Nucleic acid construct
11613559 · 2023-03-28
Assignee
Inventors
Cpc classification
C07K2319/33
CHEMISTRY; METALLURGY
C07K2319/30
CHEMISTRY; METALLURGY
C07K2319/70
CHEMISTRY; METALLURGY
International classification
C07K14/705
CHEMISTRY; METALLURGY
C07K16/28
CHEMISTRY; METALLURGY
Abstract
The present invention provides a nucleic acid construct comprising the following structure: A-X-B in which A is nucleic acid sequence encoding a first polypeptide which comprises a first signal peptide; B is nucleic acid sequence encoding a second polypeptide which comprises a second signal peptide and X is a nucleic acid sequence which encodes a cleavage site, wherein the first signal peptide or the second signal peptide comprises one or more mutation(s) such that it has fewer hydrophobic amino acids.
Claims
1. A nucleic acid construct comprising the following structure:
A-X-B in which (a) A is nucleic acid sequence encoding a first polypeptide which comprises a first signal peptide attached to a first mature protein, the first signal peptide having a tripartite structure containing a hydrophobic core region (h-region) flanked by an n-region and a c-region, (b) B is nucleic acid sequence encoding a second polypeptide which comprises a second signal peptide attached to a second mature protein, the second signal peptide having a tripartite structure containing a hydrophobic core region (h-region) flanked by an n-region and a c-region, and (c) X is a nucleic acid sequence which encodes a cleavage site, wherein the first signal peptide and the second signal peptide are derived from the same signal sequence having the same n- and c-regions, but the first signal peptide or the second signal peptide differ in the h-region, one signal peptide having 1, 2, 3, 4, or 5 amino acid deletions or substitutions in the h-region to remove or replace one or more hydrophobic amino acids compared to the other signal peptide such that the signal peptide with the amino acid deletions or substitutions has 1, 2, 3, 4, or 5 fewer hydrophobic amino acids in the h-region than the other signal peptide, and wherein differences between the first and the second signal peptides in the h-region are such that when the nucleic acid construct is expressed in an eukaryotic cell, there is differential relative expression of the first and second mature proteins.
2. The nucleic acid construct according to claim 1, wherein the hydrophobic amino acid(s) is/are selected from the group consisting of Alanine (A), Valine (V), Isoleucine (I), Leucine (L), Methionine (M), Phenylalanine (F), Tyrosine (Y), and Tryptophan (W).
3. The nucleic acid construct according to claim 2, wherein the hydrophobic amino acid(s) is/are selected from the group consisting of Valine (V), Isoleucine (I), Leucine (L), and Tryptophan (W).
4. The nucleic acid construct according to claim 1, wherein the first and second polypeptides are both transmembrane proteins, and wherein there is differential relative expression of the first and second transmembrane proteins at the cell surface.
5. The nucleic acid construct according to claim 4, wherein the first and second transmembrane proteins are both chimeric antigen receptors (CARs).
6. The nucleic acid construct according to claim 1, wherein the cleavage site is a self-cleaving peptide, a furin cleavage site or a Tobacco Etch Virus cleavage site.
7. An expression vector comprising the nucleic acid construct according to claim 1.
8. A retroviral vector or a lentiviral vector according to claim 7.
9. An isolated eukaryotic cell comprising the nucleic acid construct according to claim 1.
10. The isolated eukaryotic cell according to claim 9 which is a T cell or a natural killer (NK) cell.
11. The isolated eukaryotic cell according to claim 9 that is an isolated mammalian cell.
Description
DESCRIPTION OF THE FIGURES
(1)
(2) (a) Two different promoters within the same cassette result in two different transcripts which each give rise to separate proteins. (b) Use of an Internal Ribosome Entry sequence (IRES) leads to a single transcript which is translated into two separate proteins. (c) Use of the FMDV 2A peptide results in a single transcript, and a single polyprotein which rapidly cleaves into two separate proteins.
(3)
(4)
(5)
(6) PCT/GB2014/053452 describes vector system encoding two chimeric antigen receptors (CARs), one against CD19 and one against CD33. The signal peptide used for the CARs in that study was the signal peptide from the human CD8a signal sequence. For the purposes of this study, this was substituted with the signal peptide from the murine Ig kappa chain V-III region, which has the sequence: METDTLILWVLLLLVPGSTG (SEQ ID NO: 35) (hydrophobic residues highlighted in bold). In order to establish that the murine Ig kappa chain V-III signal sequence functioned as well as the signal sequence from human CD8a, a comparative study was performed. For both signal sequences, functional expression of the anti-CD33 CAR and the anti-CD19 CAR was observed.
