Targeting GIV-GEF-GI Signaling for Treating Diverse Diseases
20180104307 ยท 2018-04-19
Inventors
Cpc classification
C07K2319/81
CHEMISTRY; METALLURGY
C07K2319/33
CHEMISTRY; METALLURGY
C12N15/63
CHEMISTRY; METALLURGY
C07K14/4705
CHEMISTRY; METALLURGY
C07K19/00
CHEMISTRY; METALLURGY
C07K2319/10
CHEMISTRY; METALLURGY
C07K2319/74
CHEMISTRY; METALLURGY
International classification
C07K19/00
CHEMISTRY; METALLURGY
C12N15/63
CHEMISTRY; METALLURGY
Abstract
The invention provides cell-permeable Ga-Interacting Vesicle associated protein (GIV)-derived peptides and their use for treatment of diverse diseases. The invention further provides C-terminus of Ga-Interacting Vesicle associated protein (GIV-CT)-based peptides and GIV-CT encoding vectors and methods of use thereof, for successfully manipulating the diverse pathophysiologic processes in which GIV has been implicated. In one aspect, the invention provides cell-permeable peptides PTD-GIV-CT comprising (i) a peptide transduction domain (PTD) and (ii) a C-terminus of Ga-Interacting Vesicle associated protein (GIV-CT) or a mutant thereof. In one embodiment, said peptides are capable of activating Gi ownstream of receptor tyrosine kinases (RTKs). The invention also provides pharmaceutical compositions comprising one or more of the peptides of the invention as well as vectors encoding such peptides.
Claims
1. A cell-permeable peptide PTD-GIV-CT comprising (i) a peptide transduction domain (PTD) and (ii) a C-terminus of G-Interacting Vesicle associated protein (GIV-CT) or a mutant thereof, wherein said peptide is capable of activating Gi downstream of receptor tyrosine kinases (RTKs).
2. (canceled)
3. The peptide of claim 1, wherein said peptide is capable of activating Gi by enhancing nucleotide release via its GEF motif and interact with ligand-activated RTKs via its SH2-like motif.
4. The peptide of claim 1, wherein said peptide is capable of selectively affecting the activation of Gi1/2/3, but not Gao.
5. The peptide of claim 1, wherein said peptide is capable of inhibiting Gi downstream of receptor tyrosine kinases (RTKs).
6. The peptide of claim 1, wherein the PTD comprises TAT PTD sequence YGRKKRRQRRR (SEQ ID NO: 4).
7. The peptide of claim 1, wherein the PTD comprises the sequence selected from the group consisting of YARKARRQARR (SEQ ID NO: 5), YARAAARQARA (SEQ ID NO: 6), YARAARRAARR (SEQ ID NO: 7), YARAARRAARA (SEQ ID NO: 8), YARRRRRRRRR (SEQ ID NO: 9), and YAAARRRRRRR (SEQ ID NO: 10).
8. The peptide of claim 1, wherein the PTD is connected to the GIV-CT via a linker sequence.
9. (canceled)
10. The peptide of claim 8, wherein the linker sequence comprises the sequence GGSGHSG (SEQ ID NO: 11).
11. The peptide of claim 1, wherein said peptide further comprises a detection tag sequence.
12. The peptide of claim 11, wherein the detection tag sequence is hemagglutinin (HA) tag.
13. The peptide of claim 1, wherein said peptide further comprises a purification tag sequence.
14. The peptide of claim 13, wherein the purification tag sequence is hexa-histidine (His6) tag.
15. The peptide of claim 1, wherein GIV-CT comprises the sequence corresponding to amino acids 1660-1870 of human GIV protein.
16.-17. (canceled)
18. The peptide of claim 1, wherein GIV-CT comprises the sequence corresponding to amino acids 1660-1870 of human GIV protein, wherein Ser-1675 is replaced by Asp (S1675D).
19. (canceled)
20. The peptide of claim 1, wherein GIV-CT comprises the sequence corresponding to amino acids 1660-1870 of human GIV protein, wherein Ser-1689 is replaced by Ala (S1689A).
21. (canceled)
22. The peptide of claim 1, wherein GIV-CT comprises the sequence corresponding to amino acids 1660-1870 of human GIV protein, wherein Phe-1685 is replaced by Ala (F1685A).
23.-24. (canceled)
25. The peptide of claim 1, wherein GIV-CT comprises the sequence corresponding to amino acids 1660-1870 of human GIV protein, wherein Ser-1689 is replaced by Asp (S1689D).
