivative of PEG) under conditions whereby the protein becomes attached to one or more PEG groups; and (b) obtaining the reaction product(s). In general, the optimal reaction conditions will be determined case by case based on known parameters and the desired result. There are a number of PEG attachment methods known in the art. See, for example, EP 0 401 384; Malik et al., Exp. Hematol., 20:1028-1035 (1992); Francis, Focus on Growth Factors, 3(2):4-10 (1992); EP 0 154 316; EP 0 401 384; WO 92/16221; WO 95/34326; U.S. Pat. No. 5,252,714.

(72) In another embodiment, an immunoglobulin (Ig), or variants thereof, may be used as an HELP, wherein a variant includes fragments. In one embodiment, the Fc domain or portions of the immunoglobulin constant region are used. The constant region may be that of an IgM, IgG, IgD, IgA, or IgE immunoglobulin. The therapeutic polypeptide portion is connected to the Ig via the hinge region of the antibody or a peptide linker, which may be cleavable. Several patents and patent applications describe the fusion of therapeutic proteins to immunoglobulin constant regions to extend the therapeutic protein's half-life in vivo (US 2004/0087778, WO 2005/001025, WO 2005/063808, WO 2003/076567, WO 2005/000892, WO 2004/101740, U.S. Pat. No. 6,403,077). Therefore, another embodiment is to use such immunoglobulin sequences, for example, Fc fragments of immunoglobulins and variants thereof, as HLEPs. Inhibitors of FXII may be fused to Fc domains or at least portions of immunoglobulin constant regions as HLEPs and may be produced as recombinant molecules in prokaryotic or eukaryotic host cells, such as bacteria, yeast, plant, animal (including insect) or human cell lines or in transgenic animals (WO 2008/098720).

(73) An example of one SPINK mutant Fc fusion protein, the SPINK-K2-Fc fusion protein, is described in WO2008/098720.

(74) F. Linkers

(75) In one embodiment, an intervening peptidic linker may be introduced between the therapeutic polypeptide and the HLEP. In one embodiment, a cleavable linker is introduced, particularly if the HLEP interferes with the therapeutic polypeptide's specific activity, e.g. by steric hindrance. In certain embodiments, the linker is cleaved by enzymes such as coagulation proteases of the intrinsic, extrinsic, or common coagulation pathway. Coagulation proteases of the intrinsic pathway are proteases in the contact activation pathway, including, for example, FXIIa, FXIa, or FIXa. In one embodiment, the linker is cleaved by FXIIa. Proteases of the extrinsic pathway include proteases in the tissue factor pathway, for example, FVIIa. Proteases of the common pathway include proteases involved in the conversion of fibrinogen to fibrin, for example, FXa, FIIa, and FXIIIa.

(76) G. Therapeutic Formulation and Administration

(77) The FXII inhibitor or variant thereof may have a purity greater than 80%, or greater than 95%, 96%, 97%, 98%, or 99% purity. In one embodiment, the variant may have a pharmaceutically pure state that is greater than 99.9% pure with respect to contaminating macromolecules, such as other proteins and nucleic acids, and free of infectious and pyrogenic agents.

(78) The purified FXII inhibitor may be dissolved in conventional physiologically compatible aqueous buffer solutions to which there may be added, optionally, pharmaceutical excipients to provide pharmaceutical preparations for preventing, treating, or ameliorating the effects of inflammatory demyelinating disease in a patient. Such pharmaceutical carriers and excipients as well as suitable pharmaceutical formulations are well known in the art. See for example Kibbe et al. Handbook of Pharmaceutical Excipients, (3.sup.rd ed., Pharmaceutical Press), 2000. The pharmaceutical composition may be formulated in lyophilized or stable soluble form. The polypeptide may be lyophilized by a variety of procedures known in the art. Lyophilized formulations are reconstituted prior to use by the addition of one or more pharmaceutically acceptable diluents such as sterile water for injection or sterile physiological saline solution.

