Heat-stable, FE-dependent alcohol dehydrogenase for aldehyde detoxification

09951359 ยท 2018-04-24

Assignee

Inventors

Cpc classification

International classification

Abstract

The present invention relates to microorganisms and polypeptides for detoxifying aldehydes associated with industrial fermentations. In particular, a heat-stable, NADPH- and iron-dependent alcohol dehydrogenase was cloned from Thermoanaerobacter pseudethanolicus 39E and displayed activity against a number of aldehydes including inhibitory compounds that are produced during the dilute-acid pretreatment process of lignocellulosic biomass before fermentation to biofuels. Methods to use the microorganisms and polypeptides of the invention for improved conversion of bio mass to biofuel are provided as well as use of the enzyme in metabolic engineering strategies for producing longer-chain alcohols from sugars using thermophilic, fermentative microorganisms.

Claims

1. A fermentation process comprising: contacting biomass with an anaerobic, thermophilic microorganism for a time and under thermophilic, anaerobic conditions to detoxify inhibitory aldehydes present in the biomass, and to allow fermentation of the biomass and conversion of the biomass to biofuel, wherein said biofuel comprises ethanol; and recovering ethanol from said biofuel, wherein said thermophilic microorganism comprises a nucleic acid encoding a polypeptide having NAD(P)H-dependent alcohol dehydrogenase activity and comprising an amino acid sequence having at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 2, and wherein said nucleic acid is operably linked to a heterologous promoter.

2. The process of claim 1, wherein said biomass has been pretreated by acid hydrolysis, hot water, or enzymatic hydrolysis.

3. A method of improving the yield and/or efficiency of lignocellulosic biomass conversion to biofuel, comprising: contacting lignocellulosic biomass with an anaerobic, thermophilic microorganism for a time and under thermophilic, anaerobic conditions sufficient to detoxify inhibitory aldehydes present in said biomass, and to produce improved yields or efficiency of biomass conversion to biofuel, relative to lignocellulosic biomass that has not been so contacted, wherein said biofuel comprises ethanol; and recovering ethanol from said biofuel, wherein said thermophilic microorganism comprises a nucleic acid encoding a polypeptide having NAD(P)H-dependent alcohol dehydrogenase activity and comprising an amino acid sequence having at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 2, and wherein said nucleic acid is operably linked to a heterologous promoter.

4. The method of claim 3, wherein said lignocellulosic biomass has been pretreated by acid hydrolysis, hot water, or enzymatic hydrolysis.

5. A lignocellulosic biomass fermentation process comprising: contacting lignocellulosic biomass with a first anaerobic, thermophilic microorganism and a second anaerobic, thermophilic microorganism for a time and under thermophilic, anaerobic conditions to detoxify inhibitory aldehydes present in the biomass and to allow fermentation of the biomass to proceed and conversion of biomass to biofuel, wherein said biofuel comprises ethanol; and recovering ethanol from said biofuel, wherein said first anaerobic, thermophilic microorganism comprises a nucleic acid encoding a polypeptide having NAD(P)H-dependent alcohol dehydrogenase activity and comprising an amino acid sequence having at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 2, and wherein said nucleic acid is operably linked to a heterologous promoter.

6. The method of claim 5, wherein said lignocellulosic biomass has been pretreated by acid hydrolysis, hot water, or enzymatic hydrolysis.

7. An improved method of producing a bulk or platform chemical from lignocellulosic biomass, the improvement comprising: contacting said lignocellulosic biomass with an anaerobic, thermophilic microorganism for a time and under conditions to reduce the aldehyde content associated with said lignocellulosic biomass and to improve production efficiency or yield of said bulk or platform chemical relative to lignocellulosic biomass that has not been so contacted, and recovering the bulk or platform chemical, wherein the bulk or platform chemical comprises ethanol, wherein said anaerobic, thermophilic microorganism comprises a nucleic acid encoding a polypeptide having NAD(P)H-dependent alcohol dehydrogenase activity and comprising an amino acid sequence having at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 2, and wherein said nucleic acid is operably linked to a heterologous promoter.

8. The method of claim 7, wherein said lignocellulosic biomass has been pretreated by acid hydrolysis, hot water, or enzymatic hydrolysis.

9. The method of claim 7, wherein the bulk or platform chemical further comprises, lactate, furfuryl alcohol, 1,4-dicarboxylic acids, glycerol, sorbitol, mannitol, xylitol/arabinitol, L-ascorbic acid, xylitol, hydrogen gas, 2,5-furan dicarboxylic acid, 3-hydroxy propionic acid, aspartic acid, glutaric acid, glutamic acid, itaconic acid, levulinic acid, 3-hydroxybutyrolactone, fatty acids, fatty-derived molecules, isoprenoids, isoprenoid-derived molecules, alkanes, isopentanol, or isoamylacetate.

10. The method of claim 7, wherein the lignocellulosic biomass is furan waste from pulp or paper processing.

11. The method of claim 7, wherein the bulk or platform chemical is ethanol.

12. The method of claim 7, wherein the microorganism is selected from the group consisting of Thermoanaerobacter brockii, Thermoanaerobacter ethanolicus, Thermoanaerobacter pseudethanolicus, Thermoanaerobacterium aotearoense, Thermoanaerobacterium saccharolyticum, Thermoanaerobacterium thermosaccharolyticum, Thermoanaerobacterium xylanolyticum, Clostridium thermocellum, Clostridium straminisolvens, Clostridium thermocopriae, Caldicellulosiruptor bescii, Caldicellulosiruptor saccharolyticus, Caldicellulosiruptor hydrothermalis, Caldicellulosiruptor kristjanssonii, Caldicellulosiruptor kronotskyensis, Caldicellulosiruptor lactoaceticus, Caldicellulosiruptor owensensi, Caldicellulosiruptor acetigenus, and Caldicellulosiruptor obsidiansis.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) FIG. 1A depicts a line graph showing the growth of Teth39E with increasing concentrations of furfural as measured by optical density at 600 nm. FIG. 1B shows a line graph of growth of Teth39E with increasing concentrations of 5-HMF.

(2) FIG. 2A presents the furfural concentration in medium during growth of Teth39E. FIG. 2B shows 5-HMF and 2,5-(dihydroxymethyl)furan concentrations in medium during growth of Teth39E. Furan aldehyde concentration was measured spectrophotometrically, while furan alcohol concentration was measured by GC-MS.

(3) FIG. 3 shows a line drawing of the reduction of furfural and 5-HMF to their respective alcohols, furfuryl alcohol and 2,5-(dihydroxymethyl)furan, using NADPH.

(4) FIG. 4 shows a cartoon depicting three Teth39E open reading frames, Teth39_1596, Teth39_1597 and Teth39_1598. Teth39_1597 encodes an Fe-dependent alcohol dehydrogenase, the expression of which is upregulated approximately 7-fold when Teth39E is cultured in medium containing 15 mM furfural.

(5) FIG. 5 presents results of homology analysis of the bdhA gene sequence using the BLAST Conserved Domain Database at the National Center for Biotechnology Information and shows that the bdhA gene contains a butanol dehydrogenase (BDH) domain involved in the conversion of butyraldehyde to butanol using NAD(P)H.

(6) FIG. 6A presents a schematic diagram of the plasmid pET-30a-Teth39_1597 which has the Teth39_1597 coding sequence (the bdhA gene) under inducible control of a strong T7 promoter (when grown with IPTG) via the lac operon present on the plasmid. FIG. 6B shows a Coomassie-blue stained, SDS-PAGE gel of cell lysates after addition of IPTG to E. coli clones carrying pET-30a-Teth39_1597 or a control plasmid. M., molecular weight markers.