(7)
(8)
(9)
(10)
DETAILED DESCRIPTION
(11) The present invention provides a nucleic acid construct comprising the following structure:
A-X-B in which
A is nucleic acid sequence encoding a first polypeptide which comprises a first signal peptide;
B is nucleic acid sequence encoding a second polypeptide which comprises a second signal peptide and
X is a nucleic acid sequence which encodes a cleavage site,
wherein the first signal peptide or the second signal peptide comprises one or more mutation(s) such that it has fewer hydrophobic amino acids.
(12) Nucleic Acid Construct
(13) Polypeptide
(14) The polypeptides made by the nucleic acid construct of the invention are signal peptide-containing polypeptides, such as secreted, transmembrane or organelle proteins.
(15) Signal Peptide
(16) The polypeptides A and B (and optionally others, C, D etc) encoded by the nucleic acid construct of the invention each comprise may a signal sequence so that when the polypeptide is expressed inside a cell the nascent protein is directed to the endoplasmic reticulum (ER) (see
(17) The term “signal peptide” is synonymous with “signal sequence”.
(18) A signal peptide is a short peptide, commonly 5-30 amino acids long, present at the N-terminus of the majority of newly synthesized proteins that are destined towards the secretory pathway. These proteins include those that reside either inside certain organelles (for example, the endoplasmic reticulum, golgi or endosomes), are secreted from the cell, and transmembrane proteins.
(19) Signal peptides commonly contain a core sequence which is a long stretch of hydrophobic amino acids that has a tendency to form a single alpha-helix. The signal peptide may begin with a short positively charged stretch of amino acids, which helps to enforce proper topology of the polypeptide during translocation. At the end of the signal peptide there is typically a stretch of amino acids that is recognized and cleaved by signal peptidase. Signal peptidase may cleave either during or after completion of translocation to generate a free signal peptide and a mature protein. The free signal peptides are then digested by specific proteases.
(20) The signal peptide is commonly positioned at the amino terminus of the molecule, although some carboxy-terminal signal peptides are known.
(21) As mentioned above, signal sequences have a tripartite structure, consisting of a hydrophobic core region (h-region) flanked by an n- and c-region. The latter contains the signal peptidase (SPase) consensus cleavage site. Usually, signal sequences are cleaved off co-translationally, the resulting cleaved signal sequences are termed signal peptides.
(22) In the signal peptide from the murine Ig kappa chain V-III region, which has the sequence: METDTLILWVLLLLVPGSTG (SEQ ID NO: 35): the n-region has the sequence METD; the h-region (shown in bold) has the sequence TLILWVLLLV; and the c-region has the sequence PGSTG.
(23) In the nucleic acid construct of the present invention the signal sequence of the two (or more) polypeptides differ in their h-regions. One polypeptide (which has higher relative expression) has a greater number of hydrophobic amino acids in the h-region that the other polypeptide (which has lower relative expression). The signal peptide of the polypeptide with lower relative expression may comprise one or more amino acid mutations, such as substitutions or deletions, of hydrophobic amino acids in the h-region than the signal peptide of the polypeptide with lower relative expression.
(24) The first signal peptide and the second signal peptide may have substantially the same n- and c-regions, but differ in the h-region as explained above. “Substantially the same” indicates that the n- and c-regions may be identical between the first and second signal peptide or may differ by one, two or three amino acids in the n- or c-chain, without affecting the function of the signal peptide.
(25) The hydrophobic amino acids in the core may, for example, be: Alanine (A); Valine (V); Isoleucine (I); Leucine (L); Methionine (M); Phenylalanine (F); Tyrosine (Y); or Tryptophan (W).
(26) The hydrophobic acids mutated in order to alter signal peptide efficiency may be any from the above list, in particular: Valine (V); Isoleucine (I); Leucine (L); and Tryptophan (W).
(27) Of the residues in the h-region, one signal peptide (for example, the altered signal peptide) may comprise at least 10%, 20%, 30%, 40% or 50% fewer hydrophobic amino acids than the other signal peptide (for example, the unaltered signal peptide).
(28) Where the h-region comprises 5-15 amino acids, one signal peptide may comprise 1, 2, 3, 4 or 5 more hydrophobic amino acids than the other signal peptide.
(29) The altered signal peptide may comprise 1, 2, 3, 4 or 5 amino acid deletions or substitutions of hydrophobic amino acids. Hydrophobic amino acids may be replaced with non-hydrophobic amino acids, such as hydrophilic or neutral amino acids.
(30) Signal sequences can be detected or predicted using software techniques (see for example, http COLON-SLASH-SLASH www.predisi.de/).
