CD5 CHIMERIC ANTIGEN RECEPTOR FOR ADOPTIVE T CELL THERAPY
20180104308 ยท 2018-04-19
Inventors
Cpc classification
A61K39/395
HUMAN NECESSITIES
A61K39/4611
HUMAN NECESSITIES
A61K45/06
HUMAN NECESSITIES
A61K38/1774
HUMAN NECESSITIES
C07K2317/94
CHEMISTRY; METALLURGY
C07K14/715
CHEMISTRY; METALLURGY
A61K39/464429
HUMAN NECESSITIES
C07K16/2896
CHEMISTRY; METALLURGY
A61K2239/38
HUMAN NECESSITIES
C07K2317/92
CHEMISTRY; METALLURGY
International classification
C07K14/705
CHEMISTRY; METALLURGY
A61K45/06
HUMAN NECESSITIES
C07K14/715
CHEMISTRY; METALLURGY
A61K39/395
HUMAN NECESSITIES
Abstract
Embodiments of the disclosure include methods and compositions related to immunotherapy that targets CD5. In particular embodiments, immune cells engineered to comprise a chimeric antigen receptor (CAR) that targets CD5 are contemplated, and uses thereof. In particular embodiments, the immune cells expressing the CAR do not commit fratricide to any great extent against T cells that express CD5 and which are endogenous to an individual receiving the immune cells.
Claims
1. A method of inhibiting proliferation and/or activity of CD5-positive cells in an individual, comprising the step of contacting the cells with a therapeutically effective amount of immune cells that express a chimeric antigen receptor (CAR) that targets CD5.
2. The method of claim 1, wherein the cells that are contacted are cancer cells.
3. The method of claim 1, wherein the CD5-positive cells are normal cells or are cancer cells.
4. The method of claim 3, wherein the CD5-positive normal cells are B cells.
5. The method of claim 3, wherein the CD5-positive cancer cells are T cells, B cells, breast cancer cells, or thymus cancer cells.
6. The method of claim 1, wherein said contacting is performed in vitro.
7. The method of claim 1, wherein said contacting is performed in cell culture.
8. The method of claim 1, wherein said contacting is performed in vivo, and said immune cells are cells from an individual.
9. The method of claim 1, wherein said contacting is performed in vivo, and said immune cells are T cells from an individual.
10. The method of claim 9, wherein said T cells are autologous to the individual.
11. The method of claim 9, wherein said T cells are allogeneic to the individual.
12. The method of claim 1, wherein said immune cells are T cells, NK cells, dendritic cells, or a mixture thereof.
13. The method of claim 1, wherein said immune cells are T cells.
14. The method of claim 13, wherein said T cells are CD4+ T cells.
15. The method of claim 13, wherein said T cells are CD8+ T cells.
16. The method of claim 13, wherein said T cells are Treg cells.
17. The method of claim 1, wherein the CAR comprises an extracellular domain that comprises an anti-CD5 scFv.
18. The method of claim 1, wherein the CAR comprises an extracellular domain that comprises CD72 (Lyb-2).
19. The method of claim 17, wherein the CAR comprises one or more additional scFvs to the anti-CD5 scFv.
20. The method of claim 19, wherein the additional scFv targets CD19, CD20, CD22, Kappa or light chain, Glypican-3, CD30, CD33, CD123, CD38, ROR1, ErbB2, ErbB3/4, EGFR vIII, carcinoembryonic antigen, EGP2, EGP40, mesothelin, TAG72, PSMA, NKG2D ligands, B7-H6, IL-13 receptor ?2, IL-11 receptor R ?, MUC1, MUC16, CA9, GD2, GD3, HMW-MAA, CD171, Lewis Y, G250/CAIX, HLA-AI MAGE A1, HLA-A2 NY-ESO-1, PSC1, folate receptor-?, CD44v7/8, 8H9, NCAM, VEGF receptors, 5T4, Fetal AchR, NKG2D ligands, CD44v6 or CD7.
21. The method of claim 1, wherein the CAR comprises a transmembrane domain selected from the group consisting of CD3-zeta, CD28, CD8?, CD4, or a combination thereof.
22. The method of claim 1, wherein the CAR comprises a co-stimulatory molecule endodomain selected from the group consisting of CD28, CD27, 4-1BB, OX40, ICOS, and a combination thereof.
23. The method of claim 1, wherein the CAR comprises a co-stimulatory molecule endodomain that is not 4-1BB.
24. The method of claim 1, wherein the immune cells further comprise an additional CAR, a cytokine, a cytokine receptor, a chimeric cytokine receptor, or a combination thereof.
25. The method of claim 24, wherein the additional CAR is an activating CAR or an inhibitory CAR.
26. The method of claim 8, wherein the individual has received, is receiving, or will receive an additional cancer treatment.
27. The method of claim 26, wherein the additional cancer treatment comprises chemotherapy, immunotherapy, radiation, surgery, hormone therapy, or a combination thereof.
28. The method of claim 1, wherein the CD5-positive cells are normal cells and the individual has an autoimmunity disease or is in need of a transplant.
29. The method of claim 1, wherein the CD5-positive cells are normal early T cells and the individual has graft-versus-host disease.
30. The method of claim 28, wherein the autoimmunity disease is multiple sclerosis, type I diabetes, rheumatoid arthritis, systemic lupus erythematosus (SLE), or graft-versus-host disease.
31. The method of claim 1, wherein the immune cells harbor a polynucleotide that encodes the CAR.
32. The method of claim 31, wherein the polynucleotide further comprises a suicide gene, a cytokine, an additional CAR, a cytokine receptor, or a chimeric cytokine receptor
33. The method of claim 1, wherein the cells that are contacted are CD62L.sup.high T cells.
34. The method of claim 1, wherein the CAR comprises a spacer derived from IgG CH3 without the CH2 domain.
35. The method of claim 1, wherein the spacer is derived from CD8?.
36. A method of treating an individual having a CD5-expressing cancer, comprising the step of contacting the cells with a therapeutically effective amount of immune cells that express a chimeric antigen receptor (CAR) that targets CD5.
37. The method of claim 36, wherein the cells that are contacted are cancer cells.
38. The method of claim 36, wherein the CD5-positive cells are normal cells or are cancer cells.
39. The method of claim 38, wherein the CD5-positive normal cells are B cells.
40. The method of claim 38, wherein the CD5-positive cancer cells are T cells, B cells, breast cancer cells, or thymus cancer cells.
41. The method of claim 36, wherein said contacting is performed in vitro.
42. The method of claim 36, wherein said contacting is performed in cell culture.
43. The method of claim 36, wherein said contacting is performed in vivo, and said immune cells are cells from an individual.
44. The method of claim 36, wherein said contacting is performed in vivo, and said immune cells are T cells from an individual.
45. The method of claim 44, wherein said T cells are autologous to the individual.
46. The method of claim 44, wherein said T cells are allogeneic to the individual.
47. The method of claim 36, wherein said immune cells are T cells, NK cells, dendritic cells, or a mixture thereof.
48. The method of claim 36, wherein said immune cells are T cells.
49. The method of claim 48, wherein said T cells are CD4+ T cells.
50. The method of claim 48, wherein said T cells are CD8+ T cells.
51. The method of claim 48, wherein said T cells are Treg cells.
52. The method of claim 36, wherein the CAR comprises an extracellular domain that comprises an anti-CD5 scFv.
53. The method of claim 36, wherein the CAR comprises an extracellular domain that comprises CD72 (Lyb-2).
54. The method of claim 52, wherein the CAR comprises one or more additional scFvs to the anti-CD5 scFv.
55. The method of claim 54, wherein the additional scFv targets CD19, CD20, CD22, Kappa or light chain, Glypican-3, CD30, CD33, CD123, CD38, ROR1, ErbB2, ErbB3/4, EGFR vIII, carcinoembryonic antigen, EGP2, EGP40, mesothelin, TAG72, PSMA, NKG2D ligands, B7-H6, IL-13 receptor ?2, IL-11 receptor R ?, MUC1, MUC16, CA9, GD2, GD3, HMW-MAA, CD171, Lewis Y, G250/CAIX, HLA-AI MAGE A1, HLA-A2 NY-ESO-1, PSC1, folate receptor-?, CD44v7/8, 8H9, NCAM, VEGF receptors, 5T4, Fetal AchR, NKG2D ligands, CD44v6 or CD7.
56. The method of claim 36, wherein the CAR comprises a transmembrane domain selected from the group consisting of CD3-zeta, CD28, CD8a, CD4, or a combination thereof.
57. The method of claim 36, wherein the CAR comprises a co-stimulatory molecule endodomain selected from the group consisting of CD28, CD27, 4-1BB, OX40, ICOS, and a combination thereof.
58. The method of claim 36, wherein the CAR comprises a co-stimulatory molecule endodomain that is not 4-1BB.
59. The method of claim 36, wherein the immune cells further comprise an additional CAR, a cytokine, a cytokine receptor, a chimeric cytokine receptor, or a combination thereof.
60. The method of claim 59, wherein the additional CAR is an activating CAR or an inhibitory CAR.
61. The method of claim 36, wherein the individual has received, is receiving, or will receive an additional cancer treatment.
62. The method of claim 61, wherein the additional cancer treatment comprises chemotherapy, immunotherapy, radiation, surgery, hormone therapy, or a combination thereof.
63. The method of claim 36, wherein the CD5-positive cells are normal cells and the individual has an autoimmunity disease or is in need of a transplant.
64. The method of claim 36, wherein the CD5-positive cells are normal early T cells and the individual has graft-versus-host disease.
65. The method of claim 63, wherein the autoimmunity disease is multiple sclerosis, type I diabetes, rheumatoid arthritis, systemic lupus erythematosus (SLE), or graft-versus-host disease.
66. The method of claim 36, wherein the immune cells harbor a polynucleotide that encodes the CAR.
67. The method of claim 66, wherein the polynucleotide further comprises a suicide gene, a cytokine, an additional CAR, a cytokine receptor, or a chimeric cytokine receptor
68. The method of claim 36, wherein the cells that are contacted are CD62L.sup.high T cells.
69. The method of claim 36, wherein the CAR comprises a spacer derived from IgG CH3 without the CH2 domain.
70. The method of claim 36, wherein the spacer is derived from CD8a.
71. As a composition of matter, immune cells that express a chimeric antigen receptor (CAR) that targets CD5.
72. The composition of claim 71, wherein the cells are T cells, NK cells, dendritic cells, or a mixture thereof.
73. The composition of claim 71, wherein the CAR is expressed from a recombinant polynucleotide.
74. The composition of claim 71, wherein the polynucleotide further comprises a suicide gene, a cytokine, an additional CAR, a cytokine receptor, or a chimeric cytokine receptor.
75. The composition of claim 71, wherein the immune cells comprise a polynucleotide that comprises a suicide gene, a cytokine, an additional CAR, a cytokine receptor, or a chimeric cytokine receptor, wherein said polynucleotide is a different molecule than the polynucleotide that expresses the CAR that targets CD5.
76. The composition of claim 71, wherein the CAR comprises a co-stimulatory molecule endodomain selected from the group consisting of CD28, CD27, 4-1BB, OX40, ICOS, and a combination thereof.
77. The composition of claim 71, wherein the CAR comprises a co-stimulatory molecule endodomain that is not 4-1BB.
78. The composition of claim 74, wherein the additional CAR is an activating CAR or an inhibitory CAR.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0023] For a more complete understanding of the present invention, reference is now made to the following descriptions taken in conjunction with the accompanying drawing, in which:
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
DETAILED DESCRIPTION OF THE INVENTION
[0047] As used herein the specification, a or an may mean one or more. As used herein in the claim(s), when used in conjunction with the word comprising, the words a or an may mean one or more than one. As used herein another may mean at least a second or more. In specific embodiments, aspects of the subject matter may consist essentially of or consist of one or more elements or steps of the subject matter, for example. Some embodiments of the subject matter may consist of or consist essentially of one or more elements, method steps, and/or methods of the subject matter. It is contemplated that any method or composition described herein can be implemented with respect to any other method or composition described herein.
[0048] In the present disclosure, adoptive transfer of chimeric antigen receptor (CAR)-redirected T lymphocytes is extended to certain CD5-expressing cancers by targeting the CD5 antigen with a CD5 CAR. Particular aspects of the disclosure include methods of treating CD5-expressing cancers. The cancers may be of any kind, including leukemia, lymphoma, breast cancer, and thymus cancer, for example. In particular embodiments, the cancers are T-cell or B-cell malignancies. In other aspects of the disclosure, immune cells expressing the CD5 CAR are utilized for medical conditions other than cancer. As an example, the cells may be used to target unwanted/self-reactive T cells, such as in graft-versus-host disease or autoimmunity disorders, given that the immune cells of the disclosure can kill autologous T cells.