(7) FIG. 7 depicts a bar graph showing the aldehyde reductase activity in the presence of NADPH of cell lysates containing pET-30a-Teth39_1597 or a control plasmid. The aldehydes, from left to right, are furfural, 5-HMF, acetaldehyde, butyraldehyde and isobutyraldehyde.

(8) FIG. 8 shows a line graph of BdhA relative activity at temperatures ranging from 30 to 85 C.

(9) FIG. 9 presents a line graph of BdhA relative activity at pH 4 to 10.

(10) FIG. 10A presents a schematic diagram of the pDCW 171 Teth39_1597 expression cassette integration vector. Key: Ap.sup.r, apramycin resistant gene cassette; pSC101, low copy replication origin in E. coli; repA, a plasmid-encoded gene required for pSC101 replication; par, partition locus. FIG. 10B shows a graphical representation of the mechanism by which the pDCW 171 Teth39_1597 expression cassette integration vector integrates the bdhA gene into a host cell genome.

(11) FIG. 11A-11C shows the expression of T. pseudethanolicus bdhA in C. bescii. FIG. 11A shows PCR products amplified from the targeted chromosome region in JWCB001 (wild type; lane 1), JWCB018 (pyrAF ldh.sup. cbel; lane 2), JWCB044 (pyrAF ldh.sup. cbel Teth39_1957.sup.+; lane 3), and no DNA (lane 4) with primers DC477 and DC478. Total cell protein (80 g) was isolated from mid-log phase cultures and electrophoresed in SDS-PAGE gels either for staining with Coomassie Brilliant Blue (FIG. 11B) or for Western blot analysis (FIG. 11C) probed with an anti-His antibody. Lane 1: JWCB001 (wt) grown at 75 C.; lane 2: JWCB018 grown at 75 C.; lane 3: JWCB044 grown at 65 C.; lane 4: JWCB044 grown at 70 C.; lane 5: JWCB044 grown at 75 C.

(12) FIG. 12 depicts a line graph showing growth of C. bescii strains JWCB018 (lacking BdhA expression), and JWCB044 (expressing BdhA), in the presence of 5 and 10 mM furfural.

(13) FIG. 13 shows a bar graph presenting relative remaining furfural concentrations after 24 h incubation of medium only with 5 and 10 mM furfural (uninoculated control), C. bescii strain JWCB018 (lacking BdhA expression), and C. bescii strain JWCB044 (expressing BdhA).

DETAILED DESCRIPTION OF THE INVENTION

(14) The present invention relates to engineered anaerobic, thermophilic microorganisms used in industrial fermentations that express an exogenous heat-stable, NADPH- and iron-dependent alcohol dehydrogenase cloned from Thermoanaerobacter pseudethanolicus 39E (Teth39E), or homologs thereof. In one embodiment, the exogenous heat-stable, NADPH- and iron-dependent alcohol dehydrogenase cloned from Teth39E is the gene product of the Teth39_1597 locus.

(15) By engineering anaerobic, thermophilic microorganisms to express exogenous heat-stable, NADPH- and iron-dependent alcohol dehydrogenase cloned from Thermoanaerobacter pseudethanolicus 39E (Teth39E), or homologs thereof, or by adding the expressed proteins to industrial hydrolysis and fermentation, allows improved efficiency and/or yield for conversion of biomass to biofuel by detoxifying pretreatment inhibitors found in such industrial fermentations.

(16) The substrate specificity of the heat-stable, NADPH- and iron-dependent alcohol dehydrogenase cloned from Teth39E for aldehydes includes furfural, 5-hydroxymethylfurfural (5-HMF), isobutyraldehyde, butyraldehyde, and acetaldehyde, which the enzyme converts to alcohols (see FIGS. 1A, 1B, 2A, and 3, and Table 1).

(17) BdhA Proteins, Nucleic Acids and Expression Vectors

(18) Teth39 _1597 is the locus tag for an iron-containing alcohol dehydrogenase encoded by Thermoanaerobacter pseudethanolicus strain ATCC 33223 (abbreviated herein as Teth39E). Teth39E increases expression of an iron-dependent alcohol dehydrogenase (BdhA) when grown in the presence of furfural. The open reading frame encoding Teth39_1597 is located at positions 1,630,187 to 1,631,392 on the chromosome of Teth39E (see FIG. 4), is 1206 bp in length (SEQ ID NO: 2) and encodes a protein of 401 amino acids (SEQ ID NO: 1) with a mass of approximately 43.4 kD. The gene product belongs to the family of iron-containing alcohol dehydrogenases and possesses highly conserved domains for butanol dehydrogenase, an enzyme which can catalyze the final step in butanol formation in anaerobic bacteria (see FIG. 5). The iron-dependent alcohol dehydrogenases have higher activity for longer chain aldehydes relative to formaldehyde or acetaldehyde. For BdhA it is shown herein that the substrate preference in whole lysates with NADPH as the cofactor, from most to least activity, is butyraldehyde, 5-HMF, furfural, acetaldehyde and isobutyraldehyde (see Table 1).

(19) Enzymatic activity can be measured in the forward or reverse reaction direction, by alcohol to aldehyde conversion (dehydrogenation) or by aldehyde to alcohol conversion (reduction) using methods known in the art. For alcohol conversion to aldehyde, the enzymatic activity of BdhA is said to be an alcohol dehydrogenase activity. For aldehyde conversion to alcohol, the enzymatic activity of BdhA is said to be an aldehyde reductase activity. BdhA and its homologs can be characterized by specifying either activity. The specific activity of BdhA with NADPH as a cofactor is at least 0.5 mole/min/mg when expressed in E. coli and measured with various aldehydes in a whole cell lysate. When butyraldehyde is the substrate, the specific activity can reach to at least about 14 mole/min/mg.

(20) As used herein, nucleic acid includes RNA and DNA in any form, including in single or double stranded form and as cDNA. Isolated nucleic acid means that the nucleic acid has been removed from its natural position in the genome (or on an epichromosomal element such as a natural plasmid) and that it has a discrete size and can be a fragment or circular molecule in a useful form for manipulation such as for a probe, for creating a mutation, for use in cloning particular sequences, for protein expression and for such other recombinant and molecular biology techniques as known in the art.

(21) Purified nucleic acids or proteins are preparations of nucleic acids or proteins, respectively, that within reasonable detection limits, form a homogenous preparation of that particular molecule. The preparation may contain buffer or other non-nucleic acid or non-proteinaceous components routinely used in such purifications and manipulations. For example, a restriction fragment purified from an agarose gel is considered an isolated and purified nucleic acid. Likewise, a protein excised from a polyacrylamide gel is considered an isolated and purified protein. As used herein, substantially purified or partially purified molecules are at least 60% free, at least 75% free, or at least 90% free from other components with which they are naturally associated. As used herein, the terms purified and to purify also refer to the removal of contaminants from a sample. The removal of contaminating molecules results in an increase in the percent of polypeptide or nucleic acid of interest in the sample.

(22) One aspect of the invention is directed to isolated nucleic acids and expression vectors that encode the polypeptides of the present invention, that are used to create isolated anaerobic, thermophilic microorganisms that express an exogenous BdhA, or a homolog thereof.

(23) Expression vectors suitable for use in the present invention comprise nucleic acids encoding exogenous BdhA, or a homolog thereof, operably linked to a promoter, preferably a strong inducible promoter, to allow expression of the exogenous BdhA, or a homolog thereof in the microorganisms of the present invention.