(31) A very large number of signal sequences are known, and are available in databases. For example, http COLON-SLASH-SLASH www.signalpeptide.de lists 2109 confirmed mammalian signal peptides in its database.
(32) Table 1 provides a list of signal sequences purely for illustrative purposes. The hydrophobic core is highlighted in bold. This includes examples of amino acids which may be substituted or removed for the purposes of the present invention.
(33) TABLE-US-00001 TABLE 1 Accession Signal Sequence SEQ ID Number Entry Name Protein Name Length (hydrophobic core) NO: P01730 CD4_HUMAN T-cell surface glycoprotein CD4 25 MNRGVPFRHLLLVLQLALLPAATQG 36 P08575 CD45_HUMAN Leukocyte common antigen 23 MYLWLKLLAFGFAFLDTEVFVTG 37 P01732 CD8A_HUMAN T-cell surface glycoprotein CD8 alpha chain 21 MALPVTALLLPLALLLHAARP 38 P10966 CD8B_HUMAN T-cell surface glycoprotein CD8 beta chain 21 MRPRLWLLLAAQLTVLHGNSV 39 P06729 CD2_HUMAN T-cell surface antigen CD2 24 MSFPCKFVASFLLIFNVSSKGAVS 40 P06127 CD5_HUMAN T-cell surface glycoprotein CD5 24 MPMGSLQPLATLYLLGMLVASCLG 41 P09564 CD7_HUMAN T-cell antigen CD7 25 MAGPPRLLLLPLLLALARGLPGALA 42 P17643 TYRP1_HUMAN 5,6-dihydroxyindole-2-carboxylic acid 24 MSAPKLLSLGCIFFPLLLFQQARA 43 oxidase P00709 LALBA_HUMAN Alpha-lactalbumin 19 MRFFVPLFLVGILFPAILA 44 P16278 BGAL_HUMAN Beta-galactosidase 23 MPGFLVRILPLLLVLLLLGPTRG 45 P31358 CD52_HUMAN CAMPATH-1 antigen 24 MKRFLFLLLTISLLVMVQIQTGLS 46 Q6YHK3 CD109_HUMAN CD109 antigen 21 MQGPPLLTAAHLLCVCTAALA 47 P01024 CO3_HUMAN Complement C3 22 MGPTSGPSLLLLLLTHLPLALG 48 P10144 GRAB_HUMAN Granzyme B 18 MQPILLLLAFLLLPRADA 49 P04434 KV310_HUMAN Ig kappa chain V-III region VH 20 MEAPAQLLFLLLLWLPDTTR 50 P06312 KV401_HUMAN Ig kappa chain V-IV region 20 MVLQTQVFISLLLWISGAYG 51 P06319 LV605_HUMAN Ig lambda chain V-VI region EB4 19 MAWAPLLLTLLAHCTDCWA 52 P31785 IL2RG_HUMAN Cytokine receptor common gamma chain 22 MLKPSLPFTSLLFLQLPLLGVG 53 Q8N4F0 BPIL1_HUMAN Bactericidal/permeability-increasing 20 MAWASRLGLLLALLLPVVGA 54 protein-like 1 P55899 FCGRN_HUMAN IgG receptor FcRn large subunit p51 23 MGVPRPQPWALGLLLFLLPGSLG 55
(34) The mutated signal peptide comprises one or more mutation(s) such that it has fewer hydrophobic amino acids than the wild-type signal peptide from which it is derived. The term “wild type” means the sequence of the signal peptide which occurs in the natural protein from which it is derived. For example, the signal peptide described in the examples is the signal peptide from the murine Ig kappa chain V-III region, which has the wild-type sequence: METDTLILWVLLLLVPGSTG (SEQ ID NO: 35).
(35) The term “wild-type” also includes signal peptides derived from a naturally occurring protein which comprise one or more amino acid mutations in the n- or c-region. For example it is common to modify a natural signal peptide with a conserved amino acid substitution on the N-terminus to introduce a restriction site. Such modified signal peptide sequences (which do not comprise any mutations in the h-region) are considered “wild-type” for the purposes of the present invention.
(36) The present invention also relates to synthetic signal peptide sequences, which cannot be defined with reference to a wild-type sequence. In this embodiment, the signal peptide of the one polypeptide comprises fewer hydrophobic amino acids than the signal sequence of the other polypeptide. The two signal sequences may be derived from the same synthetic signal peptide sequence, but differ in the number of hydrophobic amino acids in the core region.
(37) Transmembrane Protein
(38) The present invention enables modulation of the relative expression of a transmembrane surface protein. The transmembrane surface protein is a protein which is expressed at the cell surface. When expressed at the cell surface at least one domain of the transmembrane protein is exoplasmic (i.e. on the exterior of the cell).