[0049] Described herein is a novel CAR targeting CD5, a common marker expressed in most T-cell leukemia/lymphoma blasts and normal T cells. Upon transduction with CD5 CAR, T cells produced limited and transient fratricide and eventually acquired resistance to self-killing. Expansion of CD5 CAR T cells coincided with downregulation of CD5 from the cell surface. At the same time, CD5 CAR T cells efficiently recognized and completely eliminated CD5-positive T-ALL and T cell lymphoma cell lines in vitro. Moreover, CD5 CAR T cells dramatically suppressed systemic in vivo disease progression in xenograft mouse models. Importantly, CD5 CAR T cells demonstrated significant cytotoxicity against primary T-ALL cells, highlighting the therapeutic potential of CD5 CAR for patients with T-cell malignancies. Overall, CD5 CAR can redirect normal T cells to eliminate CD5-positive malignant T-cells while producing only limited fratricide.
I. CD5
[0050] CD5 (for cluster of differentiation 5) is a transmembrane receptor that is expressed only in certain cells, including at least T- and some B-lymphocytes. CD5 is upregulated upon T cell activation and inhibits TCR signaling. CD5 is highly expressed in most T-cell leukemias/lymphomas as well as in B-cell chronic lymphocytic leukemia, mantle cell lymphoma, and hairy cell leukemia. CD5 also known to increase resistance to apoptosis.
[0051] An example of a human CD5 nucleic acid is at National Center for Biotechnology Information's GenBank? database at Accession No. NM_014207. An example of a human CD5 polypeptide is at GenBank?'s Accession No. NP_055022. One of skill in the art is able to generate antibodies, including scFv's against CD5 based on knowledge at least of the polypeptide and routine practices, although numerous anti-CD5 scFvs and monoclonal antibodies are already present in the art.
II. Chimeric Antigen Receptors
[0052] Genetic engineering of human immune cells to express tumor-directed chimeric antigen receptors (CAR) can produce antitumor effector cells that bypass tumor immune escape mechanisms that are due to abnormalities in protein-antigen processing and presentation. In certain embodiments of the invention there are CTLs that are modified to comprise a CAR that targets CD5. As used herein, chimeric antigen receptor or CAR indicates an artificial, recombinant polypeptide comprising at least an extracellular domain that binds to a particular antigen, e.g., a tumor-specific antigen or a tumor-associated antigen; a transmembrane domain, and a primary signaling domain, such as the endodomain from CD3. CARs preferably also comprise one or more co-stimulatory domains, as described elsewhere herein. The CAR, when expressed by an immune cell, e.g., a T lymphocyte, and when the antigen-binding domain binds to the targeted antigen, causes the CAR-expressing cell to kill a cell expressing the targeted antigen.
[0053] In particular cases, immune cells include a chimeric antigen receptor that is non-natural and engineered at least in part by the hand of man. In particular cases, the engineered CAR has one, two, three, four, or more components, and in some embodiments the one or more components facilitate targeting or binding of the T lymphocyte to the CD5-comprising cancer cell. In specific embodiments, the CAR comprises an antibody for CD5, part or all of a cytoplasmic signaling domain, and/or part or all of one or more co-stimulatory molecules, for example endodomains of co-stimulatory molecules. In specific embodiments, the antibody is a single-chain variable fragment (scFv).
[0054] In particular embodiments, the CD5-specific CAR comprises an extracellular domain that targets the CAR to CD5. In certain embodiments, the extracellular domain is, or comprises, an antibody that binds to CD5. In specific embodiments, the antibody is an scFv. The antibody, e.g., scFv, may be derived from any monoclonal antibody that binds to CD5, such as from one of the following: H65 (Santa Cruz Biotechnology; Santa Cruz, Calif.); clone CRIS1 or clone 4C7 (Abnova Corporation; Walnut, Calif.); OX-19 (Santa Cruz Biotechnology; Santa Cruz, Calif.); Leu-1 (Becton-Dickinson; Mountain View, Calif.) and UCHT2 (Accurate Scientific; Westbury, N.Y.); 53-7.3 (Affymetrix; Santa Clara, Calif.); 4H8E6 (Life Technologies; Grand Island, N.Y.); T101; EP2952 (Abcam, Cambridge Mass.); or L17F12. In other embodiments, the antibody, e.g., scFv, is or is derived from anti-CD5 antibodies D-9, H-3, HK231, N-20, Y2/178, H-300, L17F12, CD5/54/F6, Q-20, or CC17 (all available from Santa Cruz Biotechnology, Dallas Tex.). The antibody may also be one that is generated de novo against CD5, and the scFv sequence may be obtained, or derived, from such de novo antibodies.
[0055] Examples of specific anti-CD5 scFv include at least MOM-18539-S(P) and MOM-18885-S(P) (Creative Diagnostics; Suffolk County, N.Y.).
[0056] In certain embodiments, the anti-CD5 CAR comprises an extracellular domain that is or comprises a ligand for CD5. In specific embodiments, the anti-CD5 CAR comprises an extracellular domain that comprises CD72 (Lyb-2) and fragments and mimetics thereof. An example of a human CD72 nucleic acid is at GenBank? Accession No. NM_001782 and an example of a human CD72 protein is at NP 001773.
[0057] In certain embodiments, the CD5-specific CAR comprises a cytoplasmic signaling domain, such as one derived from the T cell receptor zeta-chain (CD3), e.g., to produce a primary T cell activation signal. Preferably the CD5-specific CAR additionally comprises one or more stimulatory domains that, e.g., produce stimulatory signals for T lymphocyte proliferation and effector function following engagement of the chimeric receptor with the target antigen. Examples of such costimulatory domains include, but are not limited to, costimulatory endodomains from co-stimulatory molecules such as CD2, CD28, CD27, CD137 (4-1BB), Inducible T-cell Costimulator (ICOS), OX40, CD30, HVEM, CD40, LFA-1 (CD11a/CD18), ICAM-1, and a combination of two or more thereof, and/or the signaling components of cytokine receptors such as IL7, IL15, or IL21. However, in specific embodiments, 4-1BB is not employed in the CAR, because 4-1BB signaling can enhance fratricide of CD5 CAR T cells (see, e.g.,
[0058] The CAR may be first generation (e.g., comprising a CD5-targeting extracellular domain, transmembrane domain, and CD3 only), second generation (e.g., comprising a CD5-targeting extracellular domain, transmembrane domain, CD3? and CD28 costimulatory endodomain), or third generation (CAR in which signaling is provided by CD3? together with co-stimulation provided by CD28 and, for example, a tumor necrosis factor receptor (TNFR), such as 4-1BB or OX40).
[0059] In particular cases the CAR is specific for CD5, and in certain embodiments, the present invention provides chimeric T cells specific for CD5 by joining an extracellular antigen-binding domain derived from a CD5-specific antibody to cytoplasmic signaling domains derived from the T-cell receptor ?-chain, optionally with the endodomains of the exemplary costimulatory molecules CD28 and OX40, for examples. In embodiments, the CAR is expressed in human cells, including human T cells, and the targeting of CD5-positive cancers is encompassed herein.
[0060] The CD5 CARs of the present disclosure may have a linker (which may also be referred to as a spacer) and/or a hinge. The hinge region is the connecting sequence between the ectodomain and the transmembrane domain, and in some embodiments the CD5 CAR utilizes a hinge, whereas in other embodiments the CD5 CAR does not utilize a hinge. In specific embodiments, the hinge is of a particular length, such as 10-20, 10-15, 11-20, 11-15, 12-20, 12-15, or 15-20 amino acids in length, for example. In specific embodiments, the hinge is a small flexible polypeptide that connects CH2-CH3 and CH1 domains of IgG Fc.
[0061] A spacer of any suitable length is utilized for the CD5 scFv to properly bind its ligand. In specific embodiments, the spacer facilitates CAR detection with spacer-specific antibodies, although in some cases of the present disclosure a linker is not used.
[0062] Any combination of linkers and hinges may be employed in the CD5 CAR. For example, one may utilize CH2-CH3 hinge (part or all) from various IgG subclasses (IgG1-4, either modified or not). However, in some cases the entire CH2-CH3 hinge is not utilized but instead a portion of the hinge is used (such as CH3 by itself or part of CH3 by itself). In particular embodiments, the CH2-CH3 hinge derived from IgG1 is utilized, and in some cases the entire CH2-CH3 hinge is used (all 229 amino acids), only the CH3 hinge (119 amino acids) is used, or a short hinge (12 amino acids) is used.
[0063] In specific cases, one can modify the identity or length of the spacer and/or hinge to optimize efficiency of the CAR. See, for example, Hudecek et al. (2014) and Jonnalagadda et al. (2015) In specific embodiments, the CD5 CAR utilizes IgG4 hinge+CH3 or utilizes CD8a stalk, for example.
[0064] Thus, in specific embodiments a spacer domain that is commonly used in CAR design comprises an IgG hinge region, typically IgG1 or IgG4, and the CH2-CH3 domain of IgG Fc. The use of the IgG Fc domain can provide flexibility to the CAR, has low immunogenicity, facilitates detection of CAR expression using anti-Fc reagents, and allows removal of one or more CH2 or CH3 modules to accommodate different spacer lengths. However, in one embodiment mutations in certain spacers to avoid Fc?R binding may improve CAR+ T cell engraftment and antitumor efficacy to avoid binding of soluble and cell surface Fc gamma receptors, for example, yet maintain the activity to mediate antigen-specific lysis. For example, one can employ IgG4-Fc spacers that have either been modified in the CH2 region. For example, the CH2 region may be mutated, including point mutations and/or deletions. Specific modifications have been demonstrated at two sites (L235E; N297Q) within the CH2 region and/or incorporate a CH2 deletion (Jonnalagadda et al, 2015). In specific embodiments, one may employ the IgG4 hinge-CH2-CH3 domain (229 aa in length) or only the hinge domain (12 aa in length) (Hudececk et al., 2015). In particular embodiments, the spacer region is 10-250 amino acids in length, although it may be 10-225, 10-200, 10-175, 10-150, 10-100, 10-50, 10-25, 12-250, 12-225, 12-200, 12-175, 12-150, 12-100, 12-50, 12-25, 25-250, 25-225, 25-200, 25-175, 25-150, 25-100, 25-50, 50-250, 50-225, 50-200, 50-175, 50-150, 50-100, 100-250, 100-225, 100-200, 100-175, 100-150, 100-125, 150-250, 150-225, 150-200, 150-175, 175-250, 175-225, 175-200, 200-250, or 225-250 amino acids in length, for example, any range therein between, and so forth.
[0065] Preferably the CD5-specific chimeric antigen receptors provided herein comprise a transmembrane (TM) domain. In certain embodiments, the transmembrane domain is, or is derived from, the TM domain of CD3 epsilon, CD4, CD5, CD8, CD9, CD16, CD22, CD28, CD33, CD37, CD45, CD64, CD80, CD86, CD134, CD137, or CD154.