26. (canceled)
27. The peptide of claim 1, wherein GIV-CT comprises the sequence corresponding to amino acids 1660-1870 of human GIV protein, wherein Ser-1675 is replaced by Ala (S1675A).
28. (canceled)
29. The peptide of claim 1, wherein GIV-CT comprises the sequence corresponding to amino acids 1660-1870 of human GIV protein, wherein Tyr-1764 and Tyr-1798 are replaced by Phe (Y1764F, Y1798F).
30. (canceled)
31. A pharmaceutical composition comprising the peptide of claim 1.
32. A vector encoding the peptide of claim 1.
33.-48. (canceled)
49. A method for modulating a GIV-dependent cellular signaling pathway in a cell, comprising administering to the cell an effective amount of the peptide of claim 1.
50. The method of claim 49, wherein said GIV-dependent cellular signaling pathway is PTK-Gi pathway for G protein activation.
51. The method of claim 49, wherein the cell is in a subject.
52. A method for enhancing wound healing in a subject in need thereof, comprising administering to said subject an effective amount of the peptide of claim 1.
53. The method of claim 52, wherein said peptide is administered topically to the wound.
54. The method of claim 52, wherein the peptide enhances epithelial cell migration into the wound and/or myofibroblast activation and/or collagen production in the wound.
55. (canceled)
56. A method for treating insulin resistance (IR) in a subject in need thereof, comprising administering to the subject an effective amount of the peptide of claim 1.
57.-59. (canceled)
60. A method for enhancing metabolic insulin signaling in a subject comprising administering to the subject an effective amount of the peptide of claim 1, wherein the subject is suffering from a disease selected from the group consisting of obesity, glucose intolerance, hypertension, dyslipidemia, endothelial dysfunction, atherosclerotic CVD, hyperinsulinemia, type II diabetes, metabolic syndrome, and polycystic ovarian syndrome (PCOS).
61. (canceled)
62. A method for inhibiting tumor metastasis in a subject in need thereof, comprising administering to the subject an effective amount of the peptide of claim 1.
63.-65. (canceled)
66. A method for treating a tissue fibrotic disease in a subject in need thereof comprising administering to the subject an effective amount of the peptide of claim 1.
67. (canceled)
68. The method of claim 66, wherein the fibrotic disease is selected from the group consisting of liver cirrhosis, liver fibrosis, non-alcoholic fatty liver disease (NAFLD), non-alcoholic steatohepatitis (NASH), alcoholic fatty liver disease, alcoholic steatohepatitis, hepatic steatosis, skeletal muscle fibrosis, skin fibrosis, scleroderma, skin fibrosis secondary to burns, keloids, hypertrophic post-surgical wounds, renal fibrosis, glomerulosclerosis, interstitial-tubular fibrosis, esophageal or gastro-intestinal fibrosis, bone marrow fibrosis, myelodysplastic syndrome, pulmonary fibrosis, peritoneal fibrosis, pancreatic fibrosis, post-radiation fibrosis, cardiac fibrosis and remodeling after myocardial infarction, brain fibrosis secondary to ischemia or infarcts, post-traumatic brain fibrosis, post-traumatic muscle fibrosis, and synovial/joint fibrosis.
69.-71. (canceled)
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
[0058]
[0059]
[0060]
[0061]
[0062]
[0063]
DETAILED DESCRIPTION OF THE INVENTION
Definitions
[0064] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which the invention pertains. Other specifically defined terms are to be construed in a manner consistent with the definition provided herein. Although any methods and materials similar or equivalent to those described herein can be used in the practice for testing of the present invention, the preferred materials and methods are described herein. In describing and claiming the present invention, the following terminology will be used.
[0065] As used in this specification and the appended claims, the singular forms a, an and the include plural referents unless the content clearly dictates otherwise. Thus, for example, reference to a construct includes a combination of two or more nucleic acid constructs, and the like.
[0066] As used herein, the term subject refers to humans, mammals and/or veterinary animals (e.g., cats, dogs, cows, horses, sheep, pigs, etc.), and experimental animal models. In certain embodiments, the subject refers to a human patient, including both genders in adult and child populations.