(39) The transmembrane protein may be a single-pass transmembrane protein, i.e. it may comprise a single transmembrane domain or it may comprise multiple transmembrane domains.
(40) Transmembrane proteins may be classified by topology i.e. with reference to the position of the N- and C-terminal domains. Types I, II, and III transmembrane proteins are single-pass molecules, while type IV trans-membrane proteins are multiple-pass molecules. Type I transmembrane proteins are anchored to the lipid membrane with a stop-transfer anchor sequence and have their N-terminal domains targeted to the ER lumen during synthesis (and the extracellular space, when the mature form is located on the plasma membrane). Type II and III are anchored with a signal-anchor sequence, with type II being targeted to the ER lumen with its C-terminal domain, while type III have their N-terminal domains targeted to the ER lumen. Type IV is subdivided into IV-A, with their N-terminal domains targeted to the cytosol and IV-B, with an N-terminal domain targeted to the lumen.
(41) The transmembrane protein(s) made by the nucleic acid construct of the present invention may be any of the types I-IV.
(42) The transmembrane domain may be any protein structure which is thermodynamically stable in a membrane. This is typically an alpha helix comprising of several hydrophobic residues. The transmembrane domain of any transmembrane protein can be used to supply the transmembrane portion. The presence and span of a transmembrane domain of a protein can be determined by those skilled in the art using the TMHMM algorithm (http://www.cbs.dtu.dk/services/TMHMM-2.0/). Further, given that the transmembrane domain of a protein is a relatively simple structure, i.e., a polypeptide sequence predicted to form a hydrophobic alpha helix of sufficient length to span the membrane, an artificially designed TM domain may also be used (U.S. Pat. No. 7,052,906 B1 describes synthetic transmembrane components).
(43) The transmembrane domain may be derived from CD28, which gives good stability.
(44) The structure and processing of Type I transmembrane proteins is well known in the art. Such proteins typically comprise an extracellular domain, a transmembrane domain and an intracellular endodomain and are single-pass molecules with a single a-helix passing through the cell membrane.
(45) Type I transmembrane proteins typically have a signal peptide which is quickly recognized by the endoplasmic reticulum (ER) and the protein in translation is therefore quickly re-directed into the ER. A hydrophobic helix locks then anchors the protein in the membrane of the ER.
(46) As mentioned above, Type I transmembrane proteins are anchored to the lipid membrane with a stop-transfer anchor sequence. The stop-transfer sequence halts the further translocation of the polypeptide and acts as a transmembrane anchor.
(47) As used herein, the term Type I transmembrane protein encompasses any protein which comprises a Type I transmembrane domain and a stop-transfer anchor sequence and is, in the absence of an exogenous intracellular retention signal, targeted for expression on the cell surface.
(48) Various type 1 transmembrane proteins which are suitable for use in the present invention are known in the art. Such proteins include, but are not limited to inhibitory receptors, stimulatory receptors, cytokine receptors and G-Proteins.
(49) The transmembrane protein(s) may be a T-cell receptor α or β chain.
(50) The transmembrane protein(s) may be a Chimeric Antigen Receptor (CAR).
(51) CARs are proteins which graft an antigen binding domain to the effector function of a T-cell. Their usual form is that of a type I transmembrane domain protein with an antigen recognizing amino terminus, a spacer, a transmembrane domain all connected to a compound endodomain which transmits T-cell survival and activation signals.
(52) The antigen binding domain may be derived from an antibody or antibody mimetic, or it may be another entity which specifically binds the antigen, such as a ligand.
(53) The most common form of these molecules are fusions of single-chain variable fragments (scFv) derived from monoclonal antibodies which recognize a target antigen, fused via a spacer and a trans-membrane domain to a signaling endodomain. Such molecules result in activation of the T-cell in response to recognition by the scFv of its target. When T cells express such a CAR, they recognize and kill target cells that express the target antigen. Several CARs have been developed against tumour associated antigens, and adoptive transfer approaches using such CAR-expressing T cells are currently in clinical trial for the treatment of various cancers.
(54) It is also possible for the signalling endodomain to be present on a separate molecule. The term “CAR” in connection with the present invention also encompasses a molecule which comprises an antigen binding domain connected to a transmembrane domain. Such a CAR may be capable of interacting with a separate intracellular signalling domain in order to stimulate T-cell activation.
(55) In the present invention, either of the nucleic acid sequences A or B may be a nucleic acid sequence which encodes a transmembrane protein comprising a signal peptide.