(79) Formulations of the FXII inhibitor are delivered to the patient by any pharmaceutically suitable means of administration. Various delivery systems are known and can be used to administer the composition by any convenient route. The compositions may be administered systemically, such as parenterally. The term parenteral as used here includes intravenous, subcutaneous, intramuscular, intra-arterial and intra-tracheal injection; as well as instillation, spray application, and infusion techniques. Parenteral formulations may be administered intravenously or subcutaneously, either in bolus form or as a constant infusion, according to known procedures. Preferred liquid carriers, which are well known for parenteral use, include sterile water, saline, aqueous dextrose, sugar solutions, ethanol, glycols, and oils. For systemic use, the therapeutic proteins may be formulated for an intravenous line or an arterial line. The formulations may be administered continuously by infusion or by bolus injection.

(80) In some embodiments, the formulations are administered by intrathecal injection or by intracranial injection, so that direct access is gained to the spinal cord and brain. In these embodiments, the formulation may be specially formulated; for example, the formulation may lack preservatives.

(81) In some embodiments, the formulation is administered via intranasal administration. Intranasal delivery has been reported to enable the direct entry of viruses and macromolecules into the cerebrospinal fluid (CSF) or CNS. Mathison et al. J. Drug Target 1998; 5:415-41; Chou et al. Biopharm Drug Dispos. 1997; 18:335-46; Draghia et al., Gene Ther. 1995; 2(6):418-235. In one embodiment, a viral vector, such as an adenovirus vector, comprising a gene encoding any of the FXII inhibitors that are proteins may be delivered via olfactory receptor neurons to obtain expression of the encoded protein in the brain. Draghia et al., Gene Ther. 1995; 2(6):418-23.

(82) Tablets and capsules for oral administration may contain conventional excipients such as binding agents, fillers, lubricants, or wetting agents, etc. Oral liquid preparations may be in the form of aqueous or oily suspensions, solutions, emulsions, syrups, elixirs or the like, or may be presented as a dry product for reconstitution with water or other suitable vehicle for use. Such liquid preparations may contain conventional additives, such as suspending agents, emulsifying agents, non-aqueous vehicles, and preservatives. Some formulations encompass slow release systems, such as a patch.

(83) The dose of the FXII inhibitor may depend on many factors such as, e.g., the indication, formulation, or mode of administration, and may be determined in preclinical and clinical trials for each respective indication. For example, in one embodiment, the dose of FXII inhibitor is 0.1 mg/kg, 1 mg/kg, 50 mg/kg, 100 mg/kg, 200 mg/kg, 500 mg/kg, 1000 mg/kg, or any dose in between, or from 0.1-1000 mg/kg, or 1-1000 mg/kg, or 1-500 mg/kg, or 50-500 mg/kg, 50-200 mg/kg, or 100-200 mg/kg, or any dose range in between.

(84) In those embodiments involving a therapeutically effective dose of an anti-FXII antibody or antigen binding fragment, a therapeutically effective dose is a dose that brings about a positive therapeutic effect in the patient or subject requiring the treatment. A therapeutically effective dose is generally in the range of about 0.01 to 100 mg/kg, from about 0.01 to 50 mg/kg, from about 0.1 to 30 mg/kg, from about 0.1 to 10 mg/kg, from about 0.1 to 5 mg/kg, from about 0.1 to 2 mg/kg or from about 0.1 to 1 mg/kg, or any dose range in between, or one of the doses for a FXII inhibitor presented above or in the examples.

(85) The treatment may comprise giving a single dose or multiple doses. If multiple doses are required, they may be administered daily, every other day, weekly, biweekly, monthly, or bimonthly or as required. A depository may also be used that slowly and continuously releases the antibody or antigen binding fragment thereof. A therapeutically effective dose may be a dose that inhibits FXIIa in the subject by at least 50%, preferably by at least 60%, 70%, 80%, 90%, more preferably by at least 95%, 99% or even 100% (or by any percentage in between).

(86) The FXII inhibitor may be administered alone or in conjunction with other therapeutic agents. These agents may be co-formulated, or may be administered as separate formulations either concurrently or separately and via the same route of administration or different routes of administration. The schedule of administration or dose of a FXII inhibitor may also vary between individual patients with the same indication or different indications depending on factors such as other medical conditions or therapies.

(87) The embodiments are further illustrated by the following examples which should not be construed as limiting. Other embodiments will be apparent to those skilled in the art from consideration of the specification and practice of the embodiments disclosed. The contents of all references, patents, and published patent applications cited throughout this application are hereby incorporated by reference.

