Vaccine Adjuvant
20180110853 ยท 2018-04-26
Inventors
- Bruce Steven Klein (Madison, WI)
- Huafeng Wang (Madison, WI, US)
- Marcel Wuethrich (Madison, WI)
- Tristan Theodore Brandhorst (Madison, WI, US)
Cpc classification
A61K39/39
HUMAN NECESSITIES
A61K2039/57
HUMAN NECESSITIES
International classification
Abstract
A Dectin-2 ligand vaccine adjuvant and a method of making and using the Dectin-2 ligand vaccine adjuvant in a vaccine to immunize a patient are disclosed. Also discloses is a vaccine composition comprising a Bl-Eng2 antigen and methods of using the vaccine composition to immunize a subject against a fungal infection.
Claims
1. A vaccine suitable to immunize a patient comprising an adjuvant, wherein the adjuvant is a Dectin-2 ligand.
2. The vaccine of claim 1, wherein the Dectin-2 ligand is a glycoprotein.
3. The vaccine of claim 1, wherein the Dectin-2 ligand is Bl-Eng2.
4. The vaccine of claim 3, wherein Bl-Eng2 comprises SEQ ID NO:1.
5. The vaccine of claim 3, wherein Bl-Eng2 comprises O-linked glycosylations.
6. The vaccine of claim 1, wherein the vaccine immunizes a patient against a fungal infection.
7. The vaccine of claim 1, wherein the vaccine comprises glucan particles.
8. The vaccine of claim 1, wherein the vaccine immunizes a patient against a bacterial infection.
9. The vaccine of claim 1, wherein the vaccine immunizes a patient against a viral infection.
10. A method of preparing a vaccine comprising the steps of, (a) preparing a pharmaceutically acceptable vaccine stabilizer; and (b) introducing to the vaccine stabilizer a suitable antigen and an adjuvant, wherein the adjuvant is a Dectin-2 ligand.
11. A method of protecting a patient from an infection comprising the steps of: (a) obtaining the vaccine of claim 1, wherein the vaccine comprises an adjuvant and a suitable antigen, wherein the adjuvant is a Dectin-2 ligand; and (b) providing a therapeutically effective amount of the vaccine to a subject, wherein the subject is protected from the infection.
12. The method of claim 11 wherein the infection is a fungal infection and the patient is protected from a fungi infection.
13. The method of claim 12, wherein the antigen is a fragment of calnexin and the fungi is selected form the group consisting of Histoplasma, Coccidiodes, Paracoccidioides, Penicillium, Blastomyces, Sporothrix, Aspergillus, Pneumocystis, Magnaportha, Exophiala, Neuroaspora, Cryptococcus, Schizophyllum, and Candida.
14. A vaccine composition comprising Bl-Eng2 and a pharmaceutically acceptable carrier.
15. The vaccine of claim 14, wherein Bl-Eng2 comprises SEQ ID NO:1.
16. The vaccine of claim 14, wherein Bl-Eng2 comprises O-linked glycosylations.
17. The vaccine of claim 14, wherein the vaccine is suitable to immunize a subject against a fungal infection.
18. The vaccine of claim 14, wherein the vaccine additionally comprises an adjuvant.
19. The vaccine of claim 18, wherein the vaccine comprises incomplete Freunds adjuvant.
20. The vaccine of claim 14, wherein the vaccine comprises a fragment of Bl-Eng2.
21. A method of protecting a patient from an infection comprising the steps of: (a) obtaining the vaccine of claim 14, wherein the vaccine comprises Bl-Eng2; and (b) providing a therapeutically effective amount of the vaccine to a subject, wherein the subject is protected from the infection.
22. The method of claim 21, wherein the infection is a fungal infection.
23. The method of claim 21, wherein Bl-Eng2 comprises SEQ ID NO:1.
24. The vaccine of claim 21, wherein Bl-Eng2 comprises O-linked glycosylations.
Description
BRIEF DESCRIPTION OF DRAWINGS
[0017] The patent or patent application file contains at least one drawing in color. Copies of this patent or patent application publication with color drawings will be provided by the Office upon request and payment of the necessary fee.
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
DETAILED DESCRIPTION OF THE INVENTION
In General
[0034] All publications, patents, and patent applications mentioned in this specification are herein incorporated by reference to the same extent as if each individual publication, patent, and patent application was specifically and individually indicated to be incorporated by reference.
[0035] In one embodiment, the present disclosure describes an adjuvant for use in a vaccine. The adjuvant is a Dectin-2 ligand, which stimulates an immune response when administered in a vaccine composition. In another embodiment, the present disclosure describes an antigen for use in a vaccine. The antigen is Bl-Eng2 or a variant thereof, which stimulates an immune response when administered in a vaccine.
[0036] Due to changes in naming conventions and related homologs, Bl-Eng2 of the current invention was named Bl-Eng3 in corresponding U.S. Provisional Application No. 62/411,281, which is incorporated herein by reference. The polypeptide sequence of the novel adjuvant and antigen has not changed.
[0037] In one embodiment, the Dectin-2 ligand is glycosylated. In one embodiment, the Dectin-2 ligand comprises at least one N-linked glycan, O-linked glycan or combinations thereof. In one embodiment, the Dectin-2 ligand comprises at least one 0-ling glycan. In one embodiment, the Dectin-2 ligand is Bl-Eng2, MP98, Furfurman, or Man-LAM.
[0038] The use of the term or in the claims is used to mean and/or unless explicitly indicated to refer to alternatives only or the alternatives are mutually exclusive. It is specifically contemplated that any listing of items using the term or means that any of those listed items may also be specifically excluded from the related embodiment.
[0039] Throughout this application, the term about is used to indicate that a value includes the standard deviation of error for the device or method being employed to determine the value.
[0040] As used herein the specification, a or an may mean one or more, unless clearly indicated otherwise. As used herein in the claims, when used in conjunction with the word comprising, the words a or an may mean one or more than one.
[0041] The terms comprise, have, and include are open-ended linking verbs. Any forms or tenses of one or more of these verbs, such as comprises, comprising, has, having, includes, and including, are also open-ended. For example, any method that comprises, has or includes one or more steps is not limited to possessing only those one or more steps and also covers other unlisted steps.
[0042] The terms polypeptide, peptide, and protein, as used herein, refer to a polymer comprising amino acid residues predominantly bound together by covalent amide bonds. By the term protein, we mean to encompass all the above definitions. The terms apply to amino acid polymers in which one or more amino acid residue may be an artificial chemical mimetic of a naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non-naturally occurring amino acid polymers. As used herein, the terms may encompass amino acid chains of any length, including full length proteins, wherein the amino acids are linked by covalent peptide bonds. The protein or peptide may be isolated from a native organism, produced by recombinant techniques, or produced by synthetic production techniques known to one skilled in the art.
[0043] The term post-translational modification, or PMT as used herein, refers to the covalent and generally enzymatic modification of proteins during or following protein biosynthesis. Post-translational modifications may occur at the C- or N-termini of the protein or on the amino acid side chains of the protein. PTMs may include, but are not limited to, the addition of phosphates, carbohydrates, acetates, amide groups, methyl groups, lipid molecules, and combinations thereof. The addition of PTM to a protein may be, but are not limited to, enzymatic phosphorylation, glycosylation, acylation, alkylation, methylation and combinations thereof. In one embodiment of the invention, PTMs include N- and O-linked glycosylations.
[0044] The term glycoprotein, as used herein, refers to a protein in which a carbohydrate, monosaccharide or glycan is attached to a hydroxyl or other functional group of the protein. The glycoprotein is the result of a post-translational modification wherein a carbohydrate has been covalently linked to the protein. The glycosylation may be, but is not limited to, the covalent addition of any glucan known in the art and may be one or more of a monosaccharide, a carbohydrate, a glucose, a mannose, an N-acetylglucosamine, and combinations thereof. In one embodiment of the invention, the glycol protein comprises at least one O-linked glycan.
[0045] The term therapeutically effective amount, as used herein, refers to an amount of an antigen or vaccine that would induce an immune response in a subject receiving the antigen or vaccine which is adequate to prevent signs or symptoms of disease, including adverse health effects or complications thereof, caused by infection with a pathogen, such as a virus or a bacterium. Humoral immunity or cell mediated immunity or both humoral and cell mediated immunity may be induced. The immunogenic response of an animal to a vaccine may be evaluated, e.g., indirectly through measurement of antibody titers, lymphocyte proliferation assays, or directly through monitoring signs and symptoms after challenge with wild-type strain. The protective immunity conferred by a vaccine may be evaluated by measuring, e.g., reduction in clinical signs such as mortality, morbidity, temperature number, overall physical condition, and overall health and performance of the subject. The amount of a vaccine that is therapeutically effective may vary depending on the particular virus used, or the condition of the subject, and may be determined by a physician.
[0046] The term protected, as used herein, refers to immunization of a patient against a disease. The immunization may be caused by administering a vaccine comprising an antigen. Specifically, in the present invention, the immunized patient is protected from a fungal, bacterial, or viral infection.
[0047] The term vaccine, as used herein, refers to a composition that includes an antigen. Vaccine may also include a biological preparation that improves immunity to a particular disease. A vaccine may typically contain an agent, referred to as an antigen, that resembles a disease-causing microorganism, and the agent may often be made from weakened or killed forms of the microbe, its toxins or one of its surface proteins. The antigen may stimulate the body's immune system to recognize the agent as foreign, destroy it, and remember it, so that the immune system can more easily recognize and destroy any of these microorganisms that it later encounters.
[0048] Vaccines may be prophylactic, e.g., to prevent or ameliorate the effects of a future infection by any natural or wild pathogen, or therapeutic, e.g., to treat the disease. Administration of the vaccine to a subject results in an immune response, generally against one or more specific diseases. The amount of a vaccine that is therapeutically effective may vary depending on the particular virus used, or the condition of the patient, and may be determined by a physician. The vaccine may be introduced directly into the subject by the subcutaneous, oral, oronasal, or intranasal routes of administration.
[0049] A vaccine of the present invention will include a suitable antigen to stimulate an immune response in a subject or patient. It is envisioned that vaccines of the present invention are not limited to a specific antigen or disease target, except where specifically specified. In some embodiments, the vaccine of the present invention provides immunity against a fungus, a parasite, a bacteria, a microbe, or a virus. In one embodiment, the antigen is Bl-Eng2 or a peptide fragment thereof and the vaccine composition provides immunity against a fungus.