(56) Most transmembrane proteins of interest are only active, or are predominantly active when at the cell membrane. Therefore the use of an inefficient signal peptide reduces the relative expression of the protein at the cell surface and therefore reduces the relative activity of the protein.
(57) Polyprotein
(58) The nucleic acid construct of the present invention may encode a polyprotein, which comprises the first and second polypeptides.
(59) The first and second polypeptides may be chimeric antigen receptors (CARs).
(60) The nucleic acid construct described in the Examples encodes the following polyprotein which comprises the various components in the order they are listed:
(61) TABLE-US-00002 Signal peptide derived from Mouse Ig kappa chain V-III region: METDTLILWVLLLLVPGSTG (SEQ ID NO: 35) (see below) scFv aCD19: DIQMTQTTSSLSASLGDRVTISCRASQDISKYLNWYQQKPDGTVKLLIY HTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTLPYTF GGGTKLEITKAGGGGSGGGGSGGGGSGGGGSEVKLQESGPGLVAPSQSL SVTCTVSGVSLPDYGVSWIRQPPRKGLEWLGVIWGSETTYYNSALKSRL TIIKDNSKSQVFLKMNSLQTDDTAIYYCAKHYYYGGSYAMDYWGQGTSV TVS (SEQ ID NO: 56) Linker: SD Human CD8aSTK: PTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDI (SEQ ID NO: 57) Human CD28TM: FWVLVVVGGVLACYSLLVTVAFIIFWV (SEQ ID NO: 58) Human CD3zeta intracellular domain: RRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGK PRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTAT KDTYDALHMQALPPR (SEQ ID NO: 59) 2A peptide: RAEGRGSLLTCGDVEENPGP (SEQ ID NO: 60) Signal peptide derived from mouse Ig kappa: MAVPTQVLGLLLLWLTDA (SEQ ID NO: 61) scFv aCD33: RCDIQMTQSPSSLSASVGDRVTITCRASEDIYFNLVWYQQKPGKAPKWY DTNRLADGVPSRFSGSGSGTQYTLTISSLQPEDFATYYCQHYKNYPLTF GQGTKLEIKRSGGGGSGGGGSGGGGSGGGGSRSEVQLVESGGGLVQPGG SLRLSCAASGFTLSNYGMHWIRQAPGKGLEWVSSISLNGGSTYYRDSVK GRFTISRDNAKSTLYLQMNSLRAEDTAVYYCAAQDAYTGGYFDYWGQGT LVTVSSM (SEQ ID NO: 62) Linker: DPA Hinge and Fc derived from human IgG1 with mutations to prevent FcRg association (HCH2CH3pvaa): EPKSPDKTHTCPPCPAPPVAGPSVFLFPPKPKDTLMIARTPEVTCVVVD VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL NGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQV SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTV DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK (SEQ ID NO: 63) Linker: KDPK (SEQ ID NO: 64) Human CD148TM: AVFGCIFGALVIVTVGGFIFW (SEQ ID NO: 65) Human CD148 intracellular domain: RKKRKDAKNNEVSFSQIKPKKSKLIRVENFEAYFKKQQADSNCGFAEEY EDLKLVGISQPKYAAELAENRGKNRYNNVLPYDISRVKLSVQTHSTDDY INANYMPGYHSKKDFIATQGPLPNTLKDFWRMVWEKNVYAIIMLTKCVE QGRTKCEEYWPSKQAQDYGDITVAMTSEIVLPEWTIRDFTVKNIQTSES HPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQSPPESPILVHCSA GVGRTGTFIAIDRLIYQIENENTVDVYGIVYDLRMHRPLMVQTEDQYVF LNQCVLDIVRSQKDSKVDLIYQNTTAMTIYENLAPVTTFGKTNGYIA (SEQ ID NO: 66)
(62) The signal sequence of from murine Ig kappa chain V-III region, which has the sequence: METDTLILWVLLLLVPGSTG (SEQ ID NO: 35) (hydrophobic residues highlighted in bold) is altered as described in the Examples. Hydrophobic residues were sequentially deleted from the hydrophobic core in order to reduce the level of expression of the anti-CD19 CAR.
(63) Cleavage Site
(64) The nucleic acid construct of the first aspect of the invention comprises a sequence encoding a cleavage site positioned between nucleic acid sequences which encode first and second polypeptides, such that first and second polypeptides can be expressed as separate entities.
(65) The cleavage site may be any sequence which enables the polypeptide comprising the first and second polypeptides to become separated.