EXAMPLES

Example 1: The Plasmatic Blood Coagulation System as an Innovative Target in Multiple Sclerosis

(88) Preliminary studies suggest that primary and secondary hemostasis are involved in the inflammatory neurodegeneration in MS. For example, it has recently been demonstrated in the EAE animal model that STIM1 and STIM2, which had already been identified as key molecules in C2.sup.+-dependent platelet activation, represent important pathophysiological determinants of the inflammatory reaction and neurodegeneration. (Schuhmann et al., J. Immunol. 2010; 184:1536-42.) Furthermore, deposits of fibrinogen and fibrin are found in both the central vessels and the brain parenchyma of MS patients. (Sobel & Mitchell, Am. J. Pathol. 1989; 135:161-68; Claudio et al., Acta Neuropathol 1995; 90:228-38; Marik et al., Brain 2007; 130:2800-15.) Fibrin is the end product of so-called plasmatic blood coagulation system, which in turn is made up of the extrinsic and intrinsic systems. Coagulation Factor XII (FXII) is the starting point of the intrinsic blood coagulation cascade, which initially leads to activation of FXI. At the same time, it activates the proinflammatory contact (kinin) system, the end point of which is the formation of bradykinin.

(89) Our work demonstrated that the bradykinin receptor B1R is an important regulator of inflammatory cell invasion in an EAE model. (Gbel et al., J. Autoimmun 2011:36:106-14.) B1R deficient mice experienced less severe EAE. Similarly, wildtype mice treated with a selective antagonist of B1R also experienced a lower disease maximum compared to untreated mice. In contrast, blockade of the bradykinin receptor B2R by disruption of the B2R gene did not alter the EAE disease course. Interestingly, B2R mediates the majority of effects of bradykinin, although both B1R and B2R mediate the classical inflammatory process after tissue injury. Further, the mechanism leading to bradykinin activity in vivo is unclear since bradykinin can be activated by at least two pathways: the intrinsic coagulation pathway and another pathway that must be FXII independent since it occurs even in FXII knockout mice. (Schmaier A H, Int. Immunopharmacol. 2008; 8:161-65.)

(90) To test whether FXII also contributes to EAE, EAE was induced by immunization of 10-12 weeks old female C57Bl/6, FXII- or FXI-deficient mice with 200 g MOG.sub.35-55. The C57Bl/6 MOG.sub.35-55 mouse model is commonly used for pre-clinical validation of therapeutic compounds. (Krishnamoorthy & Wekerle, Eur. J. Immunol 2009; 39:2031-35.) The course of EAE in this model resembles a primary progressive form of MS, since once induced the disease does not remit. Complete Freund's Adjuvant (CFA) was supplemented with MOG to obtain a 1 mg/ml emulsion and 2100 l were injected subcutaneously at two different sites of the flank of deeply anesthetized mice. Pertussis toxin was injected on the day of immunization and 2 d later (400 ng, Alexis, San Diego, Calif.). All animals were kept under standard conditions and had access to water and food ad libitum.

(91) Pharmacological modulation was also performed using the FXII antagonist H-D-Pro-Phe-Arg-chloromethylketone (PCK) (8 g/g; Bachem) administered by daily intravenous injection. PCK irreversibly inhibits the amidolytic activity of activated FXII (FXIIa) and plasma kallikrein-mediated activation of FXII. (Tans et al., Eur. J. Biochem. 1987; 164:637-42; Kleinschnitz, J Exp Med. 2006 Mar. 20; 203(3):513-8.)

(92) The clinical course of EAE was monitored daily by two blinded investigators using the following score system: grade 0, no abnormality; grade 1, limp tail tip; grade 2, limp tail; grade 3, moderate hind limb weakness; grade 4, complete hind limb weakness; grade 5, mild paraparesis; grade 6, paraparesis; grade 7, heavy paraparesis or paraplegia; grade 8, tetraparesis; grade 9, quadriplegia or premoribund state; grade 10, death. Animals, with a score higher than 7 were euthanized and continued with the accordant score until the end of the experiment.