[0066] In certain embodiments of a CD5 CAR expression construct, the expression construct comprises at least 1) the CD5 CAR; 2) full CH2-CH3 from IgG1, IgG2, IgG3, or IgG4 (or CH3 or stalk from CD8a); 3) transmembrane domain; and 4) CD28 (or one or more other costimulatory domains; and 5) CD3?. SEQ ID NO:13 (which consists of the amino acid sequences shown in SEQ ID NOS:14-17 below, in order) provides an example of a CD5 CAR, including CD5scFv plus leader; IgG1 spacer (CD2+CD3)+ hinge; CD28 TM+ cyto; and zeta as follows:
TABLE-US-00001 (SEQIDNO:14) MEFGLSWLFLVAILKGVQCIDAMGNIQLVQSGPELKKPGETVKISCKASG YTFTNYGMNWVKQAPGKGLRWMGWINTHTGEPTYADDFKGRFAFSLETSA STAYLQINNLKNEDTATYFCTRRGYDWYFDVWGAGTTVTVSSGGGGSGGG GSGGGGSDIKMTQSPSSMYASLGERVTITCKASQDINSYLSWFHHKPGKS PKTLIYRANRLVDGVPSRFSGSGSGQDYSLTISSLDYEDMGIYYCQQYDE SPWTFGGGTKLEMKGSGDPA(CD5scFv+ leader) (SEQIDNO:15) EPKSPDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLN GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSL TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKKDPK (IgG1spacer(CH2+ CH3)+ hinge) (SEQIDNO:16) FWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPT RKHYQPYAPPRDFAAYRS(CD28TM+ cyto) (SEQIDNO:17) RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPR RKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDT YDALHMQALPPR(zeta)
[0067] The immune cell comprising the CD5 CAR in the cell may additionally comprise one or more other CARs, such as those specific for B Cell Maturation Antigen (BCMA), CD19, CD20, CD22, Kappa or light chain, Glypican-3, CD30, CD33, CD123, CD38, ROR1, ErbB2, ErbB3/4, EGFR vIII, carcinoembryonic antigen, EGP2, EGP40, mesothelin, TAG72, PSMA, NKG2D ligands, B7-H6, IL-13 receptor ?2, IL-11 receptor R ?, MUC1, MUC16, CA9, GD2, GD3, HMW-MAA, CD171, Lewis Y, G250/CAIX, HLA-AI MAGE A1, HLA-A2 NY-ESO-1, PSC1, folate receptor-?. CD44v7/8, 8H9, NCAM, VEGF receptors, 5T4, Fetal AchR, NKG2D ligands, CD44v6, CD7, and other tumor-associated antigens or actionable mutations that are identified through genomic analysis and or differential expression studies of tumors, for example. In specific embodiments, the CAR utilizes two or more antigen recognizing domains, such as two or more scFvs. That is, in particular embodiments, the CAR of the present disclosure utilizes a CD5 scFv in tandem with another scFv (which may be referred to as a tandem CAR or TanCAR). In certain embodiments, in a configuration of a single CAR the CD5 scFv is utilized with another scFv (or embedded or fused with another receptor) to provide recognition of both CD5 and another antigen to which the other antibody or receptor binds.
III. Cells
[0068] Provided herein are cells e.g., immune cells that express a CD5-targeting chimeric antigen receptor.
[0069] As used herein, the terms cell, cell line, and cell culture may be used interchangeably. All of these terms also include their progeny, which is any and all subsequent generations. It is understood that all progeny may not be identical due to deliberate or inadvertent mutations. In the context of expressing a heterologous nucleic acid sequence, host cell refers to a eukaryotic cell that is capable of replicating a vector and/or expressing a heterologous gene encoded by a vector. A host cell can, and has been, used as a recipient for vectors. A host cell may be transfected or transformed, which refers to a process by which exogenous nucleic acid is transferred or introduced into the host cell. A transformed cell includes the primary subject cell and its progeny. As used herein, the terms engineered and recombinant cells or host cells are intended to refer to a cell into which an exogenous nucleic acid sequence, such as, for example, a vector, has been introduced. Therefore, recombinant cells are distinguishable from naturally occurring cells which do not contain a recombinantly introduced nucleic acid. In embodiments of the invention, a host cell is a T cell or T lymphocyte, including a cytotoxic T cell (also known as TC, Cytotoxic T Lymphocyte, CTL, T-Killer cell, cytolytic T cell, CD8+ T-cells, CD4+ T cells, or killer T cell); NK cells and NKT cells are also encompassed in the invention.
[0070] In certain embodiments, the cells, e.g., CD5-specific CAR T cells described herein, are provided in a form suitable for administration to a recipient, e.g., a human recipient, e.g., an individual having a CD5-expressing tumor. In a specific embodiment, the form suitable for administration to a recipient is a pharmaceutical composition.
[0071] In certain embodiments, the immune cells provided herein are transformed with a vector that expresses a nucleotide sequence encoding the CD5-specific CAR provided herein. The vector may be any vector that can (1) replicate in an immune cell and (2) express a protein within a T cell. in specific embodiments, the vector is a retroviral vector.
[0072] In specific embodiments, the vector comprises control sequences that allow it to be replicated and/or expressed in both prokaryotic and eukaryotic cells. One of skill in the art would further understand the conditions under which to incubate all of the above described host cells to maintain them and to permit replication of a vector. Also understood and known are techniques and conditions that would allow large-scale production of vectors, as well as production of the nucleic acids encoded by vectors and their cognate polypeptides, proteins, or peptides.
[0073] With respect to a potential recipient of the CD5-specific CAR T cells provided herein, the cells can be autologous, syngeneic, allogenic or xenogeneic cells.
[0074] In many situations one may wish to be able to kill the modified CTLs, where one wishes to terminate the treatment, the cells become neoplastic, in research where the absence of the cells after their presence is of interest, and/or another event. For this purpose, one can provide for the expression of certain gene products in which one can kill the modified cells under controlled conditions, such as inducible suicide genes, such as caspase 9.
[0075] In particular embodiments, the immune cells of the present disclosure are modified in one or more ways other than expressing a CD5 CAR. For example, the CD5 CAR may have additional modifications to its molecule, or the cells may have a second, third, fourth, or more modification other than the CD5 CAR. Any modification to the immune cells may manifest as one or more additional polynucleotides. For example, the polynucleotide that expresses the CD5 CAR may also express a suicide gene product, a cytokine, an additional CAR, a cytokine receptor, and/or a chimeric cytokine receptor. In specific embodiments, the CD5 CAR is a CAR that recognizes two different antigens by comprising two different scFvs that bind two separate antigens, one of which is CD5 scFv.
[0076] Alternative to, or in addition to, the immune cells harboring a polynucleotide that expresses the CD5 CAR and also expresses one or more modifications, the immune cells may harbor one or more separate polynucleotides that encode a suicide gene product, a cytokine, an additional CAR, a cytokine receptor, and/or a chimeric cytokine receptor.
[0077] In embodiments wherein a cytokine is expressed in the immune cells from a recombinant polynucleotide, the cytokine may any particular suitable one, but in specific embodiments the cytokine is one or more of IL-2, IL-7, IL-15, IL-21, IL-12, GM-CSF, G-CSFm and others. Cytokine receptors may be included in the cells, including receptors for IL-4, IL-10, TGF beta, and others.
[0078] Additional CAR molecules may be expressed on the cells, including, for example, CARs that target CD19, CD20, CD22, Kappa or light chain, Glypican-3, CD30, CD33, CD123, CD38, ROR1, ErbB2, ErbB3/4, EGFR vIII, carcinoembryonic antigen, EGP2, EGP40, mesothelin, TAG72, PSMA, NKG2D ligands, B7-H6, IL-13 receptor ?2, IL-11 receptor R ?, MUC1, MUC16, CA9, GD2, GD3, HMW-MAA, CD171, Lewis Y, G250/CAIX, HLA-AI MAGE A1, HLA-A2 NY-ESO-1, PSC1, folate receptor-?, CD44v7/8, 8H9, NCAM, VEGF receptors, 5T4, Fetal AchR, NKG2D ligands, CD44v6, CD7, or other tumor-associated antigens or actionable mutations that are identified through genomic analysis and or differential expression studies of tumors.
[0079] In some embodiments, the cells comprise one or more chimeric cytokine receptors that may or may not be expressed from the same molecule as the CD5 CAR. A chimeric cytokine receptor comprises an exodomain and an endodomain that are not naturally of the same molecule. In specific embodiments, the exodomain is from the exodomain of a receptor. The exodomain of the chimeric cytokine receptor binds a cytokine, in particular embodiments. The exodomain may be from a receptor or molecule that can bind to TGF?, IL10, IL4, IL13, IL6, IL8, IL5, VEGF,IL22, IL1,IL1?,IL35, TNF, GM-CSF,M-CSF, G-CSF, LAG3, or TIM3, for example. The exodomain may be from a chemokine receptor. For the endodomain component of the chimeric cytokine receptor, the endodomain may be a signal transducing endodomain. Examples of signal transducing domains include endodomains from TLR1,TLR2, TLR3, TLR4, TLR5, TLR6, TLR7, TLR8, TLR9, CD28, OX-40, 4-1BB, CD80, CD86, ICOS, CD40, CD27, CD30, CD226, IL7, IL2, IL15, IL21, IL12 and IFN-gamma. In some embodiments, the endodomain is an inhibitory endodomain, such as endodomains from PD-1, CTLA4, KIR2/KIR3, LIR, BTLA, or CEACAM, for example. Specific examples of chimeric cytokine receptors include IL4/7 receptor (Leen et al. Mol Ther 2014); TGFbeta/TLR4 receptor, and others.
IV. Illustrative Exemplifications and Therapeutic Uses of the Cells
[0080] Embodiments of the disclosure further encompass a process for the production of the CD5-specific immune cells, e.g., CD5-specific CAR T cells, provided herein, a method for the prevention, treatment or amelioration of cancer, and the use of the cells in the prevention, treatment or amelioration of cancer.
[0081] In various embodiments the expression constructs, nucleic acid sequences, vectors, host cells and/or pharmaceutical compositions comprising the same are used for the prevention, treatment or amelioration of a cancerous disease, such as a tumorous disease. In particular embodiments, the pharmaceutical composition of the present disclosure may be particularly useful in preventing, ameliorating and/or treating cancer, including cancer having solid tumors, for example.
[0082] As such, in one embodiment, provided herein is a method of treating an individual having a cancer, wherein cells of the cancer express CD5, comprising administering to the individual a therapeutically effective amount of immune cells that express a chimeric antigen receptor that targets CD5. In another embodiment, provided herein is the use of a therapeutically effective amount of immune cells that express a chimeric antigen receptor that targets CD5 for the treatment of an individual having a cancer, wherein the cells of the cancer express CD5. In another embodiment, provided herein is use of a therapeutically effective amount of immune cells that express a chimeric antigen receptor that targets CD5 for the manufacture of a medicament for treatment of an individual having a cancer, wherein the cells of the cancer express CD5. In specific embodiments, the immune cells are T-cells, CTLs, NK cells, or NKT cells. In certain specific embodiments, the immune cells are not T-cells, or are not NK cells.
[0083] In specific embodiments, the chimeric antigen receptor that targets CD5 is any of the chimeric antigen receptors described herein. In a more specific embodiment, the chimeric antigen receptor comprises a CD5 targeting moiety, a CD3? signaling domain, and a CD28 costimulatory domain. In another more specific embodiment, the chimeric antigen receptor comprises a CD5 targeting moiety, a CD3? signaling domain, and a CD137 (4-1BB) costimulatory domain. In another more specific embodiment, the chimeric antigen receptor comprises a CD5 targeting moiety, a CD3? signaling domain, a CD28 costimulatory domain and a CD137 (4-1BB) costimulatory domain. In another more specific embodiment, the chimeric antigen receptor comprises amino acid sequence of one or more of SEQ ID NO:14, SEQ ID NO:15, SEQ ID NO:16, and/or SEQ ID NO:17. In a more specific embodiment, the chimeric antigen receptor comprises the amino acid sequence of SEQ ID NO:13.
[0084] In certain embodiments, of the methods or uses herein, the cancer expresses CD5, e.g., an amount of CD5 detectable by, e.g., an ELISA assay or flow cytometry. In certain embodiments of the methods or uses herein, the cancer is a blood cancer. In a more specific embodiment, the blood cancer is a cancer of aberrant T cells, e.g., a T-cell leukemia or a T-cell lymphoma. In another more specific embodiment, the blood cancer is a cancer of aberrant B cells, e.g., a B-cell leukemia or a B-cell lymphoma. In more specific embodiments, the T-cell leukemia or T-cell lymphoma is T-lineage Acute Lymphoblastic Leukemia (T-ALL), Hodgkin's lymphoma, or a non-Hodgkin's lymphoma, acute lymphoblastic leukemia (ALL), chronic lymphocytic leukemia (CLL), large granular lymphocytic leukemia, adult T-cell leukemia/lymphoma (ATLL), T-cell prolymphocytic leukemia (T-PLL), T-cell chronic lymphocytic leukemia, knobby T-cell leukemia, T-prolymphocytic leukemia, T-cell lymphocytic leukemia, B-cell chronic lymphocytic leukemia, mantle cell lymphoma, peripheral T-cell lymphoma not otherwise specified (PTCL-NOS), anaplastic large-cell lymphoma (e.g., anaplastic lymphoma kinase (+) or anaplastic lymphoma kinase (?)), cutaneous T-cell lymphoma (e.g., mycosis fungoides), angioimmunoblastic lymphoma, cutaneous anaplastic large cell lymphoma, enteropathy-type T-cell lymphoma, hematosplenic gamma-delta T-cell lymphoma, lymphoblastic lymphoma, or hairy cell leukemia. In another more specific embodiment, the cancer is a treatment-related T-cell lymphoma, e.g., a T-cell lymphoma that arises after drug therapy, chemotherapy, or after bone marrow transplantation. In other specific embodiments, the blood cancer is acute lymphoblastic leukemia (B-ALL) or chronic lymphocytic leukemia (B-CLL). In other embodiments, the cancer is a solid tumor, wherein the cells of the solid tumor express CD5.