[0067] In the context of the present invention insofar as it relates to any of the disease conditions recited herein, the terms treat, treatment, and the like mean to relieve or alleviate at least one symptom associated with such condition, or to slow or reverse the progression of such condition. Within the meaning of the present invention, the term treat also denotes to arrest, delay the onset (i.e., the period prior to clinical manifestation of a disease) and/or reduce the risk of developing or worsening a disease. The terms treat, treatment, and the like regarding a state, disorder or condition may also include (1) preventing or delaying the appearance of at least one clinical or sub-clinical symptom of the state, disorder or condition developing in a subject that may be afflicted with or predisposed to the state, disorder or condition but does not yet experience or display clinical or subclinical symptoms of the state, disorder or condition; or (2) inhibiting the state, disorder or condition, i.e., arresting, reducing or delaying the development of the disease or a relapse thereof (in case of maintenance treatment) or at least one clinical or sub-clinical symptom thereof; or (3) relieving the disease, i.e., causing regression of the state, disorder or condition or at least one of its clinical or sub-clinical symptoms.
[0068] The practice of the present invention employs, unless otherwise indicated, conventional techniques of statistical analysis, molecular biology (including recombinant techniques), microbiology, cell biology, and biochemistry, which are within the skill of the art. Such tools and techniques are described in detail in e.g., Sambrook et al. (2001) Molecular Cloning: A Laboratory Manual. 3rd ed. Cold Spring Harbor Laboratory Press: Cold Spring Harbor, N.Y.; Ausubel et al. eds. (2005) Current Protocols in Molecular Biology. John Wiley and Sons, Inc.: Hoboken, N.J.; Bonifacino et al. eds. (2005) Current Protocols in Cell Biology. John Wiley and Sons, Inc.: Hoboken, N.J.; Coligan et al. eds. (2005) Current Protocols in Immunology, John Wiley and Sons, Inc.: Hoboken, N.J.; Coico et al. eds. (2005) Current Protocols in Microbiology, John Wiley and Sons, Inc.: Hoboken, N.J.; Coligan et al. eds. (2005) Current Protocols in Protein Science, John Wiley and Sons, Inc.: Hoboken, N.J.; and Enna et al. eds. (2005) Current Protocols in Pharmacology, John Wiley and Sons, Inc.: Hoboken, N.J. Additional techniques are explained, e.g., in U.S. Pat. No. 7,912,698 and U.S. Patent Appl. Pub. Nos. 2011/0202322 and 2011/0307437.
Peptides of the Invention and their Uses
[0069] The invention provides a method for manipulating a signaling pathway, i.e., activation or inhibition of Gi subunits downstream of multiple growth factors in different cell types and in a diverse array of pathophysiologic conditions. More specifically, the invention provides therapeutic effects of cell-permeant peptides that activate or inhibit G proteins downstream of growth factors. In certain embodiments, the invention provides cell-permeant peptides, such as, e.g., wild-type and mutant TAT-GIV-CT peptides, and/or therapeutic agents derived therefrom (e.g., pharmaceutical compositions and expression vectors), and methods of use thereof, including for wound healing, reversing insulin resistance, inhibiting metastasis and fibrosis. The invention also provides genetic modalities of expressing GIV-CT constructs for gene therapy in diverse disease conditions.
[0070] In certain embodiments, the invention provides the rationale, validation and effectiveness of a non-genetic technique for manipulating an emerging signaling pathway/paradigm, i.e., transactivation of Gi subunits by growth factors via the GIV platform. The GIV-CT-containing activating peptides of the invention were designed to retain two fundamental properties of the full-length GIV, i.e., activate Gi by enhancing nucleotide release via its GEF motif and also interacting with ligand-activated RTKs via its SH2-like motif. As described in the Examples section, below, it was determined that appending a peptide transduction domain (PTD) such as, e.g., TAT leader sequence, was able to make the GIV-CT peptides cell permeable without altering their functional properties. Additional PTDs useful in the peptides of the invention, include, e.g., PTDs described in Ho et al., Cancer Res, 2001 such as, e.g.
[0071] Non-limiting examples of additional peptide transduction domains (PTD)/cell penetrating peptides (CPPs) which can be used to impart cell-permeability on the GIV-CT peptides of the invention include those described in Kerkis et al., IUBMB Life, 2006, 58(1):7-13 and Matsumoto et al., Scientific Reports, 2015, 5, Article number: 12884.
[0072] Alternatively, the peptides of the invention can be delivered to target cells using viral (e.g., retroviral, lentiviral, etc.) and non-viral (e.g., liposomes, bioballistics etc.) vectors or lipid particles or nanoparticles.