(93) In FXII-deficient mice the maximum disease rate was significantly reduced. (FIG. 4A.) Similar results were obtained in a pharmacological blockade with PCK. (FIG. 4C, 4D.) PCK had an effect even when treatment was started on day 12, when the animals already showed EAE symptoms (FIG. 4D). But in FXI-deficient mice, the EAE disease course was similar to that in the wildtype control mice. (FIG. 4B.) Since FXI is immediately downstream of FXII and is activated by FXIIa, these results indicate that it is not the role of FXII in the intrinsic coagulation cascade that led to the observed protective effect in the EAE model.

(94) In addition to the reduction in disease score, the number of inflammatory foci and both demyelination and axonal damage were also significantly reduced in FXII-deficient animals. FIG. 5 depicts the number of inflammatory foci (FIG. 5A), demyelinated area/slice (FIG. 5B), and the axon counts (FIG. 5C) in control (left bar), PCK treated (middle bar), and FXII/ mice (right bar). For quantification, stained sections were examined in a blinded fashion by microscopy (Axiophot2, Zeiss; Oberkochen, Germany) with a CCD camera (Visitron Systems; Tuchheim, Germany). Inflammatory foci (H&E), demyelinated areas (LFB), and cells were counted on five randomly selected samples utilizing MetVue Software (Molecular Devices; Downingtown, USA). The number of axons was analyzed in defined lesions. Fluorescence intensity was measured utilizing ImageJ (NIH, USA). Examples of histologic comparisons between control (Con) and PCK-treated mice are presented for each bar graph. Arrows show areas of inflammation (FIG. 5A), demyelination (FIG. 5B), and axonal damage (FIG. 5C).

(95) In-vitro analyses also showed an altered immune response (FIGS. 5D and 5E). Splenocytes were isolated from immunized mice at the disease maximum and 50 days after EAE induction and stimulated with MOG.sub.35-55 peptide (10 mg/ml) or CD3/CD28 beads (cell to bead ratio 2:1). For the proliferation assay shown in FIG. 5D, 110.sup.5 splenocytes were cultured in 1 ml DMEM containing 10 mM HEPES, 25 mg/ml gentamicin, 50 mM mercaptoethanol, 5% FCS, 2 mM glutamine, and 1% nonessential amino acids (Cambrex; Verviers, Belgium) for three days and stimulated with CD3/CD28 beads (cell to bead ratio 2:1; Dynal Biotech, Hamburg, Germany) or 10 mg/ml MOG.sub.35-55. .sup.3H thymidine (Amerham; Piscataway, N.J.) was added for the final 14 hours, and radioactivity was measured on a beta-scintillation counter (TopCount NXT; PerkinElmer, Rodgau-Jugesheim, Germany). Experiments were performed in quadruplicates.

(96) As shown in FIG. 5D, the proliferation among control (left bar), PCK treated (middle bar), and FXII.sup./ mice (right bar) splenocytes stimulated with CD3/CD28 beads was not significantly different. When MOG.sub.35-55 peptide was used to stimulate proliferation, there was a significant different between control and PCK-treated mice, but not between control and FXII.sup./ mice.

(97) Supernatants of MOG restimulated splenocytes were also assessed for IFN, IL-17, IL-4 and IL-6 protein levels by ELISA (R&D Systems; Wiesbaden, Germany) according to the manufacturer's instructions. The results, presented in FIG. 5E, show that there was reduced production of IL-17, TNF and IL-6 from splenocytes from both PCK treated (middle bar) and FXII.sup./ mice (right bar) compared to control. Levels of IFN were not significantly different.

(98) Taken together, these results suggest that the inhibition of FXII leads to a change in the peripheral immune response that is not associated with the change in the intrinsic coagulation cascade.

Example 2: A Protein Inhibitor of FXII Also Inhibits Clinical Signs of Disease in a Primary Progressing Model of Neurological Autoimmune Inflammation

(99) rHA-Infestin-4, another inhibitor of FXII, was also active in the EAE model described in detail in Example 1. In this study, mice were treated with rHA-infestin-4, a protein comprising human albumin fused to the infestin 4 domain via a linker (which is described in Hagedorn et al. Circulation 2010; 121:1510-17) by daily intravenous injections at a dose of 200 g/g.