[0085] In various embodiments, the administration of the composition(s) of the disclosure is useful for the treatment of specific stages of cancer, including for indolent forms, acute forms, minimal residual disease, early solid tumor, advanced solid tumor and/or metastatic solid tumor.
[0086] As used herein treatment or treating, includes any beneficial or desirable effect on the symptoms or pathology of a disease or pathological condition, and may include even minimal reductions in one or more measurable markers of the disease or condition being treated, e.g., cancer. Treatment can involve optionally either the reduction or amelioration of symptoms of the disease or condition, or the delaying of the progression of the disease or condition. Treatment does not necessarily indicate complete eradication or cure of the disease or condition, or associated symptoms thereof.
[0087] As used herein, prevent, and similar words such as prevented, preventing etc., indicate an approach for preventing, inhibiting, or reducing the likelihood of the occurrence or recurrence of, a disease or condition, e.g., cancer. It also refers to delaying the onset or recurrence of a disease or condition or delaying the occurrence or recurrence of the symptoms of a disease or condition. As used herein, prevention and similar words also includes reducing the intensity, effect, symptoms and/or burden of a disease or condition prior to onset or recurrence of the disease or condition.
[0088] In particular embodiments, the present invention contemplates, in part, viruses, expression constructs, nucleic acid molecules and/or vectors that can administered either alone or in any combination with another therapy, and in at least some aspects, together with a pharmaceutically acceptable carrier or excipient. In certain embodiments, prior to administration of the viruses, they may be combined with suitable pharmaceutical carriers and excipients that are well known in the art. The compositions prepared according to the disclosure can be used for the prevention or treatment or delaying of onset or worsening of cancer.
[0089] Furthermore, the disclosure relates to a method for the prevention, treatment or amelioration of a cancerous (including tumorous) disease comprising the step of administering to a subject in need thereof an effective amount of immune cells of the disclosure, wherein the virus expresses a molecule comprising an activation domain that binds to a target on an immune cell and an antigen recognition domain that binds one or more molecules produced by or present on a target cell. The disclosure includes nucleic acid sequence that encodes a CD5-expressing CAR, vector(s) that encodes the CD5-expressing CAR, as contemplated herein and/or produced by a process as contemplated herein.
[0090] The disclosure further encompasses co-administration protocols with other cancer therapies, e.g. bispecific antibody constructs, targeted toxins or other compounds, including those which act via immune cells, including T-cell therapy. The clinical regimen for co-administration of the inventive composition(s) may encompass co-administration at the same time, before and/or after the administration of the other component. Particular combination therapies include chemotherapy, radiation, surgery, hormone therapy, and/or other types of immunotherapy.
[0091] In certain embodiments, provided herein is a kit comprising one or more oncolytic viruses as described herein, a nucleic acid sequence as described herein, a vector as described herein and/or a host as described herein. It is also contemplated that the kit of this disclosure comprises a pharmaceutical composition as described herein above, either alone or in combination with further medicaments to be administered to an individual in need of medical treatment or intervention. In particular embodiments, the kit comprises a set of instructions for use of the cells, viruses, vectors, nucleic acid sequences, and/or pharmaceutical compositions described herein.
[0092] In particular embodiments, nucleic acid introduction into the immune cells need not result in integration in every case. In some situations, transient maintenance of the nucleic acid introduced may be sufficient. In this way, one could have a short term effect, where cells could be introduced into the host and then turned on after a predetermined time, for example, after the cells have been able to home to a particular site.
[0093] The viruses may be introduced into a host organism, e.g., a mammal, in a wide variety of ways. The viruses may be introduced at the site of the tumor, in specific embodiments, although in alternative embodiments viruses hone to the cancer or are modified to hone to the cancer. The number of viruses that are employed will depend upon a number of circumstances, the purpose for the introduction, the lifetime of the cells, the protocol to be used, for example, the number of administrations, the stability of the viruses, and the like. The viruses may be applied in a dispersion, and may be injected at or near the site of interest. The viruses may be in a physiologically-acceptable medium.
[0094] By way of illustration, individuals with cancer or at risk for cancer (such as having one or more risk factors) or suspected of having cancer may be treated as follows. The immune cells modified as described herein may be administered to the individual and retained for extended periods of time. The individual may receive one or more administrations of the cells. In some embodiments, the genetically modified cells are encapsulated to inhibit immune recognition and placed at the site of the tumor.
[0095] Embodiments of the disclosure also include methods of suppressing the autoimmune system in an individual using cells bearing CD5 CARs, such as methods of treating autoimmune disease and methods of suppressing rejection of organs, cells, and/or tissue, including in graft-versus-host disease. The disclosure includes methods of preventing rejection of organs, cells, and/or tissue following their transplant or treating rejection upon its occurrence following their transplant.
[0096] Embodiments of the disclosure also include methods of suppressing the autoimmune system in an individual using cells bearing CD5 CARs, such as methods of treating autoimmune disease and methods of suppressing rejection of organs, cells, and/or tissue, including in graft-versus-host disease. The disclosure includes methods of preventing rejection of organs, cells, and/or tissue following their transplant or treating rejection upon its occurrence following their transplant.
V. Introduction of Constructs into CTLs
[0097] Expression vectors that encode the CD5 CARs can be introduced as a DNA molecule or construct. In certain embodiments, the DNA molecule or construct is, or is comprised within, a vector. In specific embodiments, the vector comprises at least one marker that allows for selection of host cells that contain the construct(s). The constructs can be prepared in conventional ways, where the genes and regulatory regions may be isolated, as appropriate, ligated, cloned in an appropriate cloning host, analyzed by restriction or sequencing, or other convenient means. Particularly, using PCR, individual fragments including all or portions of a functional unit may be isolated, where one or more mutations may be introduced using primer repair, ligation, in vitro mutagenesis, etc., as appropriate. The construct(s) once completed and demonstrated to have the appropriate sequences may then be introduced into the CTL by any convenient means. The constructs may be integrated and packaged into non-replicating, defective viral genomes like Adenovirus, Adeno-associated virus (AAV), or Herpes simplex virus (HSV) or others, including retroviral vectors or lentiviral vectors, for infection or transduction into cells, e.g., T cells. The constructs may include viral sequences for transfection, if desired. Alternatively, the construct may be introduced by fusion, electroporation, transfection, lipofection, or the like. The host cells may be grown and expanded in culture before introduction of the construct(s), followed by the appropriate treatment for introduction of the construct(s) and integration of the construct(s). The cells are then expanded and screened by virtue of a marker present in the construct. Various markers that may be used successfully include hprt, neomycin resistance, thymidine kinase, hygromycin resistance, etc. A detailed discussion of vectors suitable for use in the methods provided herein is presented in Section VII, below.
[0098] In some instances, one may have a target site for homologous recombination, where it is desired that a construct be integrated at a particular locus. For example,) can knock-out an endogenous gene and replace it (at the same locus or elsewhere) with the gene encoded for by the construct using materials and methods as are known in the art for homologous recombination. For homologous recombination, one may use either OMEGA or O-vectors. See, for example, Thomas and Capecchi, Cell (1987) 51, 503-512; Mansour, et al., Nature (1988) 336, 348-352; and Joyner, et al., Nature (1989) 338, 153-156.
[0099] Vectors containing useful elements such as bacterial or yeast origins of replication, selectable and/or amplifiable markers, promoter/enhancer elements for expression in prokaryotes or eukaryotes, etc. that may be used to prepare stocks of construct DNAs and for carrying out transfections are well known in the art, and many are commercially available.
VI. Administration of Cells
[0100] In certain embodiments, the immune cells that have been modified with the CD5 CAR and optionally other construct(s) are then grown in culture under selective conditions and cells that are selected as having the construct may then be expanded and further analyzed, using, for example, the polymerase chain reaction for determining the presence of the construct in the host cells. Once the modified host cells have been identified, they may then be used as planned, e.g. expanded in culture or introduced into a host organism.
[0101] Depending upon the nature of the cells, the cells may be introduced into a host organism, e.g. a mammal, e.g., human, e.g., human individual having a CD5-expressing cancer, in a wide variety of ways. The cells may be introduced at the site of the tumor, in specific embodiments, although in alternative embodiments the cells home to the cancer or are modified to home to the cancer. The number of cells that are employed will depend upon a number of circumstances, the purpose for the introduction, the lifetime of the cells, the protocol to be used, for example, the number of administrations, the ability of the cells to multiply, the stability of the recombinant construct, and the like. The cells may be applied as a dispersion, generally being injected at or near the site of interest. The cells may be in a physiologically-acceptable medium.
[0102] In specific embodiments of the methods of treatment or uses disclosed herein, the therapeutically effective dose or dosage of the immune cells provided herein, which express a CD5-specific chimeric antigen receptor, can comprise about 10.sup.5/m.sup.2, 10.sup.6/m.sup.2, 10.sup.7/m.sup.2, 10.sup.8/m.sup.2, 10.sup.9/m.sup.2, or 10.sup.10/m.sup.2 are employed in methods of the disclosure. In certain embodiments, the number of cells provided to an individual in need thereof is from 10.sup.6/m.sup.2 to 10.sup.10/m.sup.2; 10.sup.7/m.sup.2 to 10.sup.10/m.sup.2; 10.sup.8/m.sup.2 to 10.sup.10/m.sup.2; 10.sup.9/m.sup.2 to 10.sup.10/m.sup.2; 10.sup.6/m.sup.2 to 10.sup.9/m.sup.2; 10.sup.7/m.sup.2 to 10.sup.9/m.sup.2; 10.sup.8/m.sup.2 to 10.sup.9/m.sup.2; 10.sup.7/m.sup.2 to 10.sup.10/m.sup.2; 10.sup.7/m.sup.2 to 10.sup.9/m.sup.2; 10.sup.7/m.sup.2 to 10.sup.8/m.sup.2; 10.sup.8/m.sup.2 to 10.sup.9/m.sup.2; or 10.sup.9/m.sup.2 to 10.sup.10/m.sup.2.
[0103] In other specific embodiments, the therapeutically effective dose or dosage of the immune cells provided herein, which express a CD5-specific chimeric antigen receptor, can comprise about 1?10.sup.5/kg, 5?10.sup.5/kg, 1?10.sup.6/kg, 5?10.sup.6/kg, 1?10.sup.7/kg, 5?10.sup.7/kg, 1?10.sup.8/kg, 5?10.sup.8/kg, 1?10.sup.9/kg, 5?10.sup.9/kg, 1?10.sup.10/kg, or 5?10.sup.10/kg. In certain embodiments, the number of cells provided to an individual in need thereof is from 10.sup.5/kg to 106/kg; 10.sup.6/kg to 10.sup.7/kg, 10.sup.7/kg to 10.sup.8/kg, 10.sup.6/kg to 10.sup.10/kg; 10.sup.7/kg to 10.sup.10/kg; 10.sup.8/kg to 10.sup.10/kg; 10.sup.9/kg to 10.sup.10/kg; 10.sup.6/kg to 10.sup.9/kg; 10.sup.7/kg to 10.sup.9/kg; 10.sup.8/kg to 10.sup.9/kg; 10.sup.7/kg to 10.sup.10/kg; 10.sup.7/kg to 10.sup.9/kg; 10.sup.7/kg to 10.sup.8/kg; 10.sup.8/kg to 10.sup.9/kg; or 10.sup.9/kg to 10.sup.10/kg.
[0104] An effective dose of the immune cells provided herein can vary according to the needs of a particular individual and of the cancer that that individual has. Therefore, it is expected that for each individual patient, even if there were cells that could be administered to the population at large, each patient would be monitored for the proper dosage for the individual, and such practices of monitoring a patient are routine in the art. Indicia of successful treatment could be, e.g., detectable reduction in the growth of a tumor (e.g., as seen by MRI or the like), or reduction in one or more symptoms of a cancer or other medical condition that expresses CD5.
[0105] In specific embodiments, the tumor load of an individual receiving therapy of the disclosure is monitored. In particular cases, tumor load is monitored in peripheral blood by flow cytometric analysis of T cell blasts (CD5 and other markers, depending on their phenotype) and in the bone marrow aspirates (percent blasts). In specific embodiments, CT/MRI scans are utilized. In particular embodiments, CD5-specific CAR T cells are provided to the individual more than once and, in some embodiments, the cells are re-administered upon ascertaining a tumor load of the individual.