[0073] In certain embodiments, the cell-permeable GIV-CT peptides were developed by fusing a TAT-peptide transduction domain (TAT-PTD) to the minimal modular elements of GIV that are necessary and sufficient for activation of Gi downstream of RTKs. In certain embodiments, the minimal modular elements of GIV corresponds to the C-terminus of GIV comprising amino acid residues at 1660-1870 position of human GIV protein (TAT-GIV-CT peptides). GenBank provides the following sequence for human GIV protein (GenBank Accession No. BAE44387.1 I/GI:74356043; Accession# AB201172.1; SEQ ID NO: 1): >gi|74356043|dbj|BAE44387.1|girdin [Homo sapiens]
TABLE-US-00004 MENEIFTPLLEQFMTSPLVTWVKTFGPLAAGNGTNLDEYVALVDGVFLN QVMLQINPKLESQRVNKKVNNDASLRMHNLSILVRQIKFYYQTLQQLIM MSLPNVLIIGKNPFSEQGTEEVKKLLLLLLGCAVQCQKKEEFIERIQGL DFDTKAAVAAHIQEVTHNQENVFDLQWMEVTDMSQEDIEPLLKNMALHL KRLIDERDEHSETIIELSEERDGLHFLPHASSSAQSPCGSPGMKRTESR QHLSVELADAKAKIRRLRQELEEKTEQLLDCKQELEQMEIELKRLQQEN MNLLSDARSARMYRDELDALREKAVRVDKLESEVSRYKERLHDIEFYKA RVEELKEDNQVLLETKTMLEDQLEGTRARSDKLHELEKENLQLKAKLHD MEMERDMDRKKIEELMEENMTLEMAQKQSMDESLHLGWELEQISRTSEL SEAPQKSLGHEVNELTSSRLLKLEMENQSLTKTVEELRTTVDSVEGNAS KILKMEKENQRLSKKVEILENEIVQEKQSLQNCQNLSKDLMKEKAQLEK TIETLRENSERQIKILEQENEHLNQTVSSLRQRSQISAEARVKDIEKEN KILHESIKETSSKLSKIEFEKRQIKKELEHYKEKGERAEELENELHHLE KENELLQKKITNLKITCEKIEALEQENSELERENRKLKKTLDSFKNLTF QLESLEKENSQLDEENLELRRNVESLKCASMKMAQLQLENKELESEKEQ LKKGLELLKASFKKTERLEVSYQGLDIENQRLQKTLENSNKKIQQLESE LQDLEMENQTLQKNLEELKISSKRLEQLEKENKSLEQETSQLEKDKKQL EKENKRLRQQAEIKDTTLEENNVKIGNLEKENKTLSKEIGIYKESCVRL KELEKENKELVKRATIDIKTLVTLREDLVSEKLKTQQMNNDLEKLTHEL EKIGLNKERLLHDEQSTDDRYKLLESKLESTLKKSLEIKEEKIAALEAR LEESTNYNQQLRQELKTVKKNYEALKQRQDEERMVQSSPPISGEDNKWE RESQETTRELLKVKDRLIEVERNNATLQAEKQALKTQLKQLETQNNNLQ AQILALQRQTVSLQEQNTTLQTQNAKLQVENSTLNSQSTSLMNQNAQLL IQQSSLENENESVIKEREDLKSLYDSLIKDHEKLELLHERQASEYESLI SKHGTLKSAHKNLEVEHRDLEDRYNQLLKQKGQLEDLEKMLKVEQEKML LENKNHETVAAEYKKLCGENDRLNHTYSQLLKETEVLQTDHKNLKSLLN NSKLEQTRLEAEFSKLKEQYQQLDITSTKLNNQCELLSQLKGNLEEENR HLLDQIQTLMLQNRTLLEQNMESKDLFHVEQRQYIDKLNELRRQKEKLE EKIMDQYKFYDPSPPRRRGNWITLKMRKLIKSKKDINRERQKSLTLTPT RSDSSEGFLQLPHQDSQDSSSVGSNSLEDGQTLGTKKSSMVALKRLPFL RNRPKDKDKMKACYRRSMSMNDLVQSMVLAGQWTGSTENLEVPDDISTG KRRKELGAMAFSTTAINFSTVNSSAGFRSKQLVNNKDTTSFEDISPQGV SDDSSTGSRVHASRPASLDSGRTSTSNSNNNASLHEVKAGAVNNQSRPQ SHSSGEFSLLHDHEAWSSSGSSPIQYLKRQTRSSPVLQHKISETLESRH HKIKTGSPGSEVVTLQQFLEESNKLTSVQIKSSSQENLLDEVMKSLSVS SDFLGKDKPVSCGLARSVSGKTPGDFYDRRTTKPEFLRPGPRKTEDTYF ISSAGKPTPGTQGKIKLVKESSLSRQSKDSNPYATLPRASSVISTAEGT TRRTSIHDFLTKDSRLPISVDSPPAAADSNTTAASNVDKVQESRNSKSR SREQQSS
[0074] In certain embodiments, the cell-permeable GIV-CT peptides were developed by fusing a TAT-peptide transduction domain (TAT-PTD) to the minimal modular elements of GIV that are necessary and sufficient for activation of Gi downstream of RTKs. In certain embodiments, the minimal modular elements of GIV corresponds to the C-terminus of GIV comprising amino acid residues at 1660-1870 position (TAT-GIV-CT peptides). The TAT-GIV-CT peptides comprise TAT-tag, which provide a reliable means for direct protein transduction into the cell. The TAT-GIV-CT peptides also comprise a linker between TAT and GIV to allow for flexibility. The TAT-GIV-CT peptides also comprise a hexa-histidine tag to allow for affinity purification and a hemagglutinin (HA) tag to allow for detection in cells. Furthermore, the TAT-GIV-CT wild-type peptides comprise the GEF and SH2-like motifs, representing the cross-road between GPCR/G and PTK signaling pathways. The TAT-GIV-CT wild-type peptides also comprise two tyrosines (Y1764 and Y1798) that serve as docking site for p85 (PI3K).