[0050] In some embodiments, the vaccine of the present invention provides immunity against fungi. In one embodiment of the invention, the vaccine comprises an antigen for the family of ascomycetes in which the pan-fungal antigen Calnexin is highly conserved, and has been shown to confer protection against infection in experimental animal models. A non-limiting example of an antigen of the present invention is the calnexin fragment described in U.S. patent application Ser. No. 14/203,898 (Method of Treating Fungal Infection) and U.S. patent application Ser. No. 14/643,693 (Peptide MHCII Tetramers to Detect Endogenous Calnexin Specific CD4 T Cells), both of which are incorporated herein in their entirety.
[0051] In some embodiments, the vaccine of the present invention provides immunity against a Blastomyces dermatitidis infection. In one embodiment, the vaccine comprises Bl-Eng2 as an antigen to confer protection against a fungal infection. In some embodiments, the fungal infection is selected from the group consisting of Blastomyces dermatitidis, Histoplasma capsulatum, Coccidioides posadasii, Coccidioides immitis, Aspergillus fumigatus and Pseudogymnoascus destructans. In some embodiments, the Bl-Eng2 is a fragment of Bl-Eng2 comprising SEQ ID NO:4. Without wishing to be bound by any particular theory, SEQ ID NO:4 is conserved among Blastomyces dermatitidis, Histoplasma capsulatum, Coccidioides posadasii, Coccidioides immitis, Aspergillus fumigatus and Pseudogymnoascus destructans, and this conserved sequence may be responsible for Bl-Eng2 mediated protection against fungal infection.
Suitable Targets of the Present Invention
[0052] The term fungi or funguses, as used herein, refers to a member of a large group of eukaryotic organisms that may include microorganisms, e.g., yeasts and molds. These organisms may be classified as a kingdom of fungi, which is separate from plants, animals, and bacteria. One major difference between fungi and the others is that fungal cells have cell walls that contain chitin, unlike the cell walls of plants, which contain cellulose.
[0053] These and other differences show that the fungi form a single group of related organisms, named the Eumycota (true fungi or Eumycetes), that share a common ancestor (a monophyletic group). This fungal group may be distinct from the structurally similar myxomycetes (slime molds) and oomycetes (water molds). Genetic studies have shown that fungi are more closely related to animals than to plants. In the present invention, the terms fungi, funguses, or fungal may refer to fungi which may cause infection in humans and animals.
[0054] In one preferred embodiment of the present invention, fungi may include Candida albicans (using Candida Adh1 or Als3 protein as an antigen), Aspergillus fumigatus, endemic systemic dimorphic fungi including Coccidioides immitis and C. posadasii, Histoplasma capsulatum, Blastomyces dermatitidis, Paracoccidioides brasiliensis, Sporothrix schenkii and Penicillium marneffii) and other ascomycetes using the shared and conserved antigenic domain of Calnexin.
[0055] Aside from fungi, the present invention may be used as an adjuvant for vaccination against any infectious disease that requires the development of cellular immunity, in particular T helper 1 and T helper 17 CD4+ cells and T cytotoxic 1 and T cytotoxic 17 CD8+ T cells. This group of microorganisms may include parasites, bacteria, and viruses.
[0056] In some embodiments, the present invention may be used as an adjuvant for vaccination against a bacterial infection. The bacteria may include, but is not limited to, Mycobacterium tuberculosis, and other intracellular bacteria that require T cell immunity for host protection. Any suitable antigen known in the art to protect against the target bacterial infection can be used in a vaccine composition with the adjuvant of the present invention. In one embodiment, the vaccine composition comprises Bl-Eng2 and Ag85B and protects against a Mycobacterium tuberculosis infection.
[0057] In some embodiments, the present invention may be used as an adjuvant for vaccination against a viral infection. The virus may include, but is not limited to, influenza A, and other viral infections that require cell mediated immunity for host protection. Any suitable antigen known in the art to protect against the target viral infection can be used in a vaccine composition with the adjuvant of the present invention. In one embodiment, the vaccine composition comprises Bl-Eng2 and nucleoprotein (NP) and protects against an influenza A infection.
Vaccine Administration
[0058] The term administration, as used herein, refers to the introduction of a substance, such as a vaccine, into a subject's body through or by way of a route that does not include the digestive tract. The administration, e.g., parenteral administration, may include subcutaneous administration, intramuscular administration, transcutaneous administration, intradermal administration, intraperitoneal administration, intraocular administration, intranasal administration and intravenous administration.
[0059] The vaccine or the composition according to the invention may be administered to an individual according to methods known in the art. Such methods comprise application e.g. parenterally, such as through all routes of injection into or through the skin: e.g. intramuscular, intravenous, intraperitoneal, intradermal, mucosal, submucosal, or subcutaneous. Also, the vaccine may be applied by topical application as a drop, spray, gel or ointment to the mucosal epithelium of the eye, nose, mouth, anus, or vagina, or onto the epidermis of the outer skin at any part of the body.
[0060] Other possible routes of application are by spray, aerosol, or powder application through inhalation via the respiratory tract. In this last case the particle size that is used will determine how deep the particles will penetrate into the respiratory tract.
[0061] Alternatively, application may be via the alimentary route, by combining with the food, feed or drinking water e.g. as a powder, a liquid, or tablet, or by administration directly into the mouth as a: liquid, a gel, a tablet, or a capsule, or to the anus as a suppository. The term animal-based protein, as used herein, refers to proteins that are sourced from ruminant milk, and other sources, for example the muscle meat, of an animal, particularly a mammal. Suitable animal-based proteins may include, but are not limited to, digested protein extracts such as N-Z-Amine?, N-Z-Amine AS? and N-Z-Amine YT? (Sheffield Products Co., Norwich, N.Y.), which are casein enzymatic hydrolysates of bovine milk.
[0062] The term vegetable-based protein, as used herein, refers to proteins from vegetables. A vegetable-based protein may include, without limitation, soy protein, wheat protein, corn gluten, rice protein and hemp protein, among others. Preferred vegetable based proteins in the present invention are soy proteins and corn gluten. Corn gluten is a mixture of various corn-derived proteins. The soy proteins can include 100% soy protein (available as VegeFuel? by Twinlab), textured soy protein, and soybean enzymatic digest. Textured soy protein is a soy protein that is made from defatted soy flour that is compressed and processed into granules or chunks. Soybean enzymatic digest describes soybean peptones that result from the partial hydrolysis of soybean proteins.
Antibodies of the Present Invention
[0063] The term antibody, as used herein, refers to a class of proteins that are generally known as immunoglobulins. The term antibody herein is used in the broadest sense and specifically includes full-length monoclonal antibodies, polyclonal antibodies, multi specific antibodies (e.g., bispecific antibodies), and antibody fragments, so long as they exhibit the desired biological activity. Various techniques relevant to the production of antibodies are provided in, e.g., Harlow, et al., ANTIBODIES: A LABORATORY MANUAL, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., (1988).
[0064] The term fusion protein, as used herein, refers to a hybrid polypeptide which comprises protein domains from at least two different proteins. Fusion proteins or chimeric proteins (literally, made of parts from different sources) are proteins created through the joining of two or more genes that originally coded for separate proteins. Translation of this fusion gene results in a single or multiple polypeptides with functional properties derived from each of the original proteins. Recombinant fusion proteins are created artificially by recombinant DNA technology for use in biological research or therapeutics. Chimeric or chimera usually designate hybrid proteins made of polypeptides having different functions or physico-chemical patterns. Chimeric mutant proteins occur naturally when a complex mutation, such as a chromosomal translocation, tandem duplication, or retrotransposition creates a novel coding sequence containing parts of the coding sequences from two different genes. Naturally occurring fusion proteins are commonly found in cancer cells, where they may function as oncoproteins. In one embodiment of the present invention, fusion proteins comprise at least one engineered intein.
[0065] The term immune status or immunocompetence, as used herein, refers to the ability of the body to produce a normal immune response following exposure to an antigen. Immunocompetence is the opposite of immunodeficiency or immuno-incompetent or immuno-compromised.
[0066] The present invention is generally applied to humans. In certain embodiments, non-human mammals, such as mice and rats, may also be used for the purpose of demonstration. One may use the present invention for veterinary purpose. For example, one may wish to treat commercially important farm animals, such as cows, horses, pigs, rabbits, goats, and sheep. One may also wish to treat companion animals, such as cats and dogs.
Adjuvants of the Present Invention
[0067] As used herein, Th17 cells refers to a population of CD4+ T cells which produce Il-17. As used herein, Th1 cells refers to a population of CD4+ T cells which produce INF-?. As used herein, Tc1 cells refers to a population of cytotoxic CD8+ T cells that produce INF-?. Vaccine induced CD4+ T cells that produce IL-17 (Th17 cells) and INF-? (Th1 cells) and CD8+Tc1 cells that produce INF-? are active in resistance against fungal, bacterial and viral infections. In one embodiment of the invention, the vaccine requires the activity of the Dectin-2 receptor on phagocytes that will trigger the development of antigen-specific Th17 and Th1 cells to mediate resistance.
[0068] As used herein, the term Dectin-2 or Dec-2 refers to a type II transmembrane C-type lectin receptor involved in the innate immune response. Note to be bound by any particular theory, Applicants working theory indicates that fungal vaccine recognition by the Dectin-2/FcR?/Syk/Card9 signaling axis is required for the differentiation of Th17 and Th1 cells and the induction of vaccine-induced resistance to fungal infection (Wang et. al 2014 J Immunol).
[0069] As used herein, the term Dectin-2 ligand refers to a molecule capable of binding to or activating the Dectin-2/FcR?/Syk/Card9 signaling axis to promote the differentiation of Th17 and Th1 cells. The molecule may be a protein, a lipid, a glycoprotein, a glycolipid or any glycan capable of binding Dectin-2. A suitable Dectin-2 ligand of the present invention is characterized by the ability to induce Dectin-2 signaling using Dectin-2 expressing B3Z T cell reporter cells (
[0070] As used herein, the term Bl-Eng2 refers to the fungal glycoprotein ?-1,3-endoglucansase from Blastomyces dermatitidis. Bl-Eng2 has homology to Aspergillus fumigates endoglucanase 2 (Eng2) at the C-terminal glycosylation site, and endoglucanase 3 (Eng3) at the active site.