(66) The term “cleavage” is used herein for convenience, but the cleavage site may cause the first and second polypeptidess to separate into individual entities by a mechanism other than classical cleavage. For example, for the Foot-and-Mouth disease virus (FMDV) 2A self-cleaving peptide (see below), various models have been proposed for to account for the “cleavage” activity: proteolysis by a host-cell proteinase, autoproteolysis or a translational effect (Donnelly et al (2001) J. Gen. Virol. 82:1027-1041). The exact mechanism of such “cleavage” is not important for the purposes of the present invention, as long as the cleavage site, when positioned between nucleic acid sequences which encode first and second polypeptides, causes the first and second polypeptides to be expressed as separate entities.
(67) The cleavage site may be a furin cleavage site.
(68) Furin is an enzyme which belongs to the subtilisin-like proprotein convertase family. The members of this family are proprotein convertases that process latent precursor proteins into their biologically active products. Furin is a calcium-dependent serine endoprotease that can efficiently cleave precursor proteins at their paired basic amino acid processing sites. Examples of furin substrates include proparathyroid hormone, transforming growth factor beta 1 precursor, proalbumin, pro-beta-secretase, membrane type-1 matrix metalloproteinase, beta subunit of pro-nerve growth factor and von Willebrand factor. Furin cleaves proteins just downstream of a basic amino acid target sequence (canonically, Arg-X-(Arg/Lys)-Arg (SEQ ID NO: 67 and SEQ ID NO: 68)) and is enriched in the Golgi apparatus.
(69) The cleavage site may be a Tobacco Etch Virus (TEV) cleavage site.
(70) TEV protease is a highly sequence-specific cysteine protease which is chymotrypsin-like proteases. It is very specific for its target cleavage site and is therefore frequently used for the controlled cleavage of fusion proteins both in vitro and in vivo. The consensus TEV cleavage site is ENLYFQ\S (SEQ ID NO: 69) (where ‘\’ denotes the cleaved peptide bond). Mammalian cells, such as human cells, do not express TEV protease. Thus in embodiments in which the present nucleic acid construct comprises a TEV cleavage site and is expressed in a mammalian cell—exogenous TEV protease must also expressed in the mammalian cell.
(71) The cleavage site may encode a self-cleaving peptide.
(72) A ‘self-cleaving peptide’ refers to a peptide which functions such that when the polypeptide comprising the first and second polypeptides and the self-cleaving peptide is produced, it is immediately “cleaved” or separated into distinct and discrete first and second polypeptides without the need for any external cleavage activity.
(73) The self-cleaving peptide may be a 2A self-cleaving peptide from an aphtho- or a cardiovirus. The primary 2A/2B cleavage of the aptho- and cardioviruses is mediated by 2A “cleaving” at its own C-terminus. In apthoviruses, such as foot-and-mouth disease viruses (FMDV) and equine rhinitis A virus, the 2A region is a short section of about 18 amino acids, which, together with the N-terminal residue of protein 2B (a conserved proline residue) represents an autonomous element capable of mediating “cleavage” at its own C-terminus.
(74) The C-terminal 19 amino acids of the longer cardiovirus protein, together with the N-terminal proline of 2B mediate “cleavage” with an efficiency approximately equal to the apthovirus FMDV 2a sequence. Cardioviruses include encephalomyocarditis virus (EMCV) and Theiler's murine encephalitis virus (TMEV).
(75) Mutational analysis of EMCV and FMDV 2A has revealed that the motif DxExNPGP is intimately involved in “cleavage” activity (Donelly et al (2001) as above).
(76) The cleavage site of the present invention may comprise the amino acid sequence: Dx.sub.1Ex.sub.2NPGP, where x.sub.1 and x.sub.2 are any amino acid. X.sub.1 may be selected from the following group: I, V, M and S. X.sub.2 may be selected from the following group: T, M, S, L, E, Q and F.
(77) For example, the cleavage site may comprise one of the amino acid sequences shown in Table 2.
(78) TABLE-US-00003 TABLE 2 Motif Present in: DIETNPGP (SEQ ID NO: 1) Picornaviruses EMCB, EMCD, EMCPV21 DVETNPGP (SEQ ID NO: 2) Picornaviruses MENGO and TMEBEAN; Insect virus DCV, ABPV DVEMNPGP (SEQ ID NO: 3) Picornaviruses TMEGD7 and TMEBEAN DVESNPGP (SEQ ID NO: 4) Picornaviruses FMDA10, FMDA12, FMDC1, FMD01K, FMDSAT3, FMDVSAT2, ERAV; Insect virus CrPV DMESNPGP (SEQ ID NO: 5) Picornavirus FMDV01G DVELNPGP (SEQ ID NO: 6) Picornavirus ERBV; Porcine rotavirus DVEENPGP (SEQ ID NO: 7) Picornavirus PTV-1; Insect virus TaV; Trypanosoma TSR1 DIELNPGP (SEQ ID NO: 8) Bovine Rotavirus, human rotavirus DIEQNPGP (SEQ ID NO: 9) Trypanosoma AP endonuclease DSEFNPGP (SEQ ID NO: Bacterial sequence T. 10) maritima
(79) The cleavage site, based on a 2A sequence may be, for example 15-22 amino acids in length. The sequence may comprise the C-terminus of a 2A protein, followed by a proline residue (which corresponds to the N-terminal proline of 2B).