[0106] In particular cases, an individual is provided with therapeutic immune cells modified to comprise a CAR specific for CD5 in addition to other types of therapeutic cells, such as other immune cells. The cells may be delivered at the same time or at different times. The cells may be delivered in the same or separate formulations. The cells may be provided to the individual in separate delivery routes. The cells (either the CD5-specific CAR T cells or the other type of therapeutic cells, or both) may be delivered by injection at a tumor site or intravenously or intraarterially, subcutaneously, intraperitoneally, intrathecally, intramuscularly, intracranially, or directly into an affected organ, or orally, for example. Routine delivery routes for such compositions are known in the art.
VII. Nucleic Acid-Based Expression Systems
[0107] A polynucleotide encoding the CD5 CAR and, optionally, another gene, such as a cytokine and/or suicide gene, may comprise an expression vector.
[0108] A. Vectors
[0109] The term vector is used to refer to a carrier nucleic acid molecule into which a nucleic acid sequence can be inserted for introduction into a cell where it can be replicated. A nucleic acid sequence can be exogenous, which means that it is foreign to the cell into which the vector is being introduced or that the sequence is homologous to a sequence in the cell but in a position within the host cell nucleic acid in which the sequence is ordinarily not found. Vectors include plasmids, cosmids, viruses (bacteriophage, animal viruses, and plant viruses), and artificial chromosomes (e.g., yeast artificial chromosomes, or YACs). One of skill in the art would be well equipped to construct a vector through standard recombinant techniques (see, for example, Maniatis et al., 1988 and Ausubel et al., 1994, both incorporated herein by reference).
[0110] The term expression vector refers to any type of genetic construct comprising a nucleic acid coding for a RNA capable of being transcribed. In some cases, RNA molecules are then translated into a protein, polypeptide, or peptide. In other cases, these sequences are not translated, for example, in the production of antisense molecules or ribozymes. Expression vectors can contain a variety of control sequences, which refer to nucleic acid sequences necessary for the transcription and possibly translation of an operably linked coding sequence in a particular host cell. In addition to control sequences that govern transcription and translation, vectors and expression vectors may contain nucleic acid sequences that serve other functions as well and are described infra.
[0111] B. Promoters and Enhancers
[0112] A promoter is a control sequence that is a region of a nucleic acid sequence at which initiation and rate of transcription are controlled. It may contain genetic elements at which regulatory proteins and molecules may bind, such as RNA polymerase and other transcription factors, to initiate the specific transcription a nucleic acid sequence. The phrases operatively positioned, operatively linked, under control, and under transcriptional control mean that a promoter is in a correct functional location and/or orientation in relation to a nucleic acid sequence to control transcriptional initiation and/or expression of that sequence.
[0113] A promoter generally comprises a sequence that functions to position the start site for RNA synthesis. The best known example of this is the TATA box, but in some promoters lacking a TATA box, such as, for example, the promoter for the mammalian terminal deoxynucleotidyl transferase gene and the promoter for the SV40 late genes, a discrete element overlying the start site itself helps to fix the place of initiation. Additional promoter elements regulate the frequency of transcriptional initiation. Typically, these are located in the region 30 110 bp upstream of the start site, although a number of promoters have been shown to contain functional elements downstream of the start site as well. To bring a coding sequence under the control of a promoter, one positions the 5 end of the transcription initiation site of the transcriptional reading frame downstream of (i.e., 3 of) the chosen promoter. The upstream promoter stimulates transcription of the DNA and promotes expression of the encoded RNA.
[0114] The spacing between promoter elements frequently is flexible, so that promoter function is preserved when elements are inverted or moved relative to one another. In the tk promoter, the spacing between promoter elements can be increased to 50 bp apart before activity begins to decline. Depending on the promoter, it appears that individual elements can function either cooperatively or independently to activate transcription. A promoter may or may not be used in conjunction with an enhancer, which refers to a cis-acting regulatory sequence involved in the transcriptional activation of a nucleic acid sequence.
[0115] A promoter may be one naturally associated with a nucleic acid sequence, as may be obtained by isolating the 5 non-coding sequences located upstream of the coding segment and/or exon. Such a promoter can be referred to as endogenous. Similarly, an enhancer may be one naturally associated with a nucleic acid sequence, located either downstream or upstream of that sequence. Alternatively, certain advantages will be gained by positioning the coding nucleic acid segment under the control of a recombinant or heterologous promoter, which refers to a promoter that is not normally associated with a nucleic acid sequence in its natural environment. A recombinant or heterologous enhancer refers also to an enhancer not normally associated with a nucleic acid sequence in its natural environment. Such promoters or enhancers may include promoters or enhancers of other genes, and promoters or enhancers isolated from any other virus, or prokaryotic or eukaryotic cell, and promoters or enhancers not naturally occurring, i.e., containing different elements of different transcriptional regulatory regions, and/or mutations that alter expression. For example, promoters that are most commonly used in recombinant DNA construction include the beta-lactamase (penicillinase), lactose and tryptophan (trp) promoter systems. In addition to producing nucleic acid sequences of promoters and enhancers synthetically, sequences may be produced using recombinant cloning and/or nucleic acid amplification technology, including PCR, in connection with the compositions disclosed herein (see U.S. Pat. Nos. 4,683,202 and 5,928,906, each incorporated herein by reference). Furthermore, it is contemplated the control sequences that direct transcription and/or expression of sequences within non-nuclear organelles such as mitochondria, chloroplasts, and the like, can be employed as well.
[0116] Naturally, it will be important to employ a promoter and/or enhancer that effectively directs the expression of the DNA segment in the organelle, cell type, tissue, organ, or organism chosen for expression. Those of skill in the art of molecular biology generally know the use of promoters, enhancers, and cell type combinations for protein expression, (see, for example Sambrook et al. 1989, incorporated herein by reference). The promoters employed may be constitutive, tissue-specific, inducible, and/or useful under the appropriate conditions to direct high level expression of the introduced DNA segment, such as is advantageous in the large-scale production of recombinant proteins and/or peptides. The promoter may be heterologous or endogenous.
[0117] Additionally any promoter/enhancer combination could also be used to drive expression. Use of a T3, T7 or SP6 cytoplasmic expression system is another possible embodiment. Eukaryotic cells can support cytoplasmic transcription from certain bacterial promoters if the appropriate bacterial polymerase is provided, either as part of the delivery complex or as an additional genetic expression construct.
[0118] The identity of tissue-specific promoters or elements, as well as assays to characterize their activity, is well known to those of skill in the art.
[0119] A specific initiation signal also may be required for efficient translation of coding sequences. These signals include the ATG initiation codon or adjacent sequences. Exogenous translational control signals, including the ATG initiation codon, may need to be provided. One of ordinary skill in the art would readily be capable of determining this and providing the necessary signals.
[0120] In certain embodiments of the invention, the use of internal ribosome entry sites (IRES) elements are used to create multigene, or polycistronic, messages, and these may be used in the invention.
[0121] Vectors can include a multiple cloning site (MCS), which is a nucleic acid region that contains multiple restriction enzyme sites, any of which can be used in conjunction with standard recombinant technology to digest the vector. Restriction enzyme digestion refers to catalytic cleavage of a nucleic acid molecule with an enzyme that functions only at specific locations in a nucleic acid molecule. Many of these restriction enzymes are commercially available. Use of such enzymes is widely understood by those of skill in the art. Frequently, a vector is linearized or fragmented using a restriction enzyme that cuts within the MCS to enable exogenous sequences to be ligated to the vector. Ligation refers to the process of forming phosphodiester bonds between two nucleic acid fragments, which may or may not be contiguous with each other. Techniques involving restriction enzymes and ligation reactions are well known to those of skill in the art of recombinant technology.
[0122] Splicing sites, termination signals, origins of replication, and selectable markers may also be employed.
[0123] C. Plasmid Vectors
[0124] In certain embodiments, a plasmid vector is contemplated for use to transform a host cell. In general, plasmid vectors containing replicon and control sequences which are derived from species compatible with the host cell are used in connection with these hosts. The vector ordinarily carries a replication site, as well as marking sequences which are capable of providing phenotypic selection in transformed cells. In a non-limiting example, E. coli is often transformed using derivatives of pBR322, a plasmid derived from an E. coli species. pBR322 contains genes for ampicillin and tetracycline resistance and thus provides easy means for identifying transformed cells. The pBR plasmid, or other microbial plasmid or phage must also contain, or be modified to contain, for example, promoters which can be used by the microbial organism for expression of its own proteins.
[0125] In addition, phage vectors containing replicon and control sequences that are compatible with the host microorganism can be used as transforming vectors in connection with these hosts. For example, the phage lambda GEMTM 11 may be utilized in making a recombinant phage vector which can be used to transform host cells, such as, for example, E. coli LE392.
[0126] Further useful plasmid vectors include pIN vectors (Inouye et al., 1985); and pGEX vectors, for use in generating glutathione S transferase (GST) soluble fusion proteins for later purification and separation or cleavage. Other suitable fusion proteins are those with ? galactosidase, ubiquitin, and the like.
[0127] Bacterial host cells, for example, E. coli, comprising the expression vector, are grown in any of a number of suitable media, for example, LB. The expression of the recombinant protein in certain vectors may be induced, as would be understood by those of skill in the art, by contacting a host cell with an agent specific for certain promoters, e.g., by adding IPTG to the media or by switching incubation to a higher temperature. After culturing the bacteria for a further period, generally of between 2 and 24 h, the cells are collected by centrifugation and washed to remove residual media.
[0128] D. Viral Vectors
[0129] The ability of certain viruses to infect cells or enter cells via receptor mediated endocytosis, and to integrate into host cell genome and express viral genes stably and efficiently have made them attractive candidates for the transfer of foreign nucleic acids into cells (e.g., mammalian cells). Components of the present invention may be a viral vector that encodes one or more CARs of the invention. Non-limiting examples of virus vectors that may be used to deliver a nucleic acid of the present invention are described below.
[0130] E. Adenoviral Vectors
[0131] A particular method for delivery of the nucleic acid involves the use of an adenovirus expression vector. Although adenovirus vectors are known to have a low capacity for integration into genomic DNA, this feature is counterbalanced by the high efficiency of gene transfer afforded by these vectors. Adenovirus expression vector is meant to include those constructs containing adenovirus sequences sufficient to (a) support packaging of the construct and (b) to ultimately express a tissue or cell specific construct that has been cloned therein. Knowledge of the genetic organization or adenovirus, a 36 kb, linear, double stranded DNA virus, allows substitution of large pieces of adenoviral DNA with foreign sequences up to 7 kb (Grunhaus and Horwitz, 1992).
[0132] F. AAV Vectors
[0133] The nucleic acid may be introduced into the cell using adenovirus assisted transfection. Increased transfection efficiencies have been reported in cell systems using adenovirus coupled systems (Kelleher and Vos, 1994; Cotten et al., 1992; Curiel, 1994). Adeno associated virus (AAV) is an attractive vector system for use in the cells of the present invention as it has a high frequency of integration and it can infect nondividing cells, thus making it useful for delivery of genes into mammalian cells, for example, in tissue culture (Muzyczka, 1992) or in vivo. AAV has a broad host range for infectivity (Tratschin et al., 1984; Laughlin et al., 1986; Lebkowski et al., 1988; McLaughlin et al., 1988). Details concerning the generation and use of rAAV vectors are described in U.S. Pat. Nos. 5,139,941 and 4,797,368, each incorporated herein by reference.
[0134] G. Retroviral Vectors
[0135] Retroviruses are useful as delivery vectors because of their ability to integrate their genes into the host genome, transferring a large amount of foreign genetic material, infecting a broad spectrum of species and cell types and of being packaged in special cell lines (Miller, 1992).
[0136] In order to construct a retroviral vector, a nucleic acid (e.g., one encoding the desired sequence) is inserted into the viral genome in the place of certain viral sequences to produce a virus that is replication defective. In order to produce virions, a packaging cell line containing the gag, pol, and env genes but without the LTR and packaging components is constructed (Mann et al., 1983). When a recombinant plasmid containing a cDNA, together with the retroviral LTR and packaging sequences is introduced into a special cell line (e.g., by calcium phosphate precipitation for example), the packaging sequence allows the RNA transcript of the recombinant plasmid to be packaged into viral particles, which are then secreted into the culture media (Nicolas and Rubenstein, 1988; Temin, 1986; Mann et al., 1983). The media containing the recombinant retroviruses is then collected, optionally concentrated, and used for gene transfer. Retroviral vectors are able to infect a broad variety of cell types. However, integration and stable expression require the division of host cells (Paskind et al., 1975).