[0071] The predicted molecular weight of Bl-Eng2, based on amino acid sequence alone, is 57 kDa. However, Bl-Eng2 may appear as a 115-130 kDa band on an SDS-PAGE gel based on post-translation glycosylation. Bl-Eng2 comprises an 18 amino acid signal peptide, an N-terminal GH16 glycosyl hydrolase catalytic domain, and a C-terminal S/T-rich domain. Bl-Eng2 undergoes post-translational modification and has a number of O-linked glycosylation sites, which may be in the S/T-rich C-terminal domain. It is understood that mannose is the major monosaccharide present in the PTM glycosylation of Bl-Eng2 when it is expressed in Pichia pastoris. In one embodiment B1-Eng2 comprises the sequence of SEQ ID NO: 1. In one embodiment, the Bl-Eng2 is a fragment, single domain, or short glycan fragment of the full-length Bl-Eng2.
[0072] As used herein, the term MP98 refers to the chitin deacetylase-like protein from Cryptococcus neoformans (Levitz et al., 2001). MP98 comprises an N-terminal cleavable signal sequence, a polysaccharide deacetylase domain found in fungal chitin deacetylases, and a serine/threonine-rich C-terminal region. The C-terminal region comprises N-liked glycosylation sites comprises covalently linked mannose.
[0073] A Dectin-2 ligand suitable for use as a vaccine adjuvant in the present invention may be in any form as discussed above. In one embodiment, the Dectin-2 ligand may be expressed in commercially available sources, e.g., Pichia pastoris. The Dectin-2 ligand maybe expressed in any commercially available sources that is capable of post-translational protein modifications. The Dectin-2 ligand vaccine adjuvant may be then isolated and purified from these sources. The protein expression, isolation, and purifications are well known to a person having ordinary skill in the art. The Examples demonstrate methods of expression, isolation, and purifications of Bl-Eng2 according to one embodiment of the present invention.
[0074] A vaccine comprising a Dectin-2 ligand adjuvant may also comprise other suitable ingredients. In one embodiment, a vaccine may also comprise a carrier molecule as a stabilizer component. As the types of vaccines enclosed in the present invention may be rapidly degraded once injected into the body, the vaccine may be bound to a carrier molecule for stabilizing the vaccine during delivery and administration. A suitable carrier or stabilizer may comprise fusion proteins, polymers, liposomes, micro- or nanoparticles, or any other pharmaceutically acceptable carriers. A suitable carrier or stabilizer molecule may comprise a tertiary amine N-oxide, e.g., trimethylamine-N-oxide, a sugar, e.g., trehalose, a poly(ethylene glycol) (PEG), an animal-based protein, e.g., digested protein extracts such as N-Z-Amine?, N-Z-Amine AS? and N-Z-Amine YT? (Sheffield Products Co., Norwich, N.Y.), a vegetable-based protein, e.g., soy protein, wheat protein, corn gluten, rice protein and hemp protein, and any other suitable carrier molecules.
[0075] As used herein glucan particle refers to a formulation of the vaccine comprising ?.sub.1,3 glucan particles as a solid support. Glucan particles target Dectin-1, a key pattern recognition receptor for anti-fungal immunity. Glucan particles also serve as structural vessels or a type or structural scaffold to deliver antigen as well as adjuvants in the vaccine formulation. In one embodiment, ?.sub.1,3 glucan particles (GPs) are used as a solid support for Bl-Eng2. In one embodiment, glucan particles in used in a vaccine formulation with calnexin fragments and a Dectin-2 ligand adjuvant against pathogenic fungi.
[0076] In another aspect, the Dectin-2 ligand adjuvant of the present invention may be administered in a formulation with any known commercially available adjuvant in the art. Adjuvants to be administrated may include, but are not limited to, aluminum hydroxide (Alum), glucan particles engaging Dectin-1, Adjuplex, and combinations thereof. It is also envisioned that when Bl-Eng3 is administered in a vaccine composition as an antigen, it may be administrated with a suitable adjuvant. Suitable adjuvants are any commercially available adjuvant known in the art or an adjuvant described herein.
Suitable Carrier or Vehicle
[0077] Suitable agents may include a suitable carrier or vehicle for delivery. As used herein, the term carrier refers to a pharmaceutically acceptable solid or liquid filler, diluent or encapsulating material. A water-containing liquid carrier can contain pharmaceutically acceptable additives such as acidifying agents, alkalizing agents, antimicrobial preservatives, antioxidants, buffering agents, chelating agents, complexing agents, solubilizing agents, humectants, solvents, suspending and/or viscosity-increasing agents, tonicity agents, wetting agents or other biocompatible materials. A tabulation of ingredients listed by the above categories, may be found in the U.S. Pharmacopeia National Formulary, 1857-1859, (1990).
[0078] Some examples of the materials which can serve as pharmaceutically acceptable carriers are sugars, such as lactose, glucose and sucrose; starches such as corn starch and potato starch; cellulose and its derivatives such as sodium carboxymethyl cellulose, ethyl cellulose and cellulose acetate; powdered tragacanth; malt; gelatin; talc; excipients such as cocoa butter and suppository waxes; oils such as peanut oil, cottonseed oil, safflower oil, sesame oil, olive oil, corn oil and soybean oil; glycols, such as propylene glycol; polyols such as glycerin, sorbitol, mannitol and polyethylene glycol; esters such as ethyl oleate and ethyl laurate; agar; buffering agents such as magnesium hydroxide and aluminum hydroxide; alginic acid; pyrogen free water; isotonic saline; Ringer's solution, ethyl alcohol and phosphate buffer solutions, as well as other nontoxic compatible substances used in pharmaceutical formulations. Wetting agents, emulsifiers and lubricants such as sodium lauryl sulfate and magnesium stearate, as well as coloring agents, release agents, coating agents, sweetening, flavoring and perfuming agents, preservatives and antioxidants can also be present in the compositions, according to the desires of the formulator.
[0079] Examples of pharmaceutically acceptable antioxidants include water soluble antioxidants such as ascorbic acid, cysteine hydrochloride, sodium bisulfite, sodium metabisulfite, sodium sulfite and the like; oil-soluble antioxidants such as ascorbyl palmitate, butylated hydroxyanisole (BHA), butylated hydroxytoluene (BHT), lecithin, propyl gallate, alpha-tocopherol and the like; and metal-chelating agents such as citric acid, ethylenediamine tetraacetic acid (EDTA), sorbitol, tartaric acid, phosphoric acid and the like.
Stabilization Agent
[0080] In another configuration, the present formulation may also comprise other suitable agents that stabilize the formulations. For example, an approach for stabilizing solid protein formulations of the invention is to increase the physical stability of purified, e.g., lyophilized, protein. This will inhibit aggregation via hydrophobic interactions as well as via covalent pathways that may increase as proteins unfold. Stabilizing formulations in this context may often include polymer-based formulations, for example a biodegradable hydrogel formulation/delivery system. The critical role of water in protein structure, function, and stability is well known. Typically, proteins are relatively stable in the solid state with bulk water removed. However, solid therapeutic protein formulations may become hydrated upon storage at elevated humidities or during delivery from a sustained release composition or device. The stability of proteins generally drops with increasing hydration. Water may also play a significant role in solid protein aggregation, for example, by increasing protein flexibility resulting in enhanced accessibility of reactive groups, by providing a mobile phase for reactants, and by serving as a reactant in several deleterious processes such as beta-elimination and hydrolysis.
[0081] An effective method for stabilizing peptides and proteins against solid-state aggregation for delivery may be to control the water content in a solid formulation and maintain the water activity in the formulation at optimal levels. This level depends on the nature of the protein, but in general, proteins maintained below their monolayer water coverage will exhibit superior solid-state stability.
[0082] A variety of additives, diluents, bases and delivery vehicles may be provided within the invention that effectively control water content to enhance protein stability. These reagents and carrier materials effective as anti-aggregation agents in this sense may include, for example, polymers of various functionalities, such as polyethylene glycol, dextran, diethylaminoethyl dextran, and carboxymethyl cellulose, which significantly increase the stability and reduce the solid-phase aggregation of peptides and proteins admixed therewith or linked thereto. In some instances, the activity or physical stability of proteins may also be enhanced by various additives to aqueous solutions of the peptide or protein drugs. For example, additives, such as polyols (including sugars), amino acids, proteins such as collagen and gelatin, and various salts may be used.
[0083] Certain additives, in particular sugars and other polyols, may also impart significant physical stability to dry, e.g., lyophilized proteins. These additives may also be used within the invention to protect the proteins against aggregation not only during lyophilization but also during storage in the dry state. For example sucrose and Ficoll 70 (a polymer with sucrose units) exhibit significant protection against peptide or protein aggregation during solid-phase incubation under various conditions. These additives may also enhance the stability of solid proteins embedded within polymer matrices.
[0084] Yet additional additives, for example sucrose, stabilize proteins against solid-state aggregation in humid atmospheres at elevated temperatures, as may occur in certain sustained-release formulations of the invention. Proteins such as gelatin and collagen also serve as stabilizing or bulking agents to reduce denaturation and aggregation of unstable proteins in this context. These additives can be incorporated into polymeric melt processes and compositions within the invention. For example, polypeptide microparticles can be prepared by simply lyophilizing or spray drying a solution containing various stabilizing additives described above. Sustained release of unaggregated peptides and proteins can thereby be obtained over an extended period of time.
[0085] Various additional preparative components and methods, as well as specific formulation additives, are provided herein which yield formulations for mucosal delivery of aggregation-prone peptides and proteins, wherein the peptide or protein is stabilized in a substantially pure, unaggregated form using a solubilization agent. A range of components and additives are contemplated for use within these methods and formulations. Exemplary of these solubilization agents are cyclodextrins (CDs), which selectively bind hydrophobic side chains of polypeptides. These CDs have been found to bind to hydrophobic patches of proteins in a manner that significantly inhibits aggregation. This inhibition is selective with respect to both the CD and the protein involved. Such selective inhibition of protein aggregation may provide additional advantages within the intranasal delivery methods and compositions of the invention.
[0086] Additional agents for use in this context include CD dimers, trimers and tetramers with varying geometries controlled by the linkers that specifically block aggregation of peptides and protein. Yet solubilization agents and methods for incorporation within the invention involve the use of peptides and peptide mimetics to selectively block protein-protein interactions. In one aspect, the specific binding of hydrophobic side chains reported for CD multimers may be extended to proteins via the use of peptides and peptide mimetics that similarly block protein aggregation. A wide range of suitable methods and anti-aggregation agents may be available for incorporation within the compositions and procedures of the invention.