(24) Expression vectors suitable for use in the present invention contain appropriate regulatory sequences, such as a promoter and operator, so that the microorganism host-cell machinery can transcribe the exogenous gene and translate the resultant messenger RNA to synthesize the corresponding exogenous protein. In certain embodiments, the regulatory sequences are specific for the microorganism into which the expression vector is introduced. In certain embodiments, the expression vector is a plasmid. In alternate embodiments, the expression vector is a virus. In certain embodiments, the exogenous gene integrates into the host cell genome.

(25) In certain embodiments, flanking sequences in the vector upstream and downstream of the exogenous gene enhances integration of the exogenous gene into the host cell genome.

(26) In certain embodiments, the expression vector contains sequences that introduce modifications to the exogenous gene. The modifications may include post-translational modifications (e.g., glycosylation, methylation), purification tags (e.g., a His tag) or reporter moieties to facilitate purification, manipulation and characterization of the protein. Such modifications are not included in calculations of sequence identities.

(27) The methods for making such expression vectors as well as useful vectors and promoters therefor, along with additional expression control elements and purification tags, are all well known in the art and can be readily made and used by those of skill in the art. In general, molecular biological techniques for cloning and protein expression can be found in Green & Sambrook (2012) Molecular Cloning, A Laboratory Manual, 4th ed., Cold Spring Harbor Press, NY.

(28) For protein expression in Gram positive thermophiles, useful shuttle and expression vectors include, but are not limited to, pNW33N, pMK3, pMK4 (from the Bacillus Genetic Stock Center), pIKM1 [Mai et al. (1997) FEMS Microbiol. Let. 148:163-167]; and, pDCW142 [Chung et al. (2014) PNAS, 111:8931-8936] and pDCW89 [Chung et al. (2013) PLoS ONE 8(5): e62881. doi:10.1371/journal.pone.0062881].

(29) In one embodiment, Caldicellulosiruptor bescii is engineered to express an exogenous heat-stable, NADPH- and iron-dependent alcohol dehydrogenase cloned from Thermoanaerobacter pseudethanolicus 39E, or a homolog thereof, using the expression/integration vector disclosed in Chung et al. [PNAS, 2014, 111:8931-8936].

(30) In one embodiment, Caldicellulosiruptor bescii is engineered to express an exogenous heat-stable, NADPH- and iron-dependent alcohol dehydrogenase cloned from Thermoanaerobacter pseudethanolicus 39E, or a homolog thereof, using the expression/integration vector disclosed in Chung et al. [PLoS ONE 8(5): e62881. doi:10.1371/journal.pone.0062881].

(31) E. coli is a common organism to use for protein production and techniques to express heterologous proteins in E. coli are well known.

(32) Introduction of the expression vector into a host cell may be via any suitable method that is readily selected by one of skill in the art. Examples include the methods disclosed in Chung et al, and Cha et al. [Biotechnology for Biofuels, 2013, 6:85].

(33) The expressed exogenous BdhA, or a homolog thereof, can be expressed in bacteria, yeast, or mammalian host cells. The exogenous BdhA, or a homolog thereof, may be recovered to provide isolated and/or purified polypeptides after the removal of host cell proteins. Alternatively, the host cell containing the expression vector may be used in the production of bulk and platform chemicals from lignocellulosic material, such as lignocellulosic feedstock, where there is a need to detoxify 5-HMF, other furans or other aldehydes or carbonyl compounds.

(34) Accordingly, one aspect of the invention provides an isolated polypeptide that comprises BdhA or is a homolog thereof. A BdhA homolog is a protein with NAD(P)H- and iron-dependent aldehyde reductase activity and has, over the course of the BdhA amino acids, at least 70, 80, 90, 95, 98 or 99% identity to the amino acids encoded by the bdhA gene, and preferably has at least 90, 95, 98 or 99% amino acid identity. Enzymatic activity can be measured in the forward or reverse reaction direction, by alcohol to aldehyde conversion (dehydrogenation) or by aldehyde to alcohol conversion (reduction) using methods known in the art. For alcohol conversion to aldehyde, the enzymatic activity of BdhA or a homolog thereof is said to be an alcohol dehydrogenase activity. For aldehyde conversion to alcohol, the enzymatic activity of BdhA or a homolog thereof is said to be an aldehyde reductase activity. BdhA or a homolog thereof can be characterized by specifying either activity. The specific activity of BdhA or a homolog thereof with NADPH as a cofactor is at least 0.5 mole/min/mg when expressed in E. coli and measured with various aldehydes in a whole cell lysate. When butyraldehyde is the substrate, the specific activity can reach to at least about 14 mole/min/mg. The amino acid sequence of BdhA is set forth in SEQ ID No: 2. Examples of algorithms that are suitable for determining percent sequence identity and sequence similarity, such as the BLAST algorithm, are well known to those skilled in the art. If additional amino acids are present, such as a His tag for purification, these amino acids are not factored in the identity calculation.

(35) The isolated polypeptides of the invention can also be purified to varying degrees of homogeneity and preparations which range to at least 30, 40, 50, 60, 70, 80, 90, 95, 99 and 99.9 percent homogenous are within the ambit of the invention. Techniques for purifying proteins are known in the art and protein purity can be assessed by various known methods, including but not limited to, SDS-PAGE, increase in specific activity, amino acid analysis, amino acid sequence analysis and combinations thereof.

(36) The polypeptides of the invention can be used in the production of bulk and platform chemicals from lignocellulosic material, such as lignocellulosic feedstock, where there is a need to detoxify 5-HMF, other furans or other aldehydes or carbonyl compounds. Examples of biofuels and bulk and platform chemicals include ethanol, butanol, lactate, 1,4-dicarboxylic acids (succinic, fumaric, malic), glycerol, sorbitol, mannitol, arabinitol, L-ascorbic acid, xylitol, hydrogen gas, 2,5-furan dicarboxylic acid, 3-hydroxy propionic acid, aspartic acid, glutaric acid, glutamic acid, itaconic acid, levulinic acid, and 3-hydroxybutyrolactone, fatty acids, fatty-derived molecules, isoprenoids, isoprenoid-derived molecules, alkanes, isopentanol, and isoamylacetate. When using the polypeptides of the invention, increased specific productivity (gram product per gram cell and hour) can be achieved due to the faster removal of inhibitory furan compounds and carbonyl compounds from the medium.

(37) Thus, the polypeptides of the invention are useful to reduce the aldehyde content of biomass and to allow microorganisms that are normally inhibited at high aldehyde concentration to be used in fermentation steps. For example, the polypeptides can be mixed with biomass for a time and under conditions to convert the aldehydes that are present in the biomass (or that are released as the biomass is hydrolyzed) to non-toxic alcohols. The proteins can be added before any fermentation steps or during one or more fermentation steps to provide more efficient conversion of biomass to biofuel. The proteins of the invention are particularly useful in conjunction with anaerobic, thermophilic fermentations due to their thermostability.

(38) Microorganisms

(39) The invention generally provides two groups of microorganisms that express a polypeptide of the invention: (1) anaerobic, thermophilic microorganisms used in at least one step of an industrial fermentation process and which express an exogenous BdhA or a homolog thereof; and (2) microorganisms used in cloning, expression and purification of BdhA or a homolog thereof.

(40) As used herein exogenous expression refers to the expression of a gene product from a gene that has been introduced into a subject microorganism. The introduced gene may be a heterologous gene (i.e. not present in the subject microorganism), or identical or homologous to an endogenous gene in the subject microorganism.

(41) As used herein, exogenous BdhA or exogenous BdhA or a homolog thereof refers to the expression of BdhA or a homolog thereof from a gene that has been introduced into a subject microorganism. The introduced gene may be a heterologous gene (i.e. not present in the subject microorganism), or identical or homologous to an endogenous gene in the subject microorganism.