(100) As shown in FIG. 6A, rHA-Infestin-4 also reduced the EAE score early in the course of disease. And as was seen in the study in PCK-treated and FXII.sup./ mice, treatment with rHA-Infestin-4 resulted in a significant reduction in IL-17 production relative to control (FIG. 6B).

(101) These results provide additional evidence that pharmacological blockade of FXII offers a new, alternative anti-inflammatory strategy for the treatment of MS.

Example 3: Anti-FXII Antibody Treatment Inhibits Clinical Signs of Disease in a Relapsing Model of Neurological Autoimmune Inflammation

(102) An anti-Factor XII antibody was also used to test the role of FXII in a second EAE modelfemale SJL mice immunized with PLP peptide (Myelin Proteolipid Protein). This EAE mouse model replicates many of the clinical and histopathological signs of MS including degeneration of motor neuron function. Like the C57Bl/6 MOG.sub.35-55 model, SJL mice immunized with PLP is an accepted model for use in pre-clinical validation of therapeutic compounds. (Krishnamoorthy & Wekerle, Eur. J. Immunol 2009; 39:2031-35.) The SJL PLP model, however, also experiences remission and relapse, as occurs in the relapsing remitting form of MS.

(103) EAE was induced in female SJL mice aged 8-12 weeks by immunizing them subcutaneously with 100 g of PLP peptide (139-151) (Mimotopes, Clayton, Vic, Australia) emulsified in Complete Freund's adjuvant (CFA) (Difco, BD San Diego, Calif., USA), followed by 200 ng pertussis toxin (Sigma-Aldrich, St Louis, Mo., USA) administered intravenously on day 0. On day 1 (i.e., the day before EAE induction injection), and on days 1, 3, 6, 8, 10, 13, and 15 following induction, control animals were given a subcutaneous injection of 200 g of isotype control monoclonal antibody while the experimental group received anti-FXII mAb (3F7). Disease was monitored from day 0 to 15. Clinical score was assessed as described in Langrish et al., J Exp Med. 2005; 201:233-40, with a maximum score of 6 for each mouse. All animal procedures were approved by the CSL animal ethics committee.

(104) Treatment of mice with a neutralizing anti-FXII monoclonal antibody (mAb) inhibited the clinical progression of EAE in this relapsing model (FIG. 7). Inhibition was most effective at the early stage of disease.

(105) To assess the effect of FXII blockade on proinflammatory cytokine responses in-vivo, animals were bled at day 9 and serum harvested for cytokine analysis by Luminex assay (Millipore, Billerica, Mass., USA) on a Luminex 200 instrument (Austin, Tex., USA) according the manufacturer's instructions. Anti-FXII antibody treatment led to a reduction in pro-inflammatory cytokine release into the blood. As shown in FIG. 8, anti-FXII reduced levels of GM-CSF, IFN, TNF and IL-1.

(106) Macrophages and dendritic cells (DCs) are prominent in EAE and MS inflammatory lesions and have roles in mediating tissue injury. They contribute by production of proinflammatory cytokines, antigen presentation to auto-reactive lymphocytes, and in the production of reactive oxygen species that cause direct myelin damage (Graham et. al., 2009). Chemerin is a molecule that circulates as a zymogen within the blood, and is activated by serine proteases which include plasmin, neutrophil elastase, and to a lesser extent FVIIa. FXIIa, however, is the predominant activator (Qu and Chaikof, 2010). Activated chemerin is a potent chemoattractant for cells expressing chemokine-like receptor 1 (CMKLR1), also known as ChemR23. This receptor is highly expressed by plasmacytoid dendritic cells (pDC), tissue resident macrophages, monocytes, and NK cells (Hart and Greaves, 2010). Studies by Graham et al. (2009), have shown that mouse knockouts of the chemerin receptor, CMKLR1, or Chem23, have overall lower clinical scores in EAE experiments. Accordingly, it is possible that, at least in the relapsing EAE model, blocking the action of FXII with an antibody may act, at least in part, by reducing the amount of active chemerin, thereby producing a therapeutic effect in the EAE experiments.

(107) Other embodiments of the invention will be apparent to those skilled in the art from consideration of the specification and practice of the invention disclosed herein. It is intended that the specification and examples be considered as exemplary only, with a true scope and spirit of the invention being indicated by the following claims.