Stabilizing Delivery Vehicle, Carrier, Support or Complex-Forming Species
[0087] In another embodiment, the present formulation may also comprise other suitable agents such as a stabilizing delivery vehicle, carrier, support or complex-forming species. The coordinate administration methods and combinatorial formulations of the instant invention may optionally incorporate effective lipid or fatty acid based carriers, processing agents, or delivery vehicles, to provide improved formulations for delivery of Dectin-2 ligand or functionally equivalent fragment proteins, analogs and mimetics, and other biologically active agents and antigens of the composition. For example, a variety of formulations and methods are provided for delivery which comprise one or more active agents, including the Dectin-2 ligand adjuvant, such as a peptide or protein, admixed or encapsulated by, or coordinately administered with, a liposome, mixed micellar carrier, or emulsion, to enhance chemical and physical stability and increase the half-life of the biologically active agents (e.g., by reducing susceptibility to proteolysis, chemical modification and/or denaturation) upon mucosal delivery.
[0088] Within certain aspects of the invention, specialized delivery systems for biologically active agents may comprise small lipid vesicles known as liposomes or micelles. These are typically made from natural, biodegradable, non-toxic, and non-immunogenic lipid molecules, and can efficiently entrap or bind drug molecules, including peptides and proteins, into, or onto, their membranes. The attractiveness of liposomes as a peptide and protein delivery system within the invention is increased by the fact that the encapsulated proteins can remain in their preferred aqueous environment within the vesicles, while the liposomal membrane protects them against proteolysis and other destabilizing factors. Even though not all liposome preparation methods known are feasible in the encapsulation of peptides and proteins due to their unique physical and chemical properties, several methods allow the encapsulation of these macromolecules without substantial deactivation.
[0089] Additional delivery vehicles carrier, support or complex-forming species for use within the invention may include long and medium chain fatty acids, as well as surfactant mixed micelles with fatty acids. Most naturally occurring lipids in the form of esters have important implications with regard to their own transport across mucosal surfaces. Free fatty acids and their monoglycerides which have polar groups attached have been demonstrated in the form of mixed micelles to act on the intestinal barrier as penetration enhancers. This discovery of barrier modifying function of free fatty acids (carboxylic acids with a chain length varying from 12 to 20 carbon atoms) and their polar derivatives has stimulated extensive research on the application of these agents as mucosal absorption enhancers.
[0090] For use within the methods of the invention, long chain fatty acids, especially fusogenic lipids (unsaturated fatty acids and monoglycerides such as oleic acid, linoleic acid, linoleic acid, monoolein, etc.) provide useful carriers to enhance delivery of Calnexin or a functionally equivalent fragment, and other biologically active agents disclosed herein. Medium chain fatty acids (C6 to C12) and monoglycerides have also been shown to have enhancing activity in intestinal drug absorption and can be adapted for use within the mucosal delivery formulations and methods of the invention. In addition, sodium salts of medium and long chain fatty acids are effective delivery vehicles and absorption-enhancing agents for mucosal delivery of biologically active agents within the invention. Thus, fatty acids can be employed in soluble forms of sodium salts or by the addition of non-toxic surfactants, e.g., polyoxyethylated hydrogenated castor oil, sodium taurocholate, etc. Other fatty acid and mixed micellar preparations that are useful within the invention include, but are not limited to, Na caprylate (C8), Na caprate (C10), Na laurate (C12) or Na oleate (C18), optionally combined with bile salts, such as glycocholate and taurocholate.
[0091] The vaccine formulation may additionally include a biologically acceptable buffer to maintain a pH close to neutral (7.0-7.3). Such buffers preferably used are typically phosphates, carboxylates, and bicarbonates. More preferred buffering agents are sodium phosphate, potassium phosphate, sodium citrate, calcium lactate, sodium succinate, sodium glutamate, sodium bicarbonate, and potassium bicarbonate. The buffer may comprise about 0.0001-5% (w/v) of the vaccine formulation, more preferably about 0.001-1% (w/v). The buffer(s) may be added as part of the stabilizer component during the preparation thereof, if desired. Other excipients, if desired, may be included as part of the final vaccine formulation.
[0092] The remainder of the vaccine formulation may be an acceptable diluent, to 100%, including water. The vaccine formulation may also be formulated as part of a water-in-oil, or oil-in-water emulsion.
[0093] Also provided as part of the invention is a method of preparation of the vaccine formulation described herein. Preparation of the vaccine formulation preferably takes place in two phases. The first phase may typically involve the preparation of the stabilizer component. The stabilizer component may comprise any suitable components as discussed above. For example, a vegetable-based protein stock solution may be prepared by dissolving the vegetable-based protein in a diluent. The preferred diluent may be water, preferably distilled and/or purified so as to remove trace impurities (such as that sold as purified Super Q?). In a separate vessel an animal-based protein may be dissolved in a diluent, additionally with the sugar component and buffer additives. Preferably, an equal volume of the vegetable-based protein stock solution is added to the animal-based protein solution. It is desirable that after HCl/KOH adjustment to achieve a pH of approximately 7.2?0.1, the stabilizer component may be sterilized via autoclave. The stabilizer solution may be refrigerated for an extended period prior to introduction of the Dectin-2 ligand adjuvant and a suitable antigen.
[0094] The second phase of preparation of the vaccine formulation may include introduction of the Dectin-2 ligand adjuvant and a suitable antigen with the stabilizer component, thereby yielding the vaccine formulation. Preferably, the Dectin-2 ligand adjuvant may be diluted with a buffer solution prior to its introduction to the stabilizer component.
[0095] Once this vaccine formulation solution has been achieved, the formulation may be separated into vials or other suitable containers. The vaccine formulation herein described may then be packaged in individual or multi-dose ampoules, or be subsequently lyophilized (freeze-dried) before packaging in individual or multi-dose ampoules. The vaccine formulation herein contemplated also includes the lyophilized version. The lyophilized vaccine formulation may be stored for extended periods of time without loss of viability at ambient temperatures. The lyophilized vaccine may be reconstituted by the end user, and administered to a patient.
[0096] The term lyophilization or lyophilized, as used herein, refers to freezing of a material at low temperature followed by dehydration by sublimation, usually under a high vacuum. Lyophilization is also known as freeze drying. Many techniques of freezing are known in the art of lyophilization such as tray-freezing, shelf-freezing, spray-freezing, shell-freezing and liquid nitrogen immersion. Each technique will result in a different rate of freezing. Shell-freezing may be automated or manual. For example, flasks can be automatically rotated by motor driven rollers in a refrigerated bath containing alcohol, acetone, liquid nitrogen, or any other appropriate fluid. A thin coating of product is evenly frozen around the inside shell of a flask, permitting a greater volume of material to be safely processed during each freeze drying run. Tray-freezing may be performed by, for example, placing the samples in lyophilizer, equilibrating 1 hr at a shelf temperature of 0? C., then cooling the shelves at 0.5? C./min to ?40? C. Spray-freezing, for example, may be performed by spray-freezing into liquid, dropping by ?20 ?l droplets into liquid N.sub.2, spray-freezing into vapor over liquid, or by other techniques known in the art.
[0097] The vaccine of the present invention may be either in a solid form or in a liquid form. Preferably, the vaccine of the present invention may be in a liquid form. The liquid form of the vaccine may have a concentration of 50-4,000 nanomolar (nM), preferably between 50-150 nM. In some embodiments, the concentration will be between 1-50,000 nM.
[0098] To vaccinate a patient, a therapeutically effective amount of vaccine comprising a suitable antigen and a Dectin-2 ligand adjuvant may be administered to a patient. The therapeutically effective amount of vaccine may typically be one or more doses, preferably in the range of about 0.01-10 mL, most preferably 0.1-1 mL, containing 1-200 micrograms, most preferably 1-100 micrograms of vaccine formulation/dose. The therapeutically effective amount may also depend on the vaccination species. For example, for smaller animals such as mice, a preferred dosage may be about 0.01-1 mL of a 1-50 microgram solution of antigen. For a human patient, a preferred dosage may be about 0.1-1 mL of a 1-50 microgram solution of antigen. The therapeutically effective amount may also depend on other conditions including characteristics of the patient (age, body weight, gender, health condition, etc.), the species of fungi, and others. In one embodiment the vaccine formulation of the present invention comprises 1-100 micrograms of Dectin-2 ligand adjuvant and 5-20 micrograms of Calnexin fragment in either soluble or glucan particle formulation.
[0099] In another aspect, to vaccinate a patient against a fungal infection, a therapeutically effective amount of a vaccine comprising Bl-Eng2 as an antigen may be administered to a patient. The therapeutically effective amount of vaccine my typically be one or more doses, preferably in the range of about 0.01-10 mL, most preferably 0.1-1 mL, containing 1-200 micrograms, most preferably 1-100 micrograms of vaccine formulation/dose. The vaccine my comprise 1-100 micrograms of Bl-Eng2 as an antigen.
[0100] A vaccine of the present invention may be administered by using any suitable means as disclosed above. Preferably, a vaccine of the present invention may be administered by intranasal delivery, transmucosal administration, subcutaneous or intramuscular administration, e.g., needle injection. In some embodiments, vaccine compositions for protection against a viral infection are formulated for transmucosal delivery. In some embodiments, vaccine compositions for protection against a bacterial infection are formulated for subcutaneous administration.
[0101] After vaccination using a vaccine of the present invention comprising the Dectin-2 ligand adjuvant, a patient may be immunized against at least one type of fungi, bacteria, or virus. In one specific embodiment, a patient after vaccination may be immunized against at least one species of dimorphic fungi. In one preferred embodiment, a patient after vaccination may be immunized from multiple dimorphic fungi including Histoplasma, Coccidiodes, Paracoccidioides, Penicillium, Blastomyces, Sporothrix, and Aspergillus fumigatus
[0102] The instant invention may also include kits, packages and multicontainer units containing the above described pharmaceutical compositions, active ingredients, and/or means for administering the same for use in the prevention and treatment of diseases and other conditions in mammalian subjects. Briefly, these kits include a container or formulation that contains the Bl-Eng2 adjuvant or a functionally equivalent fragment, and/or other biologically active agents in combination with mucosal or subcutaneous delivery enhancing agents disclosed herein formulated in a pharmaceutical preparation for delivery.