(42) The term thermophiles refer to microorganisms that can grow in high temperature environments, for example, at temperatures of at least 50 C. or more. Thermophiles have growth optima that range between 50 and 100 C. The genome and proteome composition of thermophiles are characterized by overrepresentation of purine bases in protein coding sequences, higher GC-content of structural RNAs, distinct synonymous codon usage, enhanced usage of positively charged residues and aromatic residues, and a decrease in polar uncharged residues in the encoded protein. Thermophiles have optimal growth temperatures above 50 C., and typically between about 50-60 C. Extreme thermophiles have optimal growth temperatures above 65 C. and typically between about 70-80 C. Often extreme thermophiles are capable of growing at the temperatures used for thermophilic microorganisms.

(43) Anaerobic, thermophilic microorganisms that are used in at least one step in industrial fermentations are capable of, or have been engineered to be capable of, one or all of the steps of hydrolyzing cellulose and hemicellulose and converting the resultant hexose and pentose sugars, including xylose, to ethanol and acetic acid for a bioenergy source. Additionally, in accordance with the invention, this group of microorganisms can be recombinantly engineered to express exogenous BdhA or homolog thereof. Such strains can be made by techniques known in the art.

(44) Introduction of the expression vector into a host cell may be via any suitable method that is readily selected by one of skill in the art. Examples include the methods disclosed in Chung et al, Cha et al, U.S. Patent Application Publication No. 2008028340, Tripathi et al. [2010, Appl, Environ. Microbiol. 76:6591-6599], and Argyros et al. [2011, Appl, Environ. Microbiol. 77:8288-8294].

(45) Many classes of anaerobic, thermophilic bacteria are available for many purposes and stages in industrial fermentations. Cellulolytic microorganisms are capable of hydrolyzing cellulose. These bacteria produce cellulase which hydrolyzes cellulose to produce glucose. Many examples of cellulolytic, thermophilic microorganisms are known. Hemicellulolytic microorganisms produce xyalanases and are thus capable of hydrolyzing hemicellulose to release pentose sugars, especially xylose, that can then be further fermented. Useful reviews describing cellulolytic thermophiles and/or hemicellulolytic (extreme) thermophiles include, for example, Bergquist et al. (1999) FEMS Microbiol. Ecol. 28:99-110; Lynd et al. (2002) Microbiol. Mol. Biol. Rev. 66:506-577; Vanfossen et al. (2008) Ann. NY Acad. Sci. 1125:322-37. Some specific microorganisms described and known include, the cellulolytic thermophile Clostridium thermocellum [Raman et al. (2009) PLoS ONE 4(4): e5271 (2009); Zhang et al. (2005) J. Bacteriol. 187:99-106; Raman et al. (2011) BMC Microbiol. 11:134] and Clostridium thermohydrosulfuricum [Lovitt et al. (1984) App. Microbiol. 48:171-177]; as well as the hemicellulolytic extreme thermophiles including various Caldicellulosiruptor spp. [Blumer-Schuette et al. (2008) Curr. Opin. Biotechnol. 19:210-217; Blumer-Schuette et al. (2010) App. Microbiol. 76:8084-8092; Blumer-Schuette et al. (2011) J. Bacteriol. 193:1483-4; pub March 2011; e-published Jan. 7, 2011] and more specifically Caldicellulosiruptor obsidiansis [Hamilton-Brehm et al. (2010) App. Environ. Microbiol. 76:1014-1020; Mielenz et al. (2010) Abstract from The 32nd Symposium on Biotechnology for Fuel and Chemicals (Apr. 19-22, 2010)].

(46) These microorganisms are useful in the SHF, SSF, SSCF and CBP industrial processes as described below. Furthermore, CBP microorganisms are needed that produce ethanol as sole product, hydrolyze cellulose to fermentable oligomers, hydrolyze hemicellulose to fermentable oligomers, ferment cellulose oligomers, ferment xylose or xylose oligomers, produce ethanol in high titer (resistant to up to 4 to 5% ethanol), be resistant to up to 1% acetic acid from hemicelluloses, grow at thermophilic temperatures ranging from 55 to 80 C., are moderately resistant to common pretreatment inhibitors (furans, polyphenolics) and produce a multi-carbohydrase portfolio on the cellulosome [Mielenz (2009) in Molecular Biology and Biotechnology, 5th Edition, Ed. J. M. Walker & R. Rapley, Royal Society of Chemistry, pp: 548-584]. No such single microorganism is presently known and the present invention addresses the resistance to pretreatment inhibitors by allowing genetic engineering of appropriate CBP microorganisms to express exogenous BdhA or homologs thereof active at reducing common pretreatment inhibitors such as furfural and 5-HMF.

(47) Additionally, metabolic engineering of microorganisms (altering specific fermentative pathways in a microorganism) is being used to direct microorganisms to preferentially or exclusively produce particular biofuels from sugar substrates. Thus exogenous BdhA or homologs thereof can be incorporated in such strategies to produce anaerobic, thermophilic microorganisms of the invention capable of producing a particular biofuel of interest such as ethanol, butanol, isobutanol and the like.

(48) Accordingly, in some embodiments, the anaerobic thermophiles of the invention which have been modified to express exogenous BdhA or a homolog thereof are Clostridium species. Examples of useful Clostridium spp., C. thermocellum, C. straminisolvens, and C. thermocopriae, with C. thermocellum being a preferred organism. C. thermocellum is an established bacterium for hydrolysis of cellulose in the biofuel production process. Its growth temperature range is 45-65 C. and it grows optimally at 60 C. C. thermocellum strains that express exogenous Teth39 _1597 or a homolog thereof may be used in methods to produce n-butanol, furfural, and the other alcohols from when aldehydes are reduced by this enzyme.

(49) In other embodiments, the anaerobic thermophiles of the invention which have been modified to express exogenous BdhA or a homolog thereof are Caldicellulosiruptor species. Caldicellulosiruptor spp. are extremely thermophilic, anaerobic, Gram-positive bacteria capable of hydrolyzing hemicellulose and exhibit optimal growth in the temperature range of 70-80 C. The members of this genus are also capable of cofermentation of pentose and hexose sugars, including xylose. The Caldicellulosiruptor spp. suitable for use in the present invention include C. bescii, C. saccharolyticus, C. hydrothermalis, C. kristjanssonii, C. kronotskyensis, C. lactoaceticus, C. owensensi, C. acetigenus and C. obsidiansis. C. bescii is a preferred species.

(50) Caldicellulosiruptor obsidiansis (C. obsidiansis) is an extreme thermophile isolated from Yellowstone National Park (Hamilton-Brehm 2010). C. obsidiansis grows optimally at 78 C. and primarily produces acetic acid and lower levels of ethanol. It readily hydrolyzes hemicellulose and to a slower degree, hydrolyzes cellulose.

(51) In other embodiments, the anaerobic thermophiles of the invention which have been modified to express exogenous BdhA or a homolog thereof are Thermoanaerobacter and Thermoanaerobacterium species and T. pseudethanolicus strains Thermoanaerobacter and Thermoanaerobacterium species, include but are not limited to Thermoanaerobacter brockii (sample strain: ATCC 35047), Thermoanaerobacter ethanolicus (sample strain: JW200 DSM 2246), Thermoanaerobacter pseudethanolicus (sample strain: 39E ATCC 33223), Thermoanaerobacterium aotearoense (sample strain: DSM 10170), Thermoanaerobacterium saccharolyticum (sample strains include B6A, B6A-RI ATCC 49915, and JW/SL-YS485 DSM 8691), Thermoanaerobacterium thermosaccharolyticum (sample strains include ATCC 7956, HG-8 ATCC 31960, M0523, M0524 and M0795) and Thermoanaerobacterium xylanolyticum (sample strain: DSM 7097).