(80) Mutational studies have also shown that, in addition to the naturally occurring 2A sequences, some variants are also active. The cleavage site may correspond to a variant sequence from a naturally occurring 2A polypeptide, have one, two or three amino acid substitutions, which retains the capacity to induce the “cleavage” of a polyprotein sequence into two or more separate proteins.
(81) The cleavage sequence may be selected from the following which have all been shown to be active to a certain extent (Donnelly et al (2001) as above):
(82) TABLE-US-00004 (SEQ ID NO: 11) LLNFDLLKLAGDVESNPGP (SEQ ID NO: 12) LLNFDLLKLAGDVQSNPGP (SEQ ID NO: 13) LLNFDLLKLAGDVEINPGP (SEQ ID NO: 14) LLNFDLLKLAGDVEFNPGP (SEQ ID NO: 15) LLNFDLLKLAGDVESHPGP (SEQ ID NO: 16) LLNFDLLKLAGDVESEPGP (SEQ ID NO: 17) LLNFDLLKLAGDVESQPGP (SEQ ID NO: 18) LLNFDLLKLAGDVESNPGG
(83) Based on the sequence of the DxExNPGP “a motif, “2A-like” sequences have been found in picornaviruses other than aptho- or cardioviruses, ‘picornavirus-like’ insect viruses, type C rotaviruses and repeated sequences within Trypanosoma spp and a bacterial sequence (Donnelly et al (2001) as above). The cleavage site may comprise one of these 2A-like sequences, such as:
(84) TABLE-US-00005 (SEQ ID NO: 19) YHADYYKQRLIHDVEMNPGP (SEQ ID NO: 20) HYAGYFADLLIHDIETNPGP (SEQ ID NO: 21) QCTNYALLKLAGDVESNPGP (SEQ ID NO: 22) ATNFSLLKQAGDVEENPGP (SEQ ID NO: 23) AARQMLLLLSGDVETNPGP (SEQ ID NO: 24) RAEGRGSLLTCGDVEENPGP (SEQ ID NO: 25) TRAEIEDELIRAGIESNPGP (SEQ ID NO: 26) TRAEIEDELIRADIESNPGP (SEQ ID NO: 27) AKFQIDKILISGDVELNPGP (SEQ ID NO: 28) SSIIRTKMLVSGDVEENPGP (SEQ ID NO: 29) CDAQRQKLLLSGDIEQNPGP (SEQ ID NO: 30) YPIDFGGFLVKADSEFNPGP
(85) The cleavage site may comprise the 2A-like sequence shown as SEQ ID NO: 24 (RAEGRGSLLTCGDVEENPGP).
(86) It has been shown that including an N-terminal “extension” of between 5 and 39 amino acids can increase activity (Donnelly et al (2001) as above). In particular, the cleavage sequence may comprise one of the following sequences or a variant thereof having, for example, up to 5 amino acid changes which retains cleavage site activity:
(87) TABLE-US-00006 (SEQ ID NO: 31) VTELLYRMKRAETYCPRPLAIHPTEARHKQKIVAPVKQTLNFDLLKLAG DVESNPGP (SEQ ID NO: 32) LLAIHPTEARHKQKIVAPVKQTLNFDLLKLAGDVESNPGP (SEQ ID NO: 33) EARHKQKIVAPVKQTLNFDLLKLAGDVESNPGP (SEQ ID NO: 34) APVKQTLNFDLLKLAGDVESNPGP
(88) Tunability
(89) The relative expression of one or more protein(s) may be fine-tuned using the method of the invention by using signal peptides with different amounts or proportions of hydrophobic amino acids.
(90) The tunability using different signal peptides is especially useful when one considers the expression of multiple proteins, each with their own relative expression. For example, consider a nucleic acid construct having the following structure:
A-X-B-Y-C in which
A, B and C are nucleic acid sequences encoding polypeptides; and
X and Y are nucleic acid sequences encodes cleavage sites.