[0137] Lentiviruses are complex retroviruses, which, in addition to the common retroviral genes gag, pol, and env, contain other genes with regulatory or structural function. Lentiviral vectors are well known in the art (see, for example, Naldini et al., 1996; Zufferey et al., 1997; Blomer et al., 1997; U.S. Pat. Nos. 6,013,516 and 5,994,136). Some examples of lentivirus include the Human Immunodeficiency Viruses: HIV-1, HIV-2 and the Simian Immunodeficiency Virus: SIV. Lentiviral vectors have been generated by multiply attenuating the HIV virulence genes, for example, the genes env, vif, vpr, vpu and nef are deleted making the vector biologically safe.
[0138] Recombinant lentiviral vectors are capable of infecting non-dividing cells and can be used for both in vivo and ex vivo gene transfer and expression of nucleic acid sequences. For example, recombinant lentivirus capable of infecting a non-dividing cell wherein a suitable host cell is transfected with two or more vectors carrying the packaging functions, namely gag, pol and env, as well as rev and tat is described in U.S. Pat. No. 5,994,136, incorporated herein by reference. One may target the recombinant virus by linkage of the envelope protein with an antibody or a particular ligand for targeting to a receptor of a particular cell-type. By inserting a sequence (including a regulatory region) of interest into the viral vector, along with another gene which encodes the ligand for a receptor on a specific target cell, for example, the vector is now target-specific.
[0139] H. Other Viral Vectors
[0140] Other viral vectors may be employed as vaccine constructs in the present invention. Vectors derived from viruses such as vaccinia virus (Ridgeway, 1988; Baichwal and Sugden, 1986; Coupar et al., 1988), sindbis virus, cytomegalovirus and herpes simplex virus may be employed. They offer several attractive features for various mammalian cells (Friedmann, 1989; Ridgeway, 1988; Baichwal and Sugden, 1986; Coupar et al., 1988; Horwich et al., 1990).
[0141] I. Delivery Using Modified Viruses
[0142] A nucleic acid to be delivered may be housed within an infective virus that has been engineered to express a specific binding ligand. The virus particle will thus bind specifically to the cognate receptors of the target cell and deliver the contents to the cell. A novel approach designed to allow specific targeting of retrovirus vectors was developed based on the chemical modification of a retrovirus by the chemical addition of lactose residues to the viral envelope. This modification can permit the specific infection of hepatocytes via sialoglycoprotein receptors.
[0143] Another approach to targeting of recombinant retroviruses was designed in which biotinylated antibodies against a retroviral envelope protein and against a specific cell receptor were used. The antibodies were coupled via the biotin components by using streptavidin (Roux et al., 1989). Using antibodies against major histocompatibility complex class I and class II antigens, they demonstrated the infection of a variety of human cells that bore those surface antigens with an ecotropic virus in vitro (Roux et al., 1989).
[0144] J. Vector Delivery and Cell Transformation
[0145] Suitable methods for nucleic acid delivery for transfection or transformation of cells are known to one of ordinary skill in the art. Such methods include, but are not limited to, direct delivery of DNA such as by ex vivo transfection, by injection, and so forth. Through the application of techniques known in the art, cells may be stably or transiently transformed.
[0146] K. Ex Vivo Transformation
[0147] Methods for transfecting eukaryotic cells and tissues removed from an organism in an ex vivo setting are known to those of skill in the art. Thus, it is contemplated that cells or tissues may be removed and transfected ex vivo using nucleic acids of the present invention. In particular aspects, the transplanted cells or tissues may be placed into an organism. In certain facets, a nucleic acid is expressed in the transplanted cells.
VIII. Kits
[0148] Any of the CD5-CAR compositions described herein may be comprised in a kit. In a non-limiting example, one or more cells for use in cell therapy and/or the reagents to generate one or more cells for use in cell therapy that harbors recombinant expression vectors may be comprised in a kit. Polynucletoides that encodes the CD5-CAR or portions thereof may be included in the kit. The kit components are provided in suitable container means.
[0149] Some components of the kits may be packaged either in aqueous media or in lyophilized form. The container means of the kits will generally include at least one vial, test tube, flask, bottle, syringe or other container means, into which a component may be placed, and preferably, suitably aliquoted. Where there are more than one component in the kit, the kit also will generally contain a second, third or other additional container into which the additional components may be separately placed. However, various combinations of components may be comprised in a vial. The kits of the present invention also will typically include a means for containing the components in close confinement for commercial sale. Such containers may include injection or blow molded plastic containers into which the desired vials are retained.
[0150] When the components of the kit are provided in one and/or more liquid solutions, the liquid solution is an aqueous solution, with a sterile aqueous solution being particularly useful. In some cases, the container means may itself be a syringe, pipette, and/or other such like apparatus, from which the formulation may be applied to an infected area of the body, injected into an animal, and/or even applied to and/or mixed with the other components of the kit.
[0151] However, the components of the kit may be provided as dried powder(s). When reagents and/or components are provided as a dry powder, the powder can be reconstituted by the addition of a suitable solvent. It is envisioned that the solvent may also be provided in another container means. The kits may also comprise a second container means for containing a sterile, pharmaceutically acceptable buffer and/or other diluent.
[0152] In particular embodiments of the invention, cells that are to be used for cell therapy are provided in a kit, and in some cases the cells are essentially the sole component of the kit. The kit may comprise reagents and materials to make the desired cell. In specific embodiments, the reagents and materials include primers for amplifying desired sequences, nucleotides, suitable buffers or buffer reagents, salt, and so forth, and in some cases the reagents include vectors and/or DNA that encodes a CAR as described herein and/or regulatory elements therefor.
[0153] In particular embodiments, there are one or more apparatuses in the kit suitable for extracting one or more samples from an individual. The apparatus may be a syringe, scalpel, and so forth.
[0154] In some cases of the invention, the kit, in addition to cell therapy embodiments, also includes a second cancer therapy, such as chemotherapy, hormone therapy, and/or immunotherapy, for example. The kit(s) may be tailored to a particular cancer for an individual and comprise respective second cancer therapies for the individual.
IX. Combination Therapy
[0155] In certain embodiments of the invention, methods of the present invention for clinical aspects are combined with other agents effective in the treatment of hyperproliferative disease, such as anti-cancer agents. An anti-cancer agent is capable of negatively affecting cancer in a subject, for example, by killing cancer cells, inducing apoptosis in cancer cells, reducing the growth rate of cancer cells, reducing the incidence or number of metastases, reducing tumor size, inhibiting tumor growth, reducing the blood supply to a tumor or cancer cells, promoting an immune response against cancer cells or a tumor, preventing or inhibiting the progression of cancer, or increasing the lifespan of a subject with cancer. More generally, these other compositions would be provided in a combined amount effective to kill or inhibit proliferation of the cell. This process may involve contacting the cancer cells with the expression construct and the agent(s) or multiple factor(s) at the same time. This may be achieved by contacting the cell with a single composition or pharmacological formulation that includes both agents, or by contacting the cell with two distinct compositions or formulations, at the same time, wherein one composition includes the expression construct and the other includes the second agent(s).
[0156] Cancer cell resistance to chemotherapy and radiotherapy agents, for example, represents a major problem in clinical oncology. One goal of current cancer research is to find ways to improve the efficacy of chemo- and radiotherapy by combining it with another therapy In the context of the present invention, it is contemplated that the cell therapy could be used similarly in conjunction with chemotherapeutic, radiotherapeutic, or immunotherapeutic intervention. In specific embodiments, the therapy of the present disclosure is given in conjunction with vincristine, prednisone, cyclophosphamide, doxorubicin, L-asparaginase, cytarabine, methotrexate, 6-mercaptopurine, steroids, mitoxantrone. imatinib, dasatinib, ponatinib, Rituximab, Campath, Lenalidomide, Nelarabine, or a combination thereof, for example. In specific embodiments, checkpoint inhibitors are utilized. In certain embodiments, antibodies against or small molecule antagonists of PD-1, PD-L1, and/or CTLA4 may be utilized.
[0157] The present inventive therapy may precede or follow the other agent treatment by intervals ranging from minutes to weeks. In embodiments where the other agent and present invention are applied separately to the individual, one would generally ensure that a significant period of time did not expire between the time of each delivery, such that the agent and inventive therapy would still be able to exert an advantageously combined effect on the cell. In such instances, it is contemplated that one may contact the cell with both modalities within about 12-24 h of each other and, more preferably, within about 6-12 h of each other. In some situations, it may be desirable to extend the time period for treatment significantly, however, where several d (2, 3, 4, 5, 6 or 7) to several wk (1, 2, 3, 4, 5, 6, 7 or 8) lapse between the respective administrations.
[0158] Various combinations may be employed, present invention is A and the secondary agent, such as radio- or chemotherapy, is B:
[0159] A/B/A B/A/B B/B/A A/A/B A/B/B B/A/A A/B/B/B B/A/B/B
[0160] B/B/B/A B/B/A/B A/A/B/B A/B/A/B A/B/B/A B/B/A/A
[0161] B/A/B/A B/A/A/B A/A/A/B B/A/A/A A/B/A/A A/A/B/A
[0162] It is expected that the treatment cycles would be repeated as necessary. It also is contemplated that various standard therapies, as well as surgical intervention, may be applied in combination with the inventive cell therapy.
[0163] A. Chemotherapy
[0164] Cancer therapies also include a variety of combination therapies with both chemical and radiation based treatments. Combination chemotherapies include, for example, vincristine, prednisone, cyclophosphamide, doxorubicin, L-asparaginase, cytarabine, methotrexate, 6-mercaptopurine, steroids, mitoxantrone. imatinib, dasatinib, ponatinib, or a combination thereof, or any analog or derivative variant of the foregoing and also combinations thereof.
[0165] In specific embodiments, chemotherapy for the individual is employed in conjunction with the invention, for example before, during and/or after administration of the invention.
[0166] B. Radiotherapy
[0167] Other factors that cause DNA damage and have been used extensively include what are commonly known as ?-rays, X-rays, and/or the directed delivery of radioisotopes to tumor cells. Other forms of DNA damaging factors are also contemplated such as microwaves and UV-irradiation. It is most likely that all of these factors effect a broad range of damage on DNA, on the precursors of DNA, on the replication and repair of DNA, and on the assembly and maintenance of chromosomes. Dosage ranges for X-rays range from daily doses of 50 to 200 roentgens for prolonged periods of time (3 to 4 wk), to single doses of 2000 to 6000 roentgens. Dosage ranges for radioisotopes vary widely, and depend on the half-life of the isotope, the strength and type of radiation emitted, and the uptake by the neoplastic cells.
[0168] The terms contacted and exposed, when applied to a cell, are used herein to describe the process by which a therapeutic construct and a chemotherapeutic or radiotherapeutic agent are delivered to a target cell or are placed in direct juxtaposition with the target cell. To achieve cell killing or stasis, both agents are delivered to a cell in a combined amount effective to kill the cell or prevent it from dividing.
[0169] C. Immunotherapy
[0170] Immunotherapeutics generally rely on the use of immune effector cells and molecules to target and destroy cancer cells. In specific embodiments the immunotherapy is a different immunotherapy than that of the present disclosure. The additional immunotherapy may or may not target CD5, as with the present disclosure. The immune effector may be, for example, an antibody specific for some marker on the surface of a tumor cell. The antibody alone may serve as an effector of therapy or it may recruit other cells to actually effect cell killing. The antibody also may be conjugated to a drug or toxin (chemotherapeutic, radionuclide, ricin A chain, cholera toxin, pertussis toxin, etc.) and serve merely as a targeting agent. Alternatively, the effector may be a lymphocyte carrying a surface molecule that interacts, either directly or indirectly, with a tumor cell target. Various effector cells include cytotoxic T cells and NK cells.
[0171] Immunotherapy other than the inventive therapy described herein could thus be used as part of a combined therapy, in conjunction with the present cell therapy. The general approach for combined therapy is discussed below. Generally, the tumor cell must bear some marker that is amenable to targeting, i.e., is not present on the majority of other cells. Many tumor markers exist and any of these may be suitable for targeting in the context of the present invention.
[0172] In specific embodiments, the immunotherapy for use with the methods of the present disclosure is Rituximab.
[0173] D. Genes
[0174] In yet another embodiment, the secondary treatment is a gene therapy in which a therapeutic polynucleotide is administered before, after, or at the same time as the present invention clinical embodiments. A variety of expression products are encompassed within the invention, including inducers of cellular proliferation, inhibitors of cellular proliferation, or regulators of programmed cell death.