(52) Genetic transformation of Thermoanaerobacter and Thermoanaerobacterium species is described in Shaw et al. (2010) Appl. Environ. Microbiol. 76:4713-4719.

(53) In certain embodiments, the present invention provides microorganisms for cloning and expressing exogenous BdhA or a homolog thereof. Such microorganisms include bacteria, yeast and fungi, as well as cells, such as mammalian cells or insect cells. As discussed above in the section on BdhA Proteins, Nucleic Acids and Expression Vectors, hosts are well known in the art and include E. coli, S. cerevisiae and the like.

(54) Cell Lysates

(55) Yet another aspect of the invention is drawn to cell lysates prepared from the microorganisms of the invention. Cell lysates comprise active BdhA polypeptides and can thus be used directly to reduce the aldehyde content of biomass. On the industrial scale, cell lysates can be grown in large fermentor vessels. Once the appropriate cell density is achieved with an appropriate level of BdhA aldehyde reductase activity, the cells are harvested and lysed. Lysing can be by physical treatment, by chemical treatment, by enzymatic treatment or a combination thereof Once lysed, the mixture can be used directly with biomass. Alternatively, the cellular debris and membranes can be removed by centrifugation and the remaining supernatant (which has the BdhA aldehyde reductase activity) can be used in a method of the invention.

(56) Methods

(57) In accordance with the invention, the anaerobic, thermophilic microorganisms and proteins of the invention are useful to detoxify aldehydes that are present in biomass, especially in lignocellulosic biomass pretreated with acid as used in many industrial fermentation processes to produce one or more biofuels. Hence, this invention provides a method of improving yield and/or efficiency of biomass conversion to biofuel by contacting biomass with an anaerobic, thermophilic microorganism of the invention, a polypeptide of the invention or a cell lysate of the invention for a time and under thermophilic, anaerobic conditions sufficient to detoxify inhibitory aldehydes present in said biomass, and thereby produce improved yields or efficiency of biomass conversion to biofuel, relative to biomass that has not been so treated, when the so-treated biomass is used in industrial fermentation processes.

(58) Generally, the aldehyde detoxification treatments of the invention occur after hydrolysis of biomass, since that is when aldehydes are generated. However, the aldehyde detoxification treatments of biomass can be conducted before or during SHF, SSF, SSCF or CBP fermentation steps. If the hydrolysis steps that produce aldehydes occur simultaneously with a fermentation step or are conducted by microorganisms, then the aldehyde detoxification treatments can also be conducted simultaneously with those steps. In a preferred method, the biomass is pretreated with acid, then simultaneously treated for aldehyde detoxification and fermented with one or more microorganisms to produce biofuels.

(59) The ethanol and acetic acid (and other fermentation by-products which can supply energy) from industrial fermentations are referred to as biofuel. Biofuel derives its energy from biological carbon fixation and covers many types of energy sources including ethanol, butanol, biodiesel (produced from biological oils and fats), bioethers, biogas (methane) and even biomass (when used in combustion processes). As used herein, biofuel includes, but is not limited to, one or more of the energy-yielding molecules produced by the biological hydrolysis and fermentation of biomass. For example, biofuel obtained from biomass includes 2-4 carbon atom alcohols, such as ethanol, butanol, isobutanol, as well as acetate, and is not limited to any particular combination of products that are produced, e.g., such as ethanol and acetic acid, singly or in combination. Ethanol is sometimes referred to as bioethanol, cellulosic ethanol, corn ethanol and other names, which may typically reflect the source from which the ethanol is obtained. Ethanol has the chemical formula CH.sub.3CH.sub.2OH, no matter its source or production method.

(60) Biomass is a renewable resource and has three main structural componentstypically, 33-50% cellulose, 17-35% hemicellulose and 12-24% ligninwith the remainder being minerals, protein and other minor materials. Biomass is primarily lignocelluosic plant material but may include non-plant waste materials such as animal waste. Hence, biomass as used herein, includes, but is not limited to, forestry residue, agricultural residue, municipal solid waste (MSW), animal waste, yard waste, wood products, fiber resulting from grain operations, waste cellulosic products (e.g., paper and pulp operations), grasses, and energy crops whether grown for biomass production or for other purposes. The embodiments of the invention can use any type of biomass, alone or in any combination or in any ratio. It is within the knowledge of the art to select and combine biomass types for use in the present invention. For example, the biomass can comprise an energy crop alone, or municipal solid waste and yard waste, or forestry residue, paper waste and pulp waste, and on in any of the many possible combinations.

(61) In accordance with the invention, biomass can be used with or without pretreatment before culturing with microorganisms to ferment the sugars in the mash and generate biofuel. Pretreatment can be done by physical (e.g., grinding), chemical (e.g., acid treatment) or biological (e.g., enzymatic hydrolysis) techniques, and methods therefor are well known in the art [see, e.g., Zheng et al. (2009) Int. J. Agric. & Biol. Eng. 2:51-67]. As used herein, unless the context shows otherwise, biomass includes such pretreated biomass.

(62) The general aspects of culturing biomass with microorganisms as well as the equipment and apparatus needed are known to the ordinarily skilled artisan or can be readily determined, whether on the laboratory scale or on an industrial scale. See, Mielenz (2009) for an example of an industrial scale production system. Such general aspects include preparation of the biomass, introduction of the biomass and any other media into a fermentation reactor or vessel using sterile techniques, maintaining cultures and stocks of the microorganisms, timing of inoculation, amounts of an inoculum, the form of the inoculum (e.g., from exponentially growing cultures or from lag-phase cultures and otherwise), co-culturing of microorganisms in the fermentation, time length of the fermentation, appropriate thermophilic growth conditions, removal or purification of the biofuel from the fermentation mixture or mash and more.

(63) The fermentative conversion processes that breakdown biomass to produce biofuel include, but are not limited, to separate hydrolysis and fermentation (SHF); simultaneous cellulose hydrolysis (or saccharification) and fermentation (SSF); simultaneous saccharification and cofermentation (SSCF); and consolidated bioprocessing (CBP). Each of these processes can be practiced with the proteins or anaerobic, thermophilic microorganisms of the invention at any stage thereof. The preferred growth format is CBP. While the ability to conduct CBP has not yet been achieved with a single, aldehyde-tolerant, anaerobic, thermophilic microorganism (capable of cellulose and hemicellulose hydrolysis as well as hexose and pentose sugar fermentation), the present invention provides a way to achieve aldehyde tolerance.

(64) The duration needed for fermentation that yields high substrate conversion lasts for the time needed to produce biofuel and can be determined by those of skill in the art. For example, fermentation to end products should occur in the shortest time possible to allow maximum and efficient conversions of the biomass before exhaustion of the substrate. An example of good substrate conversion would be to achieve at least about 50%, 55%, 60%, 65%, 70% or 75% conversion over a time period of from at least about 30 to about 200 hours or from at least about 50 to about 150 hours.