[0103] As used herein, the term pharmaceutically acceptable carrier refers to any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible. Preferably, the carrier is suitable for intravenous, intramuscular, subcutaneous, parenteral, spinal or epidermal administration (e.g., by injection or infusion). Depending on the route of administration, the antigentic peptide, i.e., the calnexin protein may be coated in a material to protect the peptide from the action of acids and other natural conditions that may inactivate the peptide.
[0104] A pharmaceutically acceptable salt refers to a salt that retains the desired biological activity of the parent compound and does not impart any undesired toxicological effects (see e.g., Berge, S. M., et al. (1977) J. Pharm. Sci. 66:1-19). Examples of such salts include acid addition salts and base addition salts. Acid addition salts include those derived from nontoxic inorganic acids, such as hydrochloric, nitric, phosphoric, sulfuric, hydrobromic, hydroiodic, phosphorous and the like, as well as from nontoxic organic acids such as aliphatic mono- and dicarboxylic acids, phenyl-substituted alkanoic acids, hydroxy alkanoic acids, aromatic acids, aliphatic and aromatic sulfonic acids and the like. Base addition salts include those derived from alkaline earth metals, such as sodium, potassium, magnesium, calcium and the like, as well as from nontoxic organic amines, such as N,N-dibenzylethylenediamine, N-methylglucamine, chloroprocaine, choline, diethanolamine, ethylenediamine, procaine and the like.
[0105] The composition can be formulated as a solution, microemulsion, dispersion, liposome, or other ordered structure suitable to high drug concentration.
[0106] In one embodiment, the composition may also comprise a carrier molecule as a stabilizer component. As the types of proteins or peptides enclosed in the present invention may be rapidly degraded once injected into the body, the proteins or peptides may be bound to a carrier molecule for stabilizing the proteins or peptides during delivery and administration. A suitable carrier or stabilizer may comprise fusion proteins, polymers, liposome, micro or nanoparticles, or any other pharmaceutically acceptable carriers. A suitable carrier or stabilizer molecule may comprise a tertiary amine N-oxide, e.g., trimethylamine-N-oxide, a sugar, e.g., trehalose, a poly(ethylene glycol) (PEG), an animal-based protein, e.g., digested protein extracts such as N-Z-Amine?, N-Z-Amine AS? and N-Z-Amine YT? (Sheffield Products Co., Norwich, N.Y.), a vegetable-based protein, e.g., soy protein, wheat protein, corn gluten, rice protein and hemp protein, and any other suitable carrier molecules. The composition may also comprise any suitable carrier or vehicle, such as those as discussed above. The composition may also comprise other stabilization agents, such as those as discussed above.
[0107] In one embodiment, the composition may also comprise suitable stabilizing delivery vehicle, carrier, support or complex-forming species, such as those as discussed above. For example, the composition may additionally comprise at least one of a stabilizer, a buffer, or an adjuvant.
[0108] The present invention has been described in terms of one or more preferred embodiments, and it should be appreciated that many equivalents, alternatives, variations, and modifications, aside from those expressly stated, are possible and within the scope of the invention.
Example 1
[0109] Adaptive immunity is critical for the prevention and resolution of fungal infections. The contribution of antibodies to host defense is debated. In contrast, Ag-specific CD4.sup.+ T cells play the major role in fungal resistance, as evidenced by the high incidence of life-threatening fungal infections in patients with impaired CD4.sup.+ T cells. CD4.sup.+ T cells confer resistance by secretion of T-helper 1 (Th1) and Th17 cytokines such as IFN-?, TNF-?, GM-CSF, and IL-17A, which activate neutrophils, monocytes, macrophages and DCs for fungal clearance. Since CD4.sup.+ T cells are germane to host defense against fungi, the challenge is how best to elicit these T cells.
[0110] The transition from innate to adaptive immunity is fostered by dendritic cells (DCs). These cells process and present Ag to na?ve CD4.sup.+ T cells in the context of co-stimulatory factors (e.g. cell surface ligands and cytokines) that provide the combination of signals necessary to induce naive T cell activation and proliferation. During their interactions with DCs, naive T cells also become functionally specialized. Helper T cell polarization occurs as a result of the cytokines produced by DCs: Th1 polarization is associated with DC production of high levels of IL-12p70, and Th17 polarization is associated with DC production of IL-1? and IL-6. While vaccine Ags typically have little impact on the nature of the cytokines produced by DCs, the adjuvant can have a dramatic effect. Alum (aluminum hydroxide), which is the most commonly used adjuvant in current vaccine formulations, suppresses DC production of pro-inflammatory cytokines such as IL-12p70, creating an environment that polarizes T cells towards a Th2 phenotype. Thus, a major weakness and central challenge in the field of vaccinology is the lack of adjuvants that drive Th1 and/or Th17 polarization and stimulate DCs to produce the appropriate cytokines. Pathways that can differentially activate DC cytokine profiles include toll-like receptors (TLRs), C-type lectin receptors (CLRs), co-stimulatory ligands such as CD40, and cytokine receptors.
[0111] C-type lectins are important in fungal recognition by DCs and in inducing anti-fungal Th1 and Th17 responses. Dectin-1 and Dectin-2 induce Th1/Th17 cells in response to Candida albicans and Aspergillus fumigatus infection. While Dectin-1 is dispensable, Dectin-2 is requisite for the development of protective Th1 and Th17 cells and vaccine resistance against dimorphic fungi. Crude fractions of mannoproteins isolated from Malassezia pachydermatis as well as a lipoglycan (Man-LAM) of Mycobacterium tuberculosis have been shown to trigger Dectin-2 signaling, however they have not been evaluated as vaccine adjuvants, and glycans and lipids may be difficult to express and scale.
[0112] The embodiment described here demonstrates a novel fungal Dectin-2 ligand from an attenuated vaccine strain of Blastomyces dermatitidis, Bl-Eng2. We tested whether the ligation of Dectin-2 effectively vaccinates mice against fungi. Our vaccination strategy was to ligate Dectin-2 with Bl-Eng2 and assess the adjuvant activity by combining it with the recently reported pan-fungal vaccine calnexin. Fungal recombinant Bl-Eng2 was expressed and scaled efficiently, it stimulated IL-6 and IL-1? production in vitro and Th1 and Th17 cells in vivo and, when used as an adjuvant in combination with calnexin, it protected mice against pneumonia in a model of lethal pulmonary fungal infection.
[0113] Results
[0114] B. dermatitidis vaccine yeast are bound by soluble Dectin-2 fusion protein and trigger NFAT signaling of Dectin-2 reporter cells. Dectin-2.sup.?/? mice fail to develop Ag-specific Th1 and Th17 cells or acquire vaccine resistance. We therefore sought to identify the fungal pathogen-associated molecular pattern (PAMP) that is recognized by Dectin-2. We used the NFAT-LacZ reporter cells to enrich Dectin-2 ligand activity from the vaccine yeast cell wall. We sonicated vaccine yeast, collected the water-soluble, cell-wall extract (CWE) and analyzed it by SDS-PAGE. CWE displayed a broad range of protein bands (
[0115] To enrich and identify glycoprotein with ligand activity, we employed the lectin Concanavalin A (ConA), which binds ?-D-mannose and ?-D-glucose moieties, gel filtration and Mass spectrometry analysis (
[0116] Bl-Eng2 Protein is a Bona-Fide Ligand for Dectin-2
[0117] To evaluate whether Bl-Eng2 is recognized by Dectin-2, we cloned and expressed the recombinant protein in Pichia pastoris. This eukaryotic expression system modifies recombinant proteins with both O- and N-linked glycosylation. Full-length Bl-Eng2 was fused to a N-terminal ?-factor secretion signal and a C-terminal Myc-6?His tag (
[0118] To verify Bl-Eng2 ligand activity, B3Z reporter cells expressing Dectin-2 or other distinct CLRs were incubated with recombinant Bl-Eng2. Bl-Eng2 elicited strong NFAT-lacZ signalling from Dectin-2 reporter cells, but not from the other CLR-expressing cells (
[0119] Dectin-2 is required for Bl-Eng2 ligand activity in primary cellsTo investigate whether Bl-Eng2 stimulates primary cells, we examined pro-inflammatory cytokine production from bone marrow-derived dendritic cells (BMDCs). BMDCs from wild type mice, but not Dectin-2.sup.?/? or Card9.sup.?/? mice, produced a strong IL-6 response when stimulated with recombinant Bl-Eng2, but not PDIA1 (
[0120] Bl-Eng2 is a Dectin-2 Ligand with Superior Capacity to Elicit Cytokine Responses
[0121] Dectin-2 recognizes several fungi including C. albicans, A. fumigatus and Malassezia, which possess N- and O-linked mannan on their surface. Thus, not surprisingly, there are two other Dectin-2 ligands described in the literature. They are Furfurman from Malassezia spp. and Man-LAM from M. tuberculosis. In addition to these ligands, by using B3Z reporter cells in the work here, we observed that MP98 from Cryptococcus neoformans is also recognized by Dectin-2 (
[0122] To begin to evaluate the relative potency of Dectin-2 ligands, we compared the ability of Bl-Eng2 and the other three Dectin-2 ligands to induce cytokine production by BMDCs. Bl-Eng2 induced the strongest IL-6 production by BMDCs when compared at equal molar and mass ratios to the other ligands (
[0123] Bl-Eng2 Induces the Production of IL-6 and IL-1,8 by Human PBMCs
[0124] A suitable adjuvant for vaccine formulation should ideally stimulate human accessory cells. To test this capacity, we assessed the effect of Bl-Eng2 on the function of human PBMCs. After stimulation with plate-coated Bl-Eng2, human PBMCs from five healthy subjects produced up to 17 ng/ml IL-6 and 9 ng/ml IL-1? as measured in the cell culture supernatants by ELISA (
[0125] Bl-Eng2 Promotes T Cell Development In Vivo and Imparts Vaccine Efficacy
[0126] To investigate whether Bl-Eng2 could be harnessed as a vaccine adjuvant, we performed preclinical studies in mice. We first tested whether Bl-Eng2 augments the development of vaccine Ag-specific T cells. To assess these T cell responses in vivo, we vaccinated mice with the pan-fungal Ag calnexin and enumerated CD4.sup.+ T cell responses by TCR Tg 1807 cells, which are specific for calnexin. Calnexin was suspended with incomplete freund's adjuvant (mineral oil) and injected subcutaneously. The addition of Bl-Eng2 into the formulation sharply increased the frequency of IL-17 producing 1807 T cells (
[0127] Addition of Bl-Eng2 to the vaccine also reduced lung CFU as early as four days after mice received a lethal experimental challenge, and did so in a concentration-dependent manner (
[0128] Bl-Eng2 failed to increase the development of Th17 and Th1 cells, the production ex vivo of IL-17 and IFN-? or reduce lung CFU in Dectin-2.sup.?/? mice, verifying that the adjuvant effect is Dectin-2-dependent in vivo (
[0129] The studies above exploited TCR Tg T cells to sensitively report the ability of Bl-Eng2 to enhance development of calnexin Ag-specific Th17 and Th1 cells upon vaccination. However, adoptive transfer of these cells into mice artificially enhances the number of CD4.sup.+ T cell precursors in the animal. To investigate whether Bl-Eng2 also has the capacity to induce the development of endogenous calnexin-Ag specific CD4.sup.+ T cells and similarly protect animals, we vaccinated wild type mice in the absence of adoptive transfer. The formulation of Bl-Eng2 with the calnexin subunit vaccine again reduced lung CFU by over two logs vs. control mice vaccinated with calnexin in mineral oil alone (IFA), and by over 3 logs vs. mice that got IFA alone (
[0130] Bl-Eng-2 Augments In Vivo Killing of Fungi by Neutrophils (PMN) and Alveolar Macrophages
[0131] To investigate the downstream myeloid effector mechanisms of Bl-Eng-2 adjuvancy we used red fluorescent B. dermatitidis yeast to report phagocytic uptake and fungal viability during cellular interactions with the murine leukocytes. The concept of using fluorescence to monitor microbial fate and investigate functional outcomes of individual microbial cell-host cell encounters has been introduced recently and provides a powerful strategy to measure effector mechanisms in vivo. At day 4 post-infection, mice vaccinated with calnexin+Bl-Eng-2 and calnexin+Alum+Bl-Eng-2 showed increased activation and killing by neutrophils and alveolar macrophages vs. calnexin and calnexin+Alum controls (
[0132] Discussion
[0133] We describe a novel ligand for Dectin-2: Bl-Eng2. Discovery of a potent CLR ligand may address a limitation of current vaccines: the lack of adjuvants that elicit protective cell-mediated immunity. The approach we took to identify Bl-Eng2 was based on prior work from our group and other laboratories. Dectin-2 recognizes and mediates host defense against several fungi including C. albicans, C. glabrata, A. fumigatus, Malassezia spp., Coccidiodes posadasii, Histoplasma capsulatum and B. dermatitidis. Additionally, Dectin-2.sup.?/? mice vaccinated with attenuated B. dermatitidis yeast fail to prime Ag-specific Th1 and Th17 cells or acquire vaccine resistance to pulmonary infection. Thus, Dectin-2 regulates innate recognition of the fungal vaccine, and the development of a protective cellular immune response. Hence, we sought to identify the Dectin-2 ligand from the vaccine strain. We hypothesized that the ligand would prime APC to produce cytokines (e.g. IL-6) that are known to foster the development of Th17 cells that protect against lethal fungal challenge.