[0175] E. Surgery
[0176] In some embodiments, the cancer is a solid tumor and requires surgery. Approximately 60% of persons with cancer will undergo surgery of some type, which includes preventative, diagnostic or staging, curative and palliative surgery. Curative surgery is a cancer treatment that may be used in conjunction with other therapies, such as the treatment of the present invention, chemotherapy, radiotherapy, hormonal therapy, gene therapy, immunotherapy and/or alternative therapies.
[0177] Curative surgery includes resection in which all or part of cancerous tissue is physically removed, excised, and/or destroyed. Tumor resection refers to physical removal of at least part of a tumor. In addition to tumor resection, treatment by surgery includes laser surgery, cryosurgery, electrosurgery, and miscopically controlled surgery (Mohs' surgery). It is further contemplated that the present invention may be used in conjunction with removal of superficial cancers, precancers, or incidental amounts of normal tissue.
[0178] Upon excision of part of all of cancerous cells, tissue, or tumor, a cavity may be formed in the body. Treatment with embodiments of the disclosure may be accomplished by perfusion, direct injection or local application of the area with an additional anti-cancer therapy, such as during and/or following the excision. Such treatment may be repeated, for example, every 1, 2, 3, 4, 5, 6, or 7 days, or every 1, 2, 3, 4, and 5 weeks or every 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 months. These treatments may be of varying dosages as well.
[0179] F. Other Agents
[0180] It is contemplated that other agents may be used in combination with the present invention to improve the therapeutic efficacy of treatment. These additional agents include immunomodulatory agents, agents that affect the upregulation of cell surface receptors and GAP junctions, cytostatic and differentiation agents, inhibitors of cell adhesion, or agents that increase the sensitivity of the hyperproliferative cells to apoptotic inducers. Immunomodulatory agents include tumor necrosis factor; interferon alpha, beta, and gamma; IL-2 and other cytokines; F42K and other cytokine analogs; or MIP-1, MIP-lbeta, MCP-1, RANTES, and other chemokines, for example. It is further contemplated that the upregulation of cell surface receptors or their ligands such as Fas/Fas ligand, DR4 or DR5/TRAIL would potentiate the apoptotic inducing abililties of the present invention by establishment of an autocrine or paracrine effect on hyperproliferative cells. Increases intercellular signaling by elevating the number of GAP junctions would increase the anti-hyperproliferative effects on the neighboring hyperproliferative cell population. In other embodiments, cytostatic or differentiation agents can be used in combination with the present invention to improve the anti-hyerproliferative efficacy of the treatments. Inhibitors of cell adhesion are contemplated to improve the efficacy of the present invention. Examples of cell adhesion inhibitors are focal adhesion kinase (FAKs) inhibitors and Lovastatin. It is further contemplated that other agents that increase the sensitivity of a hyperproliferative cell to apoptosis, such as the antibody c225, could be used in combination with the present invention to improve the treatment efficacy.
Example 1
CD5 CAR for T-Cell Malignancies
[0181] Chimeric antigen receptors (CARs) have emerged as a powerful therapeutic tool redirecting patient's own T cells to treat hematologic malignanciesin particular, those of B cell origin. However, T cell malignancies remain a more challenging task for CAR T cells owing to the shared expression of targetable tumor-associated antigens, e.g., CD5, between normal and cancerous T cells, potentially invoking fratricide of CAR T cells.
[0182] The present disclosure provides a novel CAR targeting CD5, a common marker expressed in most T-cell leukemia/lymphoma blasts and normal T cells. As described below, upon transduction with a CD5 CAR, T cells displayed limited and transient fratricide and eventually acquired resistance to self-killing. Expansion of CD5 CAR T cells coincided with downregulation of CD5 from the cell surface. At the same time, CD5 CAR T cells efficiently recognized and completely eliminated CD5-positive T-ALL and T cell lymphoma cell lines in vitro. Moreover, CD5 CAR T cells dramatically suppressed systemic in vivo disease progression in xenograft mouse models. Importantly, CD5 CAR T cells demonstrated significant cytotoxicity against primary T-ALL cells, showcasing the therapeutic utility of CD5 CAR for patients with T-cell malignancies. As described herein for the first time, CD5 CAR can redirect normal T cells to eliminate CD5-positive malignant T-cells while producing only limited fratricide.
Example 2
A T Cell-Directed Chimeric Antigen Receptor for the Selective Treatment of T Cell Malignancies
[0183] Lymphoid malignancies produce significant morbidity and mortality in pediatric and adult patients (Dores, et al., 2012). Although recent advances in chemotherapy have improved disease-free survival, prognosis remains poor for primary chemotherapy-refractory or relapsed patients, and all patients may have significant short-term and long-term toxicities from their treatment (Kantarjian, et al., 2010; G?kbuget, et al., 2012; DeAngelo, et al., 2007; Goldberg, et al., 2003; Oudot, et al., 2008; O'Brien, et al., 2008). Recent studies in patients with B lymphoid malignancies have demonstrated the remarkable potency of chimeric antigen receptors (CARs) that can redirect T cells to the CD19 antigen present on normal and malignant B cells with complete response rates of >90% even in patients with refractory or relapsed disease (Brentjens, et al., 2013; Maude, et al., 2014). Such response rates, however, are accompanied by elimination of the normal B cell population. The concern that loss of normal T lymphocytes would produce a more profound immunodeficiency than loss of B cells has impeded parallel approaches that would treat T-cell malignancies by targeting an antigen consistently expressed by both normal and malignant T cells. Moreover, any CAR-T cell that targeted a tumor antigen shared between normal and malignant T cells might lead to fratricide of CAR T cells, thus jeopardizing their therapeutic efficacy.
[0184] CD5 is one of the characteristic surface markers of malignant T cells, present in ?80% of T cell acute lymphoblastic leukemia (T-ALL) and T cell lymphomas (Campana, et al., 1991; Pui, et al., 1993). In addition, CD5 is often expressed in B-CLL and mantle cell lymphoma. Expression of CD5 by normal cells is restricted to components of the immune system: thymocytes, peripheral T cells and a minor subpopulation of B lymphocytes (B-1 cells) (Berland & Wortis, 2002; Jones, et al., 1986). CD5 is a negative regulator of TCR signaling (Brossard, et al., 2003; Perez-Villar, et al., 1999; Bamberger, et al., 2011) implicated in promoting survival of normal and malignant human lymphocytes (Gary-Gouy, et al., 2007; Friedlein, et al., 2007; Gary-Gouy, et al., 2002; Ryan, et al., 2005), and was validated as a tumor target antigen in earlier clinical trials using immunotoxin-conjugated CD5 antibodies (Bertram, et al., 1986; LeMaistre, et al., 1991; Kernan, et al., 1984). These clinical trials demonstrated efficient depletion of malignant T cells in patients with cutaneous T cell lymphoma and T-ALL.
[0185] CD5 CAR-Transduced T Cells Expand and Downregulate CD5 from Cell Surface.
[0186] A CD5 CAR was designed comprising anti-CD5 scFv (derived from clone H65 (Kernan et al., 1984)), an IgG Fc spacer and intracellular signaling domains from CD28 and TCR zeta chain (
[0187] Expression of CD5 CAR in T cells was stable for >25 days post-transduction (
[0188] CD5 CAR T Cells Demonstrate Limited and Transient Fratricide.
[0189] To assess the extent of fratricide among CD5 CAR T cells against autologous T cells, expansion was compared of autologous GFP.sup.+ activated T cells co-cultured with CD5 CAR- or control CAR-transduced T cells for 7 days. There was a transient decline in the number of autologous GFP.sup.+ T cells after 24 h of co-culture with CD5 CAR T cells followed by sustained expansion (
[0190] Following expansion, CD5 CAR T cells were enriched for effector and effector memory cells (CD45RA.sup.?CD62L.sup.low) compared with T cells transduced with a control CAR (
[0191] It was determined if selective fratricide by CD5 CAR T cells would eliminate virus-specific T cells (VSTs) and thus potentially compromise anti-viral immunity. Autologous GFP.sup.+ T cells were co-cultured with CD5 CAR T cells for 72 h, then purified GFP.sup.+ T cells by cell sorting, and IFN? ELISpot was used to analyze the frequency of T cells reactive to a pool of peptide antigens derived from Cytomegalovirus, Epstein-Barr Virus and Adenoviruses. There was no significant change in the frequency of tri-virus-specific autologous T cells after co-culture with CD5 CAR T cells compared with control CAR (
[0192] CD5 CAR T Cells Effectively Recognize and Eliminate Malignant T Cell Lines In Vitro.
[0193] The capacity of CD5 CAR T cells to eradicate CD5.sup.+ T-ALL and T lymphoma cell lines was evaluated. Compared to control CD19 CAR T cells, CD5 CAR T cells demonstrated significant cytotoxicity against 5 different T cell lines: Jurkat, CCRF-CEM, MOLT4, Hut78 and SupT1 (
[0194] To assess the ability of CD5 CAR T cells to suppress tumor cell line growth in longer co-culture, CAR T cells were co-cultured with GFP-expressing Jurkat, CCRF or MOLT4 cells and the survival of the target cells at multiple time points was analyzed. CD5 CAR T cells effectively eliminated >95% of target cells after 48 h (
[0195] The effectiveness of cytotoxic T cell therapy likely requires the effector cells to sequentially kill multiple target cells. Therefore, the capacity was tested of CD5 CAR T cells to eliminate tumor cells in a sequential killing assay, in which fresh Jurkat cells were added to CD5 CAR T cells every 3 days to restore an effector-to-target ratio of 1:2. CD5 CAR T cells could eradicate freshly replenished Jurkat cells for at least 4 iterations (
[0196] Mechanisms of Differential Killing of Normal and Malignant T Cells.
[0197] Enhanced cytotoxicity against leukemic cells might result from increased or more stable CD5 expression on the cell surface of malignant T cells. However, surface expression of CD5 was comparable in all leukemic cell lines and activated T cells (
[0198] T-cell cytotoxicity is primarily mediated by two separate mechanisms: perforin/granzyme secretion and Fas/FasL-mediated apoptosis. It was determined which pathways contribute to the cytotoxicity of CD5 CAR T cells against normal and malignant target cells. CD5 CAR T cells were co-cultured with autologous T cells or Jurkat cells in the presence of brefeldin A (BFA) and anti-FasL antibodies (cooperatively blocking the FasL pathway), or concanamycin A (CMA) and EGTA (inhibiting the perforin pathway), or all four agents. Apoptosis of target cells was measured by Annexin V staining to determine residual cytotoxic effector activity. Blocking the FasL pathway did not significantly change the extent of cytotoxicity against autologous T cells, but perforin inhibition with CMA/EGTA reduced fratricide by 63%, (
[0199] Effector T cells employ several mechanisms to protect themselves against autolysis by perform and granzymes, including overexpression of the serine protease inhibitor PI-9, a specific inhibitor of granzyme B (Sun, et al., 1996), and cathepsin B that provides resistance to perform (Balaji, et al., 2002). Both PI-9 (
[0200] Fas-mediated apoptosis is triggered by caspase 8-mediated cleavage of the pro-apoptotic protein bid and is inhibited by bcl-2 (Luo, et al., 1998). While both normal and malignant T cell lines expressed Fas on the cell surface (
[0201] CD5 CAR T Cells Recognize and Kill Primary T-ALL Cells.
[0202] The ability of CD5 CAR T cells to respond to and kill primary tumor cells from T-ALL patients was evaluated. There was discernible cytokine production and degranulation by CD5 CAR T cells in response to primary T-ALL blasts from several patients (
[0203] To assess cytotoxicity of CD5 CAR T cells against primary tumor cells, peripheral blood mononuclear cells of a T-ALL patient were purified and used as targets in a 5 hr Cr release assay with normal donor T cells transduced with either CD5 CAR or a mock retrovirus. There was substantial cytotoxicity with CD5 CAR T cells and minimal alloreactive killing from mock-transduced T cells (
[0204] Efficient Control of T-ALL Progression by CD5 CAR T Cells In Vivo.