(65) A still additional aspect of the invention provides methods to produce bulk and platform chemicals, including alcohols, by (a) removing sufficient inhibitory aldehydes in a lignocellulosic mixture undergoing a fermentative reaction to produce bulk or platform chemicals by adding one or more polypeptides of the invention to said mixture in an amount and for a time sufficient to convert such aldehydes to nontoxic compounds, and (b) recovering the bulk or platform chemical of interest. Examples of bulk and platform chemicals include ethanol, butanol, lactate, 1,4-dicarboxylic acids (succinic, fumaric, malic), glycerol, sorbitol, mannitol, arabinitol, L-ascorbic acid, xylitol, hydrogen gas, 2,5-furan dicarboxylic acid, 3-hydroxy propionic acid, aspartic acid, glutaric acid, glutamic acid, itaconic acid, levulinic acid, 3-hydroxybutyrolactone, fatty acids, fatty-derived molecules, isoprenoids, isoprenoid-derived molecules, alkanes, isopentanol, and isoamylacetate. When using the polypeptides of the invention, increased specific productivity (gram product per gram cell and hour) can be achieved due to the faster removal of inhibitory furan compounds and carbonyl compounds from the medium.

(66) A further aspect of the invention relates to methods to produce butanol from biomass which comprises culturing biomass with an anaerobic, thermophilic microorganism of the invention for a time and under fermentation conditions suitable to produce butanol and recovering the butanol. The invention also contemplates similar methods for producing ethanol, furfuryl alcohol, and/or 2,5-(dihydroxymethyl)furan, by culturing as for butanol production and recovering the desired alcohol. Depending on the source of biomass, certain alcohols may predominate over others, for example, using the method with furan waste from pulp or paper processing is advantageous for recovering furfuryl alcohol. These methods are practiced as described above for biomass conversion to biofuel.

(67) Methods for recovery and downstream processing of biofuel, specific alcohols and bulk and platform chemicals are known in the art. For example, ethanol can be recovered by distillation, and using a thermophilic process is an advantage in that regard, especially when working on an industrial scale. Ethanol can be removed from fermentation reactors as it is produced to avoid its toxic effects on microorganisms and methods for such removal are known in the art. Butanol can be recovered by adsorption techniques. All the methods of the invention can be practiced on any scale, from small batches in a laboratory to industrial scale production.

(68) The foregoing is considered as illustrative of the principles of the invention. Further, since numerous modifications and changes will readily occur to those skilled in the art, it is not desired to limit the invention to the exact construction and operation shown and described, and accordingly, all suitable modifications and equivalents may be resorted to, falling within the scope of the invention. All referenced patents, patent applications or other documents cited are herein incorporated by reference in their entirety.

EXAMPLE 1

Identification of a Teth39E Fe-Dependent, Alcohol Dehydrogenase

(69) The saccharolytic thermophile Thermoanaerobacter pseudethanolicus 39E (Teth39E) tolerates furfural and HMF, and reduces these compounds to their respective alcohols.

(70) Teth39E (DSMZ 2355) was purchased from Deutsche Sammlung von Mikroorganismen and Zellkulturen GmbH (DSMZ). Anaerobic growth medium was prepared anaerobically by a modified Hungate technique and consisted of 4.5 mM KCl, 4.7 mM NH4Cl, 2.5 mM MgSO4.7H2O, 1.0 mM NaCl, 0.7 mM CaCl2.2H2O, 0.25 mg/ml resazurin, 2.8 mM cysteine-HCl, 6.0 mM NaHCO3, 1 mM potassium phosphate buffer (pH 6.8), 10 mM 3-(N-morpholino)-propanesulfonic acid (pH 6.8), 1 Wolfe's trace minerals, 1 Wolfe's vitamin supplement, 0.1% (w/v) yeast extract, and 40 mM glucose [Miller and Wolin (1974) Appl. Microbiol. 27:985-987; Wolin et al. (1963) J. Biol. Chem. 238:2882-2886]. Furan aldehydes were added from degassed concentrated stock solutions. Cultures were grown at 65 C. from a 1% inoculum in Balch tubes (10 mL) or 125 mL serum bottles (50 mL) Cell growth was monitored by optical density at 600 nm, either directly in the Balch tube using a Spectronic 200 spectrophotometer (Thermo Fisher Scientific, Waltham, Mass.) or as 200 L samples transferred to a 96-well plate and read on a Synergy Mx plate reader (BioTek, Winooski, Vt.). All growth experiments were performed in triplicate.

(71) Lower concentrations of furfural (10 and 20 mM) and 5-hydroxymethylfurfural (10 mM) stimulated growth of Teth39E, with increased cell yields after 12 h for both (see FIGS. 1A and 1B). Furfural addition increased specific growth rate at both 10 mM (0.520.03 h.sup.1) and 20 mM (0.430.03 h.sup.1) versus the control without furfural (0.380.01 h.sup.1) (see FIG. 1A) and 5-hydroxymethylfurfural (5-HMF) also increased specific growth rate at 10 mM versus the control (0.510.03 v. 0.410.02 h.sup.1) (see FIG. 1B). The furan aldehyde concentration which resulted in 50% inhibition of growth (IC.sub.50) with furfural was 30 mM after 12 h and 30 to 40 mM after 24 h. The IC.sub.50 for 5-HMF was between 20 and 30 mM after both 12 and 24 h.

(72) Furfural and 5-HMF were measured spectrophotometrically (DU 800, Beckman Coulter, Brea, Calif.) at 304 and 323 nm, respectively, and concentrations were determined using standard curves generated in growth medium. In addition, 2,5-(dihydroxymethyl)furan was measured using GC-MS. Teth39E was grown in the presence of 15 mM furfural or 5-HMF and furan aldehyde and respective furan alcohol concentrations were measured along with growth, either spectrophotometrically or by GC-MS. As shown in FIGS. 2A and 2B, furfural (FIG. 2A) and 5-HMF (FIG. 2B) concentration decreased and 2,5-(dihydroxymethyl)furan concentration increased concomitant with growth, indicating reduction of 5-HMF by Teth39E. Furfural was most likely also reduced to furfuryl alcohol; however, detection of the latter is complicated by its polymerization at the growth temperature of Teth39E.

(73) The gene product of Teth39_1597 is an aldehyde reductase (BdhA) that reduces furfural and 5-HMF to furfuryl alcohol and 2,5-(dihydroxymethyl)furan in an NADPH-dependent manner. See FIG. 3.

EXAMPLE 2

Characterization of BdhA

(74) To identify the enzymes responsible for furfural and 5-HMF conversion, the proteomes were compared for strain Teth39E grown in the presence or absence of 15 mM furfural. Many proteins were upregulated at least 2-fold by furfural, including homologs of proteins involved in furfural detoxification in Escherichia coli (Miller 2009), and these proteins were targeted for further investigation. The protein encoded by the Teth39_1597 locus is a predicted Fe-dependent, alcohol dehydrogenase (bdhA) and the expression was upregulated approximately 7-fold in the presence of 15 mM furfural.

(75) The bdhA gene was PCR amplified from Teth39E genomic DNA and cloned into E. coli expression vector pET30a (see FIG. 6A) under control of an IPTG-inducible, strong T7 promoter via the methods described below.

(76) Teth39E genomic DNA was isolated using the Wizard Genomic DNA Purification kit (Promega, Madison, Wis.). The bdha gene was PCR amplified using Phusion polymerase (New England Biolabs, Ipswich, Mass.) and cloned into pET30a (EMD Millipore, Billerica, Mass.) behind 6 His- and S-tags. See FIG. 6A. Expression plasmids were transformed in BL21 (DE3) E. coli according to the manufacturer's protocol (Invitrogen, Grand Island, N.Y.). Cells were grown in 50 mL 2YT medium at 37 C. to OD.sub.600 of 0.8-1.0, then induced with 100 M isopropyl--D-thiogalactopyranoside and switched to 30 C. for 16 h. Cells were harvested at 4 C. (3,000g, 30 min), washed in 50 mL 100 mM sodium phosphate buffer, pH 7 (buffer A), and re-suspended in 5 mL buffer A. Enzyme assays were performed aerobically at 60 C. with whole cell lysates and specific activity was determined by measuring the change in absorbance at 340 nm due to oxidation of NADPH or NADH.