[0134] By using Dectin-2 reporter cells as a probe, we enriched and identified Bl-Eng2 by ConA binding, gel filtration and Mass spectrometry. The identification of Bl-Eng2 also led us to unveil the unappreciated role of Asp-Eng2 in binding Dectin-2. Both Eng2 proteins are bona fide Dectin-2 ligands since they trigger NFAT signaling in Dectin-2 reporter cells. Bl-Eng2 features a 45.2% overall and 60.1% GH16 domain sequence similarity to Eng2 from A. fumigatus (Asp-Eng2) and contains a Ser/Thr-rich C-terminus that both proteins have in common. Bl-Eng2 and Asp-Eng2 respectively harbor 68 and 74 potential O-linked glycosylation sites within their respective 134-aa and 234-aa long Ser/Thr-rich C-terminus, but display no consensus sites for N-linked glycosylation (Asn-X-Ser/Thr). In addition to the Eng2 glycoproteins, we now also establish here that MP98 from C. neoformans serves as a ligand for Dectin-2.
[0135] Dectin-2 has been reported to recognize high mannose structures of fungi, such as ?-1,2-mannan from C. albicans and furfurman, which is a mannoprotein from Malassezia spp. Man-Lam from M. tuberculosis consists of four components: a mannosyl-phophatidyl-myo-inositol (MPI) anchor, a mannose backbone, an arabinan domain, and a ?1,2-mannose cap. MP98 from C. neoformans is a mannoprotein with a Mr of 98 kDa; it contains 12 possible N-linked glycosylation sites, and 103 Ser/Thr residues at the C-terminus that serve as potential 0-linked glycosylation sites. The minimal unit of Bl-Eng2 that confers ligand activity is uncertain. Since both mannosidase and proteinase K digestion of CWE starting material reduced Dectin-2 ligand activity, both the protein and glycan moieties of Bl-Eng2 may contribute to its action, perhaps explaining its superior stimulation of cytokine responses compared to the other ligands.
[0136] We found that recombinant Bl-Eng2 elicits potent downstream functions. It induces the production of IL-6 by BMDC in a Dectin-2- and Card9-dependent manner. In addition, Bl-Eng2 induces the production of IL-6 and IL-1? by human PBMC, which may have strong implications for the translational aspect of our discovery. In comparison to previously described Dectin-2 ligands, Bl-Eng2 triggers superior cytokine production by murine BMDC. Ligand induced IL-6 production was >100 fold higher for Bl-Eng2 than the other Dectin-2 ligands: Furfurman from Malassezia spp. and Mannose-capped lipoarabinomannan (Man-Lam) from M. tuberculosis and MP98 from C. neoformans.
[0137] Bl-Eng2 induction of T cell priming cytokines by APCs efficiently promoted the development of calnexin Ag-specific Th17 cells (more so than Th1 cells), and recall of these cells to the lung upon fungal challenge of vaccinated mice. The large numbers of pro-inflammatory T cells sharply reduced lung CFU and increased survival after infection of Bl-Eng2 vaccinated vs. control mice. In comparison, combining commercial Alum with the calnexin subunit vaccine did not show an adjuvant effect. However, Bl-Eng-2 combined with Alum augmented its adjuvancy indicating that Bl-Eng-2 has the potential to improve T cell priming by the commercially available and FDA approved Alum. Thus, in our subunit vaccine model, Bl-Eng2-induced Dectin-2 signaling was associated with cellular immune responses that protected mice against lethal pulmonary fungal infection. Although not experimentally addressed in this manuscript, it is conceivable that Bl-Eng-2 can also augment the induction of CD4.sup.+ T cell-dependent antibody responses that promote host protection against fungi, especially when combined with Alum since the latter is known to stimulate both T and B cell immune responses. It remains to be investigated whether antibody will be protective in our vaccine setting.
[0138] We previously reported that mice vaccinated with calnexin and other adjuvants (glucan particles engaging Dectin-1, Adjuplex, or the combination) were optimally protected when we adoptive transferred na?ve 1807 cells to increase the pool of Ag-experienced CD4.sup.+ T cells. Here, the addition of Bl-Eng2 to the same calnexin vaccine reduced lung CFU by more than two to three logs vs. control mice even without adoptive transfer of large numbers of na?ve 1807 T cell precursors. These results imply that engagement of Dectin-2 by Bl-Eng2 may be better than engagement of Dectin-1 by glucan particles and other previously used adjuvants at expanding the pool of endogenous calnexin-specific CD4.sup.+ T cell precursors or that Bl-Eng2 induced individual Ag-experienced cells to produce larger amounts of effector cytokines. Thus, Bl-Eng2 may be a powerful vaccine adjuvant in situations where T cell precursors are low in number and adoptive transfer of na?ve T cell precursors is either not feasible or too costly.
[0139] In contrast to the protective effects of Bl-Eng2 vaccination, Man-Lam induced Dectin-2 responses that caused Th17 cell-mediated autoimmune disease pathology and EAE. Man-Lam stimulation of Dectin-2 lead to the development of MOG.sub.35-55 peptide-specific T cells that produced IL-17, IFN-? and GM-CSF upon ex vivo stimulation. This could simply relate to model selection rather than adjuvant efficiency. Thus, it is unclear whether Man-Lam is capable of inducing protective T cell immunity in an infectious disease setting. Although C. neoformans MP98 and its glycan modifications also promoted T cell activation, the T-helper phenotype and functional role in resistance by primed T cells were not investigated.
[0140] In conclusion, among the few Dectin-2 ligands reported to date, or newly discovered here, Bl-Eng2 is the most potent at stimulating murine and human cells to produce cytokines known to foster the development of protective Th17 and Th1 cells e.g. IL-6 and IL-1?. The production of IL-17 and IFN-? by Th17 and Th1 cells then promotes the activation and killing of fungi by myeloid effector cells such as neutrophils and alveolar macrophages. Since Bl-Eng2 also greatly augments protective immunity mediated by a subunit vaccine, Bl-Eng2 could potentially be harnessed as an adjuvant for vaccination against infectious disease that requires cellular immunity for host defense. The structural basis underpinning Bl-Eng2 potency as an adjuvant will be important to investigate and understand so that those features can be harnessed for vaccine development in the fight against infectious disease due to intracellular pathogens.
[0141] Material and Methods
[0142] Fungi
[0143] Strains used were wild-type, virulent B. dermatitidis ATCC strain 26199, DsRed26199 and strain #55, the isogenic, attenuated mutant lacking BAD1. B. dermatitidis was grown as yeast on Middlebrook 7H10 agar with oleic acid-albumin complex (Sigma) at 39? C.
[0144] Mouse Strains
[0145] Inbred wild type C57BL/6 and congenic B6. PL-Thy1.sup.a/Cy (stock #00406) mice carrying the Thy 1.1 allele were obtained from Jackson Laboratories, Bar Harbor, Me. Blastomyces-specific TCR Tg 1807 mice were generated in our lab and were backcrossed to congenic Thy1.1.sup.+ mice as described elsewhere. Dectin-2.sup.?/? mice were bred at our facility. Mice were 7-8 weeks old at the time of these experiments. Mice were housed and cared for as per guidelines of the University of Wisconsin Animal Care Committee who approved all aspects of this work.