[0205] The ability of CAR T cells to suppress or eliminate malignant cells in vivo in xenograft mouse models may be an important predictor of their therapeutic efficacy in patients. A xenograft mouse model of disseminated T-ALL was established by intravenously engrafting NOD.SCID ?-chain deficient mice with firefly luciferase-expres sing Jurkat cells and the capacity of CD5 CAR T cells (injected on day 3 and day 6 after tumor implantation) to control disease progression was evaluated by recording in vivo luminescence. Upon intravenous injection, Jurkat cells establish disseminated leukemia expanding preferentially in the spine, femur, head and pelvis (Christoph, et al., 2013), with limited numbers of cells in peripheral blood. Mice receiving control CD19 CAR T cells developed rapid disease progression and were euthanized by day 30 (
[0206] The capacity of CD5 CAR T cells to control established tumor was evaluated by injecting CAR T cells on day 6 and 9 post implantation. By day 6, the overall tumor burden in control and CD5 CAR groups was similar. In the group receiving CD5 CAR T cell injection, however, the disease was significantly reduced by day 12 (
[0207] A second xenograft mouse model was established of an aggressive T-ALL by engrafting CCRF-CEM cells intravenously to produce a predominantly leukemic distribution of tumor with cells also detected in lymphoid organs. The ability of CD5 CAR T cells administered on day 3 and day 6 post-engraftment to suppress leukemia progression was tested. While the control mice succumbed to the disease by day 22, injection of CD5 CAR T cells significantly reduced tumor burden and disease progression (
X. Materials and Methods
[0208] CD5 CAR Design. Anti-CD5 single chain variable fragment (scFv) was created using commercial gene synthesis and cloned into a backbone of a 2.sup.nd generation CAR (anti-kappa chain) containing an IgG Fc spacer, transmembrane and cytoplasmic portions of CD28 and a TCR zeta chain (Vera, et al., 2006). VL and VH parts of the scFv were connected with a (G.sub.4S).sub.3 linker. For the in vivo studies, the C.sub.H2 portion of the IgG Fc spacer was removed. A truncated version of CD5 CAR (?CD5 CAR) was created by deleting cytoplasmic domains.
[0209] Retroviral Transduction and Expansion of T Cells.
[0210] Peripheral blood mononuclear cells were isolated from healthy volunteers with a Ficoll-Paque and stimulated with anti-CD3 (OKT3, Ortho Biotech) and anti-CD28 (BD Pharmingen) antibodies for 48 h in CTL media (45% RPMI-1640, 45% Click's media, 10% FBS, supplemented with L-glutamin, penicillin and streptomycin). After that, T cells were transferred to a retronectin-coated plate with pre-bound retrovirus and transduced twice on day 2 and day 3. T cells were then transferred to another plate and expanded in the presence of IL-7 (10 ng/ml) and IL-15 (5 ng/ml). CD19 CAR (Savoldo, et al., 2011) and ?CD5 CAR were used as controls. Efficiency of transduction routinely exceeded 90%. For some experiments, activated T cells were transduced with a GFP+ retrovirus in parallel to obtain GFP+ autologous T cells.
[0211] In Vitro T Cell Assays.
[0212] Cell lines Jurkat (clone E6-1, ATCC #TIB-152), CCRF-CEM (ATCC #CCL-119), MOLT-4 (ATCC #CRL-1582), Hut 78 (ATCC #TIB-161), SupT1 (ATCC #CRL-1942), Raji (ATCC #CCL-86) and Daudi (ATCC #CCL-213) were purchased from ATCC and expanded according to ATCC recommendations. For some experiments, Jurkat, CCRF-CEM and MOLT-4 cells were transduced with a GFP-FFluc-expressing retrovirus and purified by cell sorting. For long co-culture experiments, GFP+ Jurkat and CCRF-CEM cells were purified by single-cell sorting.
[0213] Cytotoxicity of CD5 CAR T cells was assessed via standard Cr release assays or long co-culture experiments with GFP+ target cells. In the co-culture experiments CAR T cells and target cells were plated in 96-well flat bottom plates at 1:4 or 1:2 effector-to-target ratios (target cell number was constant at 50,000) in CTL media. After 3 days of co-culture, cells were transferred to a 24-well plate with fresh media to accommodate cell expansion. Number of viable target cells was calculated with flow cytometry using CountBright counting beads (Life Technologies) and 7-AAD staining. No exogenous cytokines were added.
[0214] Sequential Killing Assay.
[0215] CD5 CAR T cells were plated with GFP+ Jurkat cells in 96-well flat bottom plates at a 1:2 effector-to-target ratio (25,000 CAR T and 50,000 Jurkat cells per well in 200 ul of CTL media without cytokines). Seventy-two hours later, cells were collected and counted with flow cytometry using CountBright counting beads and 7-AAD. CD5 CAR T cells were then replated (25,000 per well) and reconstituted with fresh Jurkat-GFP cells (50,000 per well). Cell counting and replating was repeated after 72 hours with total of 4 iterations. No exogenous cytokines were added to the culture.
[0216] Inhibition of Perforin- and FasL-Mediated Cytotoxicity.
[0217] CD5 CAR T cells were preincubated for 2 h at 37? C. in the presence of 50 nM concanamycin A (CMA) or 10 ul/ml brefeldin A (BFA), or both in 100 ul of complete CTL media per well in a 96 well flat bottom plate. Thirty minutes before the end of preincubation, anti-FasL antibody (Nok-1, LEAF purified, Biolegend) was added to a final concentration of 40 ug/ml to BFA-pretreated CAR T cells. EGTA/MgCl2 was added to CMA-pretreated cells to a final concentration of 2 mM before adding target cells (GFP+ autologous T cells, Jurkat or CCRF) at an E:T ratio 1:2. Cytotoxicity was assessed by Annexin V staining (BD Biosciences) of GFP+ target cells 2 h later and normalized to the media control. Toxicity of all inhibitors was assessed by Annexin V staining of CAR T cells and did not exceed background levels of apoptosis.
[0218] Flow Cytometry.
[0219] Anti-human CD45RA, CD45, CD62L, CD4, CD8, CD3, CD5 (clones UCHT-2 and L17F12), IFN? and TNF? antibodies were purchased from BD Biosciences and Beckman Coulter. Anti-human CD107a was purchased from eBioscience. Intracellular cytokine staining was performed using BD Perm III buffer according to manufacturer's instructions. Protein expression of PI-9 and Bcl-2 was performed with anti-human PI-9 (ABD Serotec) and anti-Bcl-2 (BD Biosciences) antibodies using fixation and permeabilization with 100% ice cold methanol. Flow cytometric data was acquired with BC Gallios and BD LSRII cytometers and analyzed using FlowJo ver. 9 (Tree Star).
[0220] ELISpot Assay.
[0221] ELIspot analysis was used to quantitate the frequency of T cells that secreted IFN-? in response to AdV, EBV and CMV antigens. As a positive control, ATCs were stimulated with Staphylococcal enterotoxin B (1 ?g/mL; Sigma-Aldrich). Hexon and penton (Adv), IE1 and pp65 (CMV), and EBNA1, LMP1, LMP2 (EBV) pepmixes, diluted to 1 ?g/mL, were used as a stimulus. Responder T cells were resuspended at 0.5-1?10.sup.6/mL. Ninety-six well filtration plates (MultiScreen, #MAHAS4510, Millipore) were coated with 10 ?g/mL anti-IFN-? antibody (Catcher-mAB91-DIK, Mabtech) overnight at 4? C., then washed and blocked with CTL medium for 1 hour at 37? C. Cells were incubated for 20 hours, and the plates were washed and incubated with the secondary biotin conjugated anti-IFN-? monoclonal antibody (Detector-mAB, 7-B6-1-Biotin; Mabtech) followed by incubation with avidin-biotinylated horseradish peroxidase complex (Vectastain Elite ABC Kit, Standard, #PK6100; Vector Laboratories) and developed with AEC substrate (Sigma-Aldrich). Plates were sent for evaluation to Zellnet Consulting. Data are plotted as spot-forming cells (SFC) versus input cell numbers.
[0222] Primary T-ALL.
[0223] De-identified frozen peripheral blood samples from T-ALL patients were thawed, rested in RPMI-1640 media supplemented with 20% FBS for 2 h and used for analysis. Low viability of cells upon thawing precluded cytotoxicity assays in all samples except #394, which was freshly processed. The protocol for collection of peripheral blood T-ALL patients was approved by the Institutional Review Board (IRB) at Baylor College of Medicine.
[0224] Mouse Xenograft Models.
[0225] Five- to seven-week-old female NOD.Cg-Prkdc.sup.scidIl2rg.sup.tm1Wjl/SzJ (NSG) mice (The Jackson Laboratory) were inoculated intravenously with either 3?10.sup.6 Jurkat or 1?10.sup.6 CCRF-CEM cells engineered to express FFluc-GFP fusion protein. Three and six days later, mice received 10?10.sup.6 T cells transduced with either control (CD19) or CD5 CAR intravenously. Tumor burden was monitored by recording luminescence after injecting D-Luciferin (150 ug/kg intraperitoneally) with an IVIS Imaging system (Caliper Life Sciences). Living Image ver. 2.6 was used to visualize and calculate total luminescence. In some experiments, CAR T cells were injected on day 6 and 9 after inoculating Jurkat cells. Mice were euthanized after developing hind limb paralysis. Peripheral blood was collected by tail vein bleeding. All procedures were done in compliance with the Institutional Animal Care and Usage Committee of Baylor College of Medicine.
[0226] qPCR.
[0227] Total RNA was extracted using RNEasy Mini Plus kit (QIAgen) and cDNA was synthesized with Superscript III First-Strand Synthesis System (Invitrogen). Quantitative PCR was performed with SYBR Green Universal Mastermix (Bio-rad) using iQ5 Thermal Cycler (Bio-Rad). The following primers were used: CD5 (set 1) forward, 5-CTCACCCGTTCCAACTCGAAG-3 (SEQ ID NO: 1) and reverse, 5-TGGCAGACTTTTGACGCTTGA-3 (SEQ ID NO: 2); (set 2) forward, 5-TGACCTGCTTAGAACCCCAGA-3 (SEQ ID NO: 3) and reverse, 5-GCTGCCGCTGTAGAACTCC-3 (SEQ ID NO: 4); Bcl-2 forward, 5-GGTGGGGTCATGTGTGTGG-3 (SEQ ID NO: 5) and reverse, 5-CGGTTCAGGTACTCAGTCATCC-3 (SEQ ID NO: 6); Bid forward, 5-ATGGACCGTAGCATCCCTCC-3 (SEQ ID NO: 7) and reverse, 5-GTAGGTGCGTAGGTTCTGGT-3 (SEQ ID NO: 8); Cathepsin B forward, 5-ACAACGTGGACATGAGCTACT-3 (SEQ ID NO: 9) and reverse, 5-TCGGTAAACATAACTCTCTGGGG-3 (SEQ ID NO: 10); GAPDH forward, 5-GCACCGTCAAGGCTGAGAAC-3 (SEQ ID NO: 11) and reverse, 5-ATGGTGGTGAAGACGCCAGT-3 (SEQ ID NO: 12).
[0228] Statistical Analysis.
[0229] Unpaired 2-tailed Student's t-test was used to determine statistical significance, with P values indicated in the text and figures. Statistical analysis of the Kaplan-Meier survival curves was done using log rank (Mantel-Cox) test. Data are presented as mean?SD unless noted otherwise. All P values were calculated with Prism 6 (GraphPad).
Example 3
Modifications of CD5 Chimeric Antigen Receptors
[0230] In particular embodiments, a CD5 CAR has modifications to one or more components of the polynucleotide encoding the CAR and/or the immune cell harboring the polynucleotide. In certain embodiments, a particular anti-CD5 scFv is utilized, including those that are not specifically listed elsewhere herein. For the intracellular signaling domains, any suitable combination may be employed, and the skilled artisan knows how to test the efficacy and safety of the combinations based on routine practices described elsewhere herein.
[0231] One CAR component that may be varied depending on the particular CD5 CAR is the spacer and/or hinge region. A spacer region links the antigen binding domain to the transmembrane domain. In specific embodiments the spacer is flexible enough to allow the antigen binding domain to orient in different directions to facilitate antigen recognition. In certain embodiments, the hinge region is from IgG1. In specific embodiments, the CH2CH3 region of immunoglobulin and portions of CD3 are utilized. The IgG4 hinge and CH3 only may be employed, in certain aspects, and in some cases the CD8a stalk is utilized.
[0232]
[0233]
[0234]
[0235]
[0236]
[0237]
[0238] CD5 CARs having CH3 hinge, including experimental design (above) and images of experimental mice. CD5 CAR T cells with either full (CH2CH3) or truncated (CH3) IgG spacer were injected to mice previously engrafted with Jurkat-FFluc cells as outlined above on day 3 and day 6 post tumor engraftment. Tumor burden in mice is shown on day 9 and day 16 demonstrating superior tumor control by T cells transduced with CD5 CAR harboring CH3 spacer.
[0239]
[0240]
[0241]
[0242]