(77) Cell suspension (450 L) was added to 0.1 mm zirconia beads (300 L) and vortexed 460 sec with 30 sec on ice in between. Samples were centrifuged (14,000g, 2 min) and the resulting supernatant was used for enzyme assays.

(78) For the enzyme assays, Buffer A (1 mL), 10 mM NAD(P)H (25 L), and 400 mM aldehyde (50 L) were added to a 2 mL quartz cuvette, sealed with a butyl stopper, and equilibrated to 60 C. Assays were read at 340 nm (DU 800) for 150 sec to establish a baseline slope before whole cell lysate was added (1-5 L). Cuvettes were inverted once to mix and read an additional 450 sec. The decrease in absorbance over time was calculated and the baseline slope was subtracted. NAD(P)H concentration was determined using the extinction coefficient (NADH: 6220 M.sup.1 cm .sup.1, NADPH: 6270 M.sup.1 cm.sup.1) and specific activity was calculated as the change in moles NAD(P)H/min/mg of whole cell lysate protein. Protein concentration was determined using the Bradford assay (Bio-Rad, Hercules, Calif.) with bovine serum albumin as a standard. Specific activity was measured for the pET30a vector (control) and overexpressed Teth39_1597 (BdhA) with acetaldehyde, butyraldehyde, isobutyraldhyde, furfural, and 5-HMF. Furfural was also assayed under anaerobic conditions. BdhA activity was compared to the vector-only control.

(79) BdhA showed activity above the vector control under aerobic conditions using NADPH as cofactor with both furan aldehydes. The assays showed reducing activity for furfural, 5-HMF, butyraldehyde, isobutyraldehyde, and acetaldehyde in the presence of NADPH (see Table 1 and FIG. 7). Specific activity was 4.970.17 U with furfural and 10.060.80 U with 5-HMF. The highest activity was observed against butyraldehyde (approximately 14.583.57 moles/min/mg) while the lowest activity occurred with isobutyraldehyde as the substrate. No activity was detected with BdhA (above the vector control) using NADH as the cofactor, and no other cofactors were required.

(80) TABLE-US-00001 TABLE 1 BdhA Aldehyde Activities Substrate Vector control BdhA Furfural 0.33 0.13 4.97 0.17 5-HMF 0.44 0.16 10.06 0.80 Acetaldehyde 0.02 0.15 4.54 0.76 Butyraldehyde 0.09 0.05 14.58 3.57 Isobutyraldehyde 0.10 0.21 0.63 0.29

(81) When overexpressed in E. coli, the Teth39E expression BdhA vector produced a protein of the correct molecular weight whereas the control vector did not as shown by SDS PAGE and Coomassie blue staining (see FIG. 6B). The overexpressed protein had an expected molecular weight of 48 kD, including N-terminal tags and cleavage sites.

(82) The optimal temperature for BdhA activity was determined from purified enzyme as follows. A 1 liter culture of E. coli BL21 (DE3) harboring the pET30a-BdhA expression construct (see FIG. 6A) was grown to mid-log phase and induced with 0.4 mM IPTG and allowed to incubate for 16 h at 30 C. with shaking at 250 rpm. The induced cells were harvested via centrifugation at 5,000g for 20 min at 4 C. and washed 3 times with 40 mL ice-cold phosphate buffered saline (PBS) at pH 7.2 and placed on ice. The cell pellet was resuspended in binding buffer (20 mM sodium phosphate, 500 mM NaCl, 20-40 mM imidazole, pH 7.4) containing 0.2 mg/mL lysozyme, 20 g/mL DNAse, 1 mM MgCl.sub.2, 1 mM PMSF and stirred for 30 min at room temperature. The cells were then subjected to 52 min rounds of sonication (Branson Sonifier 450 with microtip, duty cycle at 30%) while kept in an ice water bath. The lysate was centrifuged at 7,500g for 20 min at 4 C. and the supernatant was transferred to a new 50 mL conical tube. Purification of the 6 His tagged BdhA enzyme was performed using 1 mL HisTrap FF crude affinity column according to the supplier's protocol (GE Healthcare, Piscataway, N.J., USA). Enzyme assays were performed as described above only 3 g of purified BdhA enzyme was used rather than crude lysate. For determining the optimal temperature for BdhA, 1 mL assays containing 100 mM phosphate buffer (pH 7.5), 20 mM butyraldehyde, and 0.25 mM NADPH were monitored for loss of absorbance at 340 nm for 20 seconds at 30-90 C. in 5 C. intervals. Each assay was preheated to the appropriate temperature before adding 3 g of purified BdhA enzyme. A temperature controlled cuvette holder (Shimadzu UV-800) was used to maintain assay temperature. The results are shown in FIG. 8. The optimal temperature was observed to be 75 C.

(83) The optimum pH was also determined for BdhA by using butyraldehyde as the substrate and NADPH as the cofactor. The assay conditions were as described above but a series of buffers increasing in pH from 4-10 were substituted for 100 mM phosphate buffer (pH 7.5). The optimal relative activity was found to be at a value of 8.0 pH units. See FIG. 9.

(84) The bdhA gene was inserted into the genome of the cellulolytic, thermophilic microorganism, Caldicellulosiruptor bescii. The coding sequence for BdhA the bdhA gene set forth in SEQ ID NO: 1 was PCR amplified from Thermoanaerobacter pseudethanolicus 39E and cloned into the shuttle vector pDCW 171 (FIG. 10A), generating the BdhA expression cassette, which consists of the bdha coding region flanked by a strong promoter (P.sub.s-layer) at the 5 end and a 6 His-tag plus Rho-independent terminator at the 3 end. Flanking the expression cassette are two kb sequences enabling homologous recombination into a targeted area in the chromosome. Also included in the pDCW 171 vector is a pyrF cassette allowing for uracil prototrophic selection of transformants. The construct was transformed into a C. bescii host strain (JWCB018) according to the methods described in Chung et al. [PNAS, 2014, 111:8931-8936]. Homologous recombination can occur at either the upstream or the downstream targeted chromosomal region, integrating the plasmid into the genome and generating a strain that is a uracil prototroph due to integration of the pyrF cassette on pDCW 171. Counter-selection with 5-fluoroorotic acid (5-FOA) selects for loss of the plasmid sequences, specifically the pyrF cassette, but not the BdhA expression cassette. Bent arrows depict primers used for verification of the integrated expression cassette (see FIG. 10B).