[0146] Preparation of CWE
[0147] Blastomyces dermatitidis yeast were harvested from 7H10 agar, washed with H.sub.2O, and sonicated for 3 min on ice. After centrifuging, the soluble extract was collected, passed through a 0.45-?m pore-size filter and used as CWE. The protein level was measured with the Pierce BCA assay (Thermo Fisher Scientific).
[0148] Enrichment of Mannosylated Proteins and Mass Spectrometry Analysis
[0149] To enrich the mannosylated proteins, CWE was incubated with Concanavalin A (ConA) Sepharose resin (Sigma-Aldrich), and the bound fraction was eluted with methyl-?-D-mannopyranoside as described previously. The ConA-enriched proteins were then applied to a size exclusion column of Ultragel AcA 44 resin (Pall) and eluted with PBS. The ConA enrichment and size exclusion fractions were assessed using SDS-PAGE and silver staining. Size exclusion fractions that contained Dectin-2 ligand activity were analyzed by mass spectrometry as previously described at the Mass Spectrometry Facility, University of Wisconsin-Madison. Briefly, peptides were analyzed by nano-LC-MS/MS using the Agilent 1100 nanoflow system (Agilent Technologies) connected to a hybrid linear ion trap-orbitrap mass spectrometer (LTQ-Orbitrap XL, Thermo Fisher Scientific) equipped with a nanoelectrospray ion source.
[0150] Generation and Purification of r-Bl-Eng2
[0151] Bl-Eng2 was cloned and expressed in P. pastoris using standard recombinant techniques. Total RNA was extracted from B. dermatitidis yeast and transcribed to cDNA as previously described. Using the cDNA as a template, the Bl-ENG2 coding sequence was amplified using KOD Hot Start DNA Polymerase (Toyobo) with primers 5-GGCTCGAGAAAAGAGAGGCTGAAGCTAGGGCTACCAAGCTCGCGTT (SEQ ID NO:9) and 5-GTTTCTAGACCGTACTTGTCATTTGTGGGGTATCCCG (SEQ IN NO:10), and inserted in-frame into the XhoI/XbaI sites of the pPICZ?A vector (Invitrogen). The resulting expression vector was then linearized with PmeI and transformed into Pichia pastoris strain X-33 (Invitrogen) by electroporation. Yeast colonies were screened for Bl-Eng2 protein expression by Western blot analysis using an anti-His antibody (Cell Signaling Technology). Bl-Eng2 protein secreted from methanol-induced yeast cells was purified using Ni-NTA agarose (Qiagen) according to the manufacturer's protocol, and dialyzed against PBS. Purity of recombinant Bl-Eng2 was assessed by SDS-PAGE and silver staining. Without being bound to any particular theory, it is believed that the alpha-factor signal peptide is excised from the recombinant Bl-Eng2 upon secretion of the protein from the yeast. The predicted sequence of the Bl-Eng2 recombinant protein after excision of the alpha-factor signal peptide is included below.
[0152] Predicted recombinant Bl-Eng2 protein: alpha-factor signal peptide excised during secretion (SEQ ID NO:11).
TABLE-US-00001 RATKLALLAALAKLSTGAYVLQDDYQPSNFFDDFAFFDGPDPSNAYVTYV DKSKALRDGLASNNNDFVYLGVDHQNVARGRGRESVRLETKKSYKHGLIV ADISHMPGNICGTWPAFWATGATWPDDGEFDIIEGVNKQNKNVVALHTTA GCKVEDNNKYSGILVTKDCDVYSPNQPSNQGCLFRAPSATSYGTAFNSIG GGVYATEWTSDSISVWFFPRYQIPSNINDENPDPSTWPRPIAHFTGCEFD KFFQEQRIIFNTAFCGDWAKATWNENGCAAGGRTCEDYVKNNPWAFSEAF WSINYMKVFQNKQGDTSTSTTTSSTSSTSSSSTEAPTTTMTTSSTYEPSV SSSTAPEPSQSASTPSEYPQPSTAEPTASSSSYPKSSFASTDSPVPTDYP VPSSDEPTVPSATYSESSPVPTDYPVPSSDEPTVPSATYSESLPSASAPS EYPTGTASVDPTDVSSCTPPPTQSCITYTTKTTIAIVVTAPESYKEAIQT ESAEDETEPAAYPTEPAGYPTNDKYGLEQKLISEEDLNSAVDHHHHHH
[0153] Carbohydrate Analysis
[0154] Bl-Eng2 protein glycosylation was assessed using the Pierce Glycoprotein Staining Kit (Thermo Fisher Scientific). Monosaccharide composition was determined by gas chromatography as described elsewhere.
[0155] CLR Reporter Assay
[0156] B3Z/BWZ reporter cells expressing Dectin-2, Mincle, MCL and Dectin-1 have been described previously. For B3Z/BWZ cell stimulation, 10.sup.5 B3Z/BWZ cells per well in a 96-well plate were incubated for 18 h with heat-killed fungal cells or plate-coated ligands. ?-galactosidase (lacZ) activity was measured in total cell lysates using CPRG (Roche) as a substrate. OD 560 was measured using OD 620 as a reference.
[0157] Stimulation of Mouse BMDCs or Human PBMCs and Cytokine DetectionGeneration of bone marrow-derived dendritic cells (BMDCs) has been described previously. Peripheral blood mononuclear cells (PBMCs) were isolated from heparinized whole blood collected over Ficoll-Paque Plus (GE). 1-2?10.sup.5 BMDCs or 5?10.sup.5 PBMCs per well in a 96-well plate were incubated with plate-bound Bl-Eng2. After 24 h, supernatants were collected and cytokine levels were measured by ELISA (R&D Systems or Biolegend) according to the manufacturer's specifications.
[0158] Vaccination with Calnexin and Bl-Eng2 and Enumeration of Rare Epitope-Specific T Cells
[0159] Prior to vaccination, mice received adoptively transferred na?ve 1807 T cells or not. Mice were vaccinated twice subcutaneously with 10 ?g recombinant calnexin and 10 ?g Bl-Eng2 formulated in incomplete Freund's adjuvant (IFA), two weeks apart. Two weeks after the boost, mice were challenged with 2?10.sup.4 26199 yeast and analyzed for lung T cell responses (at day 4 post-infection) and lung CFU (at day 4 or two weeks post-infection). 1807 T cell responses were detected with the congenic Thy1.1 marker and endogenous, calnexin-specific T cells by tetramer. T cells were detected using the following antibodies: tetramer-PE, CD4-BUV395, CD8-PeCy7, CD3-BV421, CD90.2-BV785, CD44-BV650, Live-dead Near IR, IFN-?-A488 and IL-17-A647.
[0160] Intracellular Cytokine Stain
[0161] Lung cells were harvested at day 4 post-infection. Cells (0.5?10.sup.6 cells/ml) were stimulated for 5 hours with anti-CD3 (clone 145-2C11; 0.1 ?g/ml) and anti-CD28 (clone 37.51; 1 ?g/ml) in the presence of Golgi-Stop (BD Biosciences). Stimulation with fungal ligands yielded comparable cytokine production by transgenic T-cells compared to CD3/CD28 stimulation. After cells were washed and stained for surface CD4 and CD8 using anti-CD4 BV395, anti-CD8 PeCy7, and anti-CD44-FITC mAbs (Pharmingen), they were fixed and permeabilized in Cytofix/Cytoperm at 4? C. overnight. Permeabilized cells were stained with anti-IL-17A PE and anti-IFN-? Alexa 700 (clone XMG1.2) conjugated mAbs (Pharmingen) in FACS buffer for 30 min at 4? C., washed, and analyzed by FACS. Cells were gated on CD4 and cytokine expression in each gate analyzed. The number of cytokine positive CD4.sup.+ T cells per lung was calculated by multiplying the percent of cytokine-producing cells by the number of CD4.sup.+ T cells in the lung.
[0162] The Generation of Bone Marrow Dendritic Cells
[0163] Bone marrow-derived dendritic cells (BMDCs) were obtained from the femurs and tibias of individual mice. Each bone was flushed with 10 ml of 1% FBS in RPMI through a 22G needle. Red blood cells were lysed followed by wash and re-suspension of cells in 10% FBS in RPMI medium. In a petri dish, 2?10.sup.6 bone marrow cells were plated in 10 ml of RPMI containing 10% FBS plus penicillin-streptomycin (P/S) (HyClone), 2-mercaptoethanol and 20 ng/ml of rGM-CSF. The culture media were refreshed every three days and BMDCs were harvested after 10 days for in vitro co-culture assays.
[0164] Ex vivo stimulation of primed T cells for cytokine protein measurementEx vivo cell culture supernatants were generated using the brachial and inguinal draining lymph nodes harvested from mice 28 days post-vaccination and at day 4 post-infection, washed and resuspended in complete RPMI containing 10 ?g/ml recombinant calnexin, and plated in 96-well plates at a concentration of 5?10.sup.5 cells/well. Supernatants were collected from ex vivo co-cultures after three days of incubation at 37? C. and 5% CO.sub.2. IFN-? and IL-17 (R&D System) were measured by ELISA according to manufacturer specifications (detection limits, 0.05 ng/ml and 0.02 ng/ml, respectively).
[0165] Tracking Association of Yeast with Neutrophils and Alveolar Macrophages In Vivo
[0166] Mice were euthanized three days after challenge i.t. with 10.sup.5 DsRed yeast and hearts were perfused with PBS to remove blood from the lungs to improve staining. Lungs were dissociated, digested and stained as described previously. In summary, lungs were dissociated and digested in buffer containing collagenase D and DNase I. After erythrocyte lysis, cells were stained for myeloid cell markers and then fixed in Cytofix/Cytoperm (BD Biosciences, San Jose, Calif.). Cells were stained for 30 minutes at room temperature with 1 ?g/ml Uvitex-2B (Polysciences, Warrington, Pa.) diluted in BD perm/wash buffer and then subsequently washed with BD perm/wash buffer and fixed with 2% paraformaldehyde.
[0167] Statistics
[0168] Differences in the number of cells and lung CFU were analyzed using Wilcoxon rank and Mann Whitney test for non-parametric data or a T-test if data were normally distributed. A Bonferroni adjustment was used to correct for multiple tests. A value of P<0.05 is considered significant.