(91) The nucleic acid construct will encode three proteins A, B and C, any or all of which may be transmembrane proteins. If it is desired for A, B and C to be expressed such that the relative levels are A>B>C, then the nucleic acid sequence A may have a signal peptide with the most hydrophobic amino acids, the nucleic acid sequence B may have a signal peptide with a medium amount of hydrophobic amino acids, and the nucleic acid sequence C may have a signal peptide with the least hydrophobic amino acids.
(92) Vector
(93) The present invention also provides a vector comprising a nucleic acid construct according to the first aspect of the invention.
(94) Such a vector may be used to introduce the nucleic acid construct into a host cell so that it expresses the first and second polypeptide.
(95) The vector may, for example, be a plasmid or a viral vector, such as a retroviral vector or a lentiviral vector, or a transposon based vector or synthetic mRNA.
(96) The vector may be capable of transfecting or transducing a mammalian cell, for example a T cell.
(97) Cell
(98) The present invention furthers provides a cell comprising a nucleic acid construct or vector of the present invention which expresses the first and second polypeptide encoded by the nucleic acid sequence.
(99) The cell may be any eukaryotic cell capable of expressing a transmembrane protein at the cell surface, such as an immunological cell.
(100) The cell may be a cytolytic immune cell, such as a T cell or natural killer cell.
(101) Method
(102) In a further aspect the present invention provides a method for making a cell according to the invention which comprises the step of introducing a nucleic acid construct or a vector of the invention into a cell.
(103) The nucleic acid construct may be introduced by transduction or transfection.
(104) The cell may be a cell isolated from a subject, for example a T cell or an NK cell isolated from a subject.
(105) The present invention also provides a method for modulating the relative cell surface expression of a first protein expressed from a single nucleic acid construct with a second protein which comprises the step of mutating the nucleic acid sequence which encodes the signal peptide of one protein in order to remove or replace on or more hydrophobic amino acids in comparison with the signal peptide of the other protein.
(106) The signal peptide may be altered by techniques known in the art, such as site directed mutagenesis and recombinant techniques.
(107) The invention will now be further described by way of Examples, which are meant to serve to assist one of ordinary skill in the art in carrying out the invention and are not intended in any way to limit the scope of the invention.
EXAMPLES
Example 1—Using the Murine Ig Kappa Chain V-III Signal Sequence
(108) PCT/GB2014/053452 describes a vector system encoding two chimeric antigen receptors (CARs), one against CD19 and one against CD33. The signal peptide used for the CARs in that study was the signal peptide from the human CD8a signal sequence. For the purposes of this study, this was substituted with the signal peptide from the murine Ig kappa chain V-III region, which has the sequence: METDTLILWVLLLLVPGSTG (SEQ ID NO: 35) (hydrophobic residues highlighted in bold). In order to establish that the murine Ig kappa chain V-III signal sequence functioned as well as the signal sequence from human CD8a, a comparative study was performed. For both signal sequences, functional expression of the anti-CD33 CAR and the anti-CD19 CAR was observed. This substituted signal sequence and all subsequent mutations thereof were transiently transfected into 293T cells. Three days after transfection the 293T cells were stained with both soluble chimeric CD19 fused with rabbit Fc chain and soluble chimeric CD33 fused with mouse Fc chain. All cells were then stained with anti-Rabbit Fc-FITC and anti-mouse Fc-APC. Flow cytometry plots show the substituted signal sequence as a comparison with non-transfected (NT) and the construct with Cd8 signal sequences (
Example 2—Altering Relative Expression by Deleting Hydrophobic Residues in the Signal Peptide
(109) Hydrophobic residues were deleted in a stepwise fashion and the effect on the relative expression of the anti-CD33 CAR and the anti-CD19 CAR was observed. The effect of one, two, three and four amino acid deletions was investigated and the results are shown in
(110) All mutant constructs showed a decrease in relative expression of the anti-CD19 CAR compared to the anti-CD33 CAR. The relative decrease of anti-CD19 CAR expression was greater with a greater number of amino acid deletions from 1 to 3, but then plateaued out (four deletions gave a similar decrease in expression as three deletions).
(111) Modification of the signal sequences in a nucleic acid construct encoding two polypeptides can therefore be used to control the relative expression of the two polypeptides.
(112) All publications mentioned in the above specification are herein incorporated by reference. Various modifications and variations of the described methods and system of the invention will be apparent to those skilled in the art without departing from the scope and spirit of the invention. Although the invention has been described in connection with specific preferred embodiments, it should be understood that the invention as claimed should not be unduly limited to such specific embodiments. Indeed, various modifications of the described modes for carrying out the invention which are obvious to those skilled in molecular biology, cell biology or related fields are intended to be within the scope of the following claims.