(85) TABLE-US-00002 SEQIDNO:1 atgATGAAATTTGAATTTTATAACCCGACCCGACTAATTT TTGGTGCAGGTTCATTAGGACAGTTAGGTAAAGTAGTTAA TCAATATGGTAAAAAAGCATTGCTTGTCATTGGTGGTGGA AGTGTAAAGAAAAGTGGAGCGTTTGATCGAGCAGTAGCAA GTCTCAAAGCAGCGGGTGTTTTAGTGGTAGAATTCTCAGG TGTTGAGCCAAACCCCCGCCTGTCAACTGTAGTGCGTGCT TCAGAACTGGCAAAAAAAGAAGCATGTGATGTGGTTATAG GTATGGGTGGCGGTAGCGTCATGGACGCCTCAAAAGTAAT TGCAGCCTCAGTCCTTTATGAAGGCGATCCTAAGGATATG CTTGTACGGGCAGGAAAAGCGCCCAGGCTGCCGGAGCGAG CTCTTCCTATTATCACTGTTCCTACCCTGGCGGCAACTGG CTCGGAAATGAACAACGGTGCGGTGATCACGATTGACGAT GAAGGAGAAAAGCTAAAAACATTCGTTCAGGCCGAGGTTC TCTATCCTCGAGTGGCAGTGGTGGATCCTGAACTTACGAT GACAGTGCCCAAGAATCACACAGCTTTTGGGGTTTGCGAT ATAATAACCCATGTGACCGAGGGTTATTTTAACGGTATAG ACGGGACTCCTCTTCAGGACAGATTTGCCGAGGGAGTGAT CCTTACTGTCTTGGAGTGGGGACCAAAGGCGGTTAGTGAT GGAAGTGACCTGGAAGCGCGCACTCAGGTGCAGTGGGCGT CGATAGTTGCTCTTAATGGGTGGGTACAAGTAGGAACAAA CGGAGCGTACCCTGTTCATATGATCGAGCACACACTTTCC GCACTCTACGATATCCCCCATGGAGCAGGGTTAGCAGTCG TGAACCCCGCTTGGATGCGCTTTGCTGCAAGATTCCGCCC CGAACGTTTTGCCCAATTTGCTCAACGTATCTTTGGTTTG ACAGCAACAGGCAAAGACACCTTGAGCCTTGCCATGGAAG GTATTGATAAGTTTGAAGAGTTCTTGCGTTCAATAGGTTG TCCTACACGCTTGTCGGAATTGGGCATTGGAGAAATTACC GAGGAAATGCTTTTCCGTTATGCGGAAGAGACGCTGAAAG TGCTTCAGGATGAAGAAGGAAGGCTTCCAGGTCGTCCCTC TCTGCGAAAGGAAGATATTGTAGAAATACTACGCATGGCAATGtga SEQIDNO:2 MMKFEFYNPTRLIFGAGSLGQLGKVVNQYGKKALLVIGGG SVKKSGAFDRAVASLKAAGVLVVEFSGVEPNPRLSTVVRA SELAKKEACDVVTGMGGGSVMDASKVIAASVLYEGDPKDM LVRAGKAPRLPERALPIITVPTLAATGSEMNNGAVTTIDD EGEKLKTFVQAEVLYPRVAVVDPELTMTVPKNHTAFGVCD IITHVTEGYFNGIDGTPLQDRFAEGVTLTVLEWGPKAVSD GSDLEARTQVQWASIVALNGWVQVGTNGAYPVHMTEHTLS ALYDIPHGAGLAVVNPAWMRFAARFRPERFAQFAQRIFGL TATGKDTLSLAMEGIDKFEEFLRSIGCPTRLSELGIGEIT EEMLFRYAEETLKVLQDEEGRLPGRPSLRKEDIVEILRMAM.

(86) Transformants were selected on a minimal medium without uracil. Counter-selection for double recombinants and loss of the suicide plasmid were screened for by picking colonies onto media containing 5-FOA. PCR was used to verify integration of the bdhA gene allele at the target locus within the chromosome (FIG. 11A). The total cellular protein was separated on an SDS-PAGE gel for wild-type C. bescii; the parent strain (JWCB018), and the expression strain JWCB044 grown at 65, 70, and 75 C. (FIG. 11B). The separated proteins were stained with Coomassie blue, transferred to a blotting membrane and subjected to Western analysis using anti-His antibodies (FIG. 11B). The BdhA enzyme was heterologously expressed in C. bescii at 65-75 C. as indicated by antibody detection in total cell protein.

(87) Growth experiments were conducted to test the phenotype of a C. bescii strain expressing BdhA (JWCB044) compared to a parent strain (JWCB018) when exposed to 5 and 10 mM furfural. The cells were grown in 10 mL of a minimal defined medium [Farkas et al. (2013) J. Ind. Microbiol. Biotechnol. 40:41-49] in Balch tubes incubated at 75 C. with shaking at 100 rpm. Experiments were inoculated in triplicate at equal cell densities from fresh overnight cultures. Growth was measured by placing individual Balch tubes in a Spec20 spectrophotometer and recording the absorbance at 600 nm. Furfural was added after 4 h of incubation and growth was measured periodically for 28 h. Compared to the parent strain control (JWCB018), the BdhA expression strain (JWCB044) displayed increased cell densities at 24 h of growth by 12.2% for the 5 mM furfural treatment and 21.7% when 10 mM furfural was added. See FIG. 12. A 15 mM furfural treatment, when applied to both JWCB018 and JWCB044 resulted in an improvement in the final OD600 values by 49% in JWCB044 after 24 h of growth. The residual furfural concentration was measured via HPLC analysis in cultures of JWCB018 and JWCB044 after 24 h of growth in the presence of either 5, 10, or 15 mM furfural. Uninoculated controls showed no degradation of furfural over time. When exposed to 5 mM furfural, the parent strain displayed some ability to reduce furfural to furfuryl alcohol in situ; however, at 10 mM furfural, no furfural was reduced and 100% remained in the medium after 24 h. In contrast, the strain expressing BdhA showed a dramatic difference in furfural concentration, with no detectable furfural remaining in any culture after 24 h. See FIG. 13. These results demonstrate that the engineered strain expressing BdhA is improved over the parent strain (which is derived from the wild-type) and tolerates significant concentrations of the furan aldehyde, furfural.

EXAMPLE 3

Bacterial Homology to BdhA

(88) Table 2 lists the sequenced microorganisms that have coding sequences that share at least 60% identity and homology with BdhA as determined by the BLAST algorithm in May 2013.

(89) TABLE-US-00003 TABLE 2 % Protein Accession Strain identity No. Thermoanaerobacter pseudethanolicus 100% YP_001665577.1 ATCC 33223 Thermoanaerobacter brockii subsp. finnii Ako-1 Carboxydothermus hydrogenoformans 96% YP_360528.1 Z-2901 Thermacetogenium phaeum DSM 12270 92% YP_006920865.1 Syntrophothermus lipocalidus DSM 12680 93% YP_003701586.1 Thermoanaerobacter mathranii 89% YP_003677126.1 subsp. mathranii str. A3 Thermoanaerobacter mathranii 89% CAZ39598.1 Thermoanaerobacter italicus Ab9 89% YP_003476555.1 Thermococcus litoralis DSM 5473 70% ZP_09730910.1 Spirochaeta thermophila DSM 6192 71% YP_003874393.1 Chlorobium chlorochromatii CaD3 69% YP_380004.1 Desulfobulbus propionicus DSM 2032 68% YP_004194670.1 Geobacter bemidjiensis Bem 67% YP_002137602.1 Geobacter sp. M21 67% YP_003020662.1 Desulfovibrio magneticus RS-1 65% YP_002951509.1 Chlorobium limicola DSM 245 66% YP_001943939.1 Chlorobium phaeovibrioides DSM 265 64% YP_001130471.1 uncultured bacterium 64% EKD39159.1 Desulfovibrio sp. U5L 65% ZP_10078352.1 Desulfovibrio desulfuricans ND132 62% YP_005167244.1 Desulfovibrio salexigens DSM 2638 62% YP_002993144.1 Chlorobium luteolum DSM 273 63% YP_374851.1 Thermanaerovibrio acidaminovorans 64% YP_003318139.1 DSM 6589 Thermanaerovibrio velox DSM 12556 62% ZP_09412593.1 Carboxydothermus hydrogenoformans 86% AAG23613.1

(90) Although the various aspects of the invention have been illustrated above by reference to examples and preferred embodiments, it will be appreciated that the scope of the invention is defined not by the foregoing description but by the following claims properly construed under principles of patent law.