Example 2
[0169] The embodiment described herein demonstrates the use of Bl-Eng2 as a vaccine adjuvant in bacterial and viral vaccines. As demonstrated in
Example 3
[0170] The embodiment described herein demonstrates the use of Bl-Eng2 as a novel antigen for use in vaccine compositions. As demonstrated in
[0171] This peptide could also be used to expand autologous, endogenous Bl-Eng2-specific T cells of patients that will undergo transplantation, chemotherapy or other immunocompromising treatments to boost their immunity against fungal infection (e.g. cellular immunotherapy following stem cell transplantation). The lethality of invasive pulmonary infection with Aspergillus fumigatus is 50-90% in that patient population.
REFERENCES
[0172] 1. Brown G D, Denning D W, Gow N A, Levitz S M, Netea M G, et al. (2012) Hidden killers: human fungal infections. Sci Transl Med 4: 165rv113. [0173] 2. Brown G D, Denning D W, Levitz S M (2012) Tackling human fungal infections. Science 336: 647. [0174] 3. Romani L (2011) Immunity to fungal infections. Nat Rev Immunol 11: 275-288. [0175] 4. W?thrich M, Deepe G S, Jr., Klein B (2012) Adaptive immunity to fungi. Annu Rev Immunol 30: 115-148. [0176] 5. Leibundgut-Landmann S, W?thrich M, Hohl T M (2012) Immunity to fungi. Curr Opin Immunol 24: 449-458. [0177] 6. W?thrich M, Gem B, Hung C Y, Ersland K, Rocco N, et al. (2011) Vaccine-induced protection against 3 systemic mycoses endemic to North America requires Th17 cells in mice. J Clin Invest 121: 554-568. [0178] 7. Zelante T, De Luca A, Bonifazi P, Montagnoli C, Bozza S, et al. (2007) IL-23 and the Th17 pathway promote inflammation and impair antifungal immune resistance. Eur J Immunol 37: 2695-2706. [0179] 8. Mori A, Oleszycka E, Sharp F A, Coleman M, Ozasa Y, et al. (2012) The vaccine adjuvant alum inhibits IL-12 by promoting PI3 kinase signaling while chitosan does not inhibit IL-12 and enhances Th1 and Th17 responses. Eur J Immunol 42: 2709-2719. [0180] 9. Gringhuis S I, Wevers B A, Kaptein T M, van Capel T M, Theelen B, et al. (2011) Selective C-Rel activation via Malt1 controls anti-fungal T(H)-17 immunity by dectin-1 and dectin-2. PLoS Pathog 7: e1001259. [0181] 10. Gringhuis S I, den Dunnen J, Litjens M, van der Vlist M, Wevers B, et al. (2009) Dectin-1 directs T helper cell differentiation by controlling noncanonical NF-kappaB activation through Raf-1 and Syk. Nat Immunol 10: 203-213. [0182] 11. Geijtenbeek T B, Gringhuis S I (2009) Signalling through C-type lectin receptors: shaping immune responses. Nat Rev Immunol 9: 465-479. [0183] 12. LeibundGut-Landmann S, Gross O, Robinson M J, Osorio F, Slack E C, et al. (2007) Syk- and CARDS-dependent coupling of innate immunity to the induction of T helper cells that produce interleukin 17. Nat Immunol 8: 630-638. [0184] 13. Robinson M J, Osorio F, Rosas M, Freitas R P, Schweighoffer E, et al. (2009) Dectin-2 is a Syk-coupled pattern recognition receptor crucial for Th17 responses to fungal infection. J Exp Med 206: 2037-2051. [0185] 14. Saijo S, Ikeda S, Yamabe K, Kakuta S, Ishigame H, et al. (2010) Dectin-2 recognition of alpha-mannans and induction of Th17 cell differentiation is essential for host defense against Candida albicans. Immunity 32: 681-691. [0186] 15. Zhu L L, Zhao X Q, Jiang C, You Y, Chen X P, et al. (2013) C-type lectin receptors Dectin-3 and Dectin-2 form a heterodimeric pattern-recognition receptor for host defense against fungal infection. Immunity 39: 324-334. [0187] 16. Rivera A, Hohl T M, Collins N, Leiner I, Gallegos A, et al. (2011) Dectin-1 diversifies Aspergillus fumigatus-specific T cell responses by inhibiting T helper type 1 CD4 T cell differentiation. J Exp Med 208: 369-381. [0188] 17. Loures F V, Rohm M, Lee C K, Santos E, Wang J P, et al. (2015) Recognition of Aspergillus fumigatus hyphae by human plasmacytoid dendritic cells is mediated by dectin-2 and results in formation of extracellular traps. PLoS Pathog 11: e1004643. [0189] 18. Carrion Sde J, Leal S M, Jr., Ghannoum M A, Aimanianda V, Latge J P, et al. (2013) The RodA hydrophobin on Aspergillus fumigatus spores masks dectin-1- and dectin-2-dependent responses and enhances fungal survival in vivo. J Immunol 191: 2581-2588. [0190] 19. Wang H, Lebert V, Hung C Y, Galles K, Saijo S, et al. (2014) C-type lectin receptors differentially induce th17 cells and vaccine immunity to the endemic mycosis of north America. J Immunol 192: 1107-1119. [0191] 20. Yonekawa A, Saijo S, Hoshino Y, Miyake Y, Ishikawa E, et al. (2014) Dectin-2 is a direct receptor for mannose-capped lipoarabinomannan of mycobacteria. Immunity 41: 402-413. [0192] 21. W?thrich M, Brandhorst T T, Sullivan T D, Filutowicz H, Sterkel A, et al. (2015) Calnexin induces expansion of antigen-specific CD4(+) T cells that confer immunity to fungal ascomycetes via conserved epitopes. Cell Host Microbe 17: 452-465. [0193] 22. Hartl L, Gastebois A, Aimanianda V, Latge J P (2011) Characterization of the GPI-anchored endo beta-1,3-glucanase Eng2 of Aspergillus fumigatus. Fungal Genet Biol 48: 185-191. [0194] 23. McGreal E P, Rosas M, Brown G D, Zamze S, Wong S Y, et al. (2006) The carbohydrate-recognition domain of Dectin-2 is a C-type lectin with specificity for high mannose. Glycobiology 16: 422-430. [0195] 24. Sato K, Yang X L, Yudate T, Chung J S, Wu J, et al. (2006) Dectin-2 is a pattern recognition receptor for fungi that couples with the Fc receptor gamma chain to induce innate immune responses. J Biol Chem 281: 38854-38866. [0196] 25. Ishikawa T, Itoh F, Yoshida S, Saijo S, Matsuzawa T, et al. (2013) Identification of Distinct Ligands for the C-type Lectin Receptors Mincle and Dectin-2 in the Pathogenic Fungus Malassezia. Cell Host Microbe 13: 477-488. [0197] 26. Taylor P R, Roy S, Leal S M, Jr., Sun Y, Howell S J, et al. (2014) Activation of neutrophils by autocrine IL-17A-IL-17RC interactions during fungal infection is regulated by IL-6, IL-23, RORgammat and dectin-2. Nat Immunol 15: 143-151. [0198] 27. Levitz S M, Nong S, Mansour M K, Huang C, Specht C A (2001) Molecular characterization of a mannoprotein with homology to chitin deacetylases that stimulates T cell responses to Cryptococcus neoformans. Proc Natl Acad Sci USA 98: 10422-10427. [0199] 28. W?thrich M, Ersland K, Sullivan T, Galles K, Klein B S (2012) Fungi subvert vaccine T cell priming at the respiratory mucosa by preventing chemokine-induced influx of inflammatory monocytes. Immunity 36: 680-692. [0200] 29. Jhingran A, Mar K B, Kumasaka D K, Knoblaugh S E, Ngo L Y, et al. (2012) Tracing conidial fate and measuring host cell antifungal activity using a reporter of microbial viability in the lung. Cell Rep 2: 1762-1773. [0201] 30. Ifrim D C, Bain J M, Reid D M, Oosting M, Verschueren I, et al. (2014) Role of Dectin-2 for host defense against systemic infection with Candida glabrata. Infect Immun 82: 1064-1073. [0202] 31. Lin L, Ibrahim A S, Xu X, Farber J M, Avanesian V, et al. (2009) Th1-Th17 cells mediate protective adaptive immunity against Staphylococcus aureus and Candida albicans infection in mice. PLoS Pathog 5: e1000703. [0203] 32. Spellberg B, Ibrahim A S, Lin L, Avanesian V, Fu Y, et al. (2008) Antibody titer threshold predicts anti-candidal vaccine efficacy even though the mechanism of protection is induction of cell-mediated immunity. J Infect Dis 197: 967-971. [0204] 33. Lam J S, Mansour M K, Specht C A, Levitz S M (2005) A model vaccine exploiting fungal mannosylation to increase antigen immunogenicity. J Immunol 175: 7496-7503. [0205] 34. Specht C A, Nong S, Dan J M, Lee C K, Levitz S M (2007) Contribution of glycosylation to T cell responses stimulated by recombinant Cryptococcus neoformans mannoprotein. J Infect Dis 196: 796-800. [0206] 35. Sterkel A K, Lorenzini J L, Fites J S, Subramanian Vignesh K, Sullivan T D, et al. (2016) Fungal Mimicry of a Mammalian Aminopeptidase Disables Innate Immunity and Promotes Pathogenicity. Cell Host Microbe 19: 361-374. [0207] 36. Brandhorst T T, W?thrich M, Warner T, Klein B (1999) Targeted gene disruption reveals an adhesin indispensable for pathogenicity of Blastomyces dermatitidis. J Exp Med 189: 1207-1216. [0208] 37. Marty A J, Wuthrich M, Carmen J C, Sullivan T D, Klein B S, et al. (2013) Isolation of Blastomyces dermatitidis yeast from lung tissue during murine infection for in vivo transcriptional profiling. Fungal Genet Biol 56: 1-8. [0209] 38. Zarnowski R, Westler W M, Lacmbouh G A, Marita J M, Bothe J R, et al. (2014) Novel entries in a fungal biofilm matrix encyclopedia. MBio 5: e01333-01314. [0210] 39. W?thrich M, Wang H, Li M, Lerksuthirat T, Hardison S E, et al. (2015) Fonsecaea pedrosoi-induced Th17-cell differentiation in mice is fostered by Dectin-2 and suppressed by Mincle recognition. Eur J Immunol 45: 2542-2552. [0211] 40. W?thrich M, Filutowicz H I, Klein B S (2000) Mutation of the WI-1 gene yields an attenuated Blastomyces dermatitidis strain that induces host resistance. J Clin Invest 106: 1381-1389.