[0075] In one specific embodiment, the invention provides TAT-GIV-CT-WT peptide (SEQ ID NO: 2).
TABLE-US-00005
[0076] The cell-permeable peptides can be used to engineer signaling networks and alter cell behavior. In the presence of an intact GEF motif, TAT-GIV-CT peptides enhanced diverse processes such as, e.g., 2D cell migration after scratch-wounding, myofibroblast activation and collagen production, and metabolic insulin response in skeletal muscles. Furthermore, topical application of TAT-GIV-CT peptides enhanced wound repair in a GEF-dependent manner. Therefore, the cell-permeable GIV-CT peptides of the invention, e.g., (1) modulate two dimensional cell migration; (2) effectively modulate signaling in human stellate cells; (3) restore insulin sensitivity in insulin resistant skeletal muscle; and (4) accelerate wound healing. The therapeutic potential of these peptides grows as the list of pathophysiologic processes that GIV modulates grows. Pharmaceutical compositions comprising the cell-permeable peptides of the inventions are also provided.
[0077] In certain embodiments, the invention provides a method for modulating GIV-dependent cellular signaling pathways in a pathophysiologic condition in a subject in need, comprising administering to said subject an effective amount of the cell permeable peptide, or the pharmaceutical composition of the invention. In certain embodiments, the GIV-dependent cellular signaling pathway is PTK-Gi pathway, wherein the cell permeable peptide serves as a peptide agonist that enhances the PTK-Gi pathway G protein activation. In certain embodiments, the pathophysiologic condition is associated with growth factor cellular response driven by GIV-GEF.
[0078] The invention further provides a method for accelerating wound healing in a subject in need thereof, comprising administering to said subject an effective amount of the cell permeable peptide of the invention or a pharmaceutical composition comprising such peptide or a vector encoding such peptide, wherein the cell-permeable peptide enhances, e.g., epithelial 2D-cell migration.
[0079] Moreover, the invention provides a method for modulating GIV-dependent metabolic insulin signaling in skeletal muscles and/or adipose tissue in a subject in need thereof, comprising administering to the subject an effective amount of the cell permeable peptide, or a pharmaceutical composition comprising such peptide or a vector encoding such peptide, wherein the cell-permeable peptide effectively reverses insulin resistance (IR) in skeletal muscles and/or adipose tissue. Further, the invention provides a method for regulating glucose uptake on insulin response in skeletal muscles in a subject in need, comprising targeting GIV-GEF motif to control its ability to bind to ligand-activated InsR-IRS1 complexes and/or to activate InsR-Gi protein complexes after insulin simulation. The invention further provides a method for reversing insulin resistance and sensitizing myotubes to the insulin action in skeletal muscles in a subject in need thereof, by increasing the copies of functional GIV-GEF molecules that can overcome the phosphoinhibition of serine residue at position 1689 (Ser1689) of endogenous GIV. The invention also provides mutant GIV-CT peptides in which Serine at position 1689 (Ser1689) is mutated to Alanine (Ala); such a peptide can no longer be phosphoinhibited, and therefore, will maintain GIV-GEF in active state.
[0080] In addition to the cell-permeable peptides based on the sequence of wild-type GIV-CT, the invention also provides constitutively active mutants of GIV-CT such as, e.g., S1675D (Bhandari et al., Proc Natl Acad Sci USA, 2015, 112(35):E4874-83).
[0081] The invention also provides a method for inhibiting tumor cell invasion (e.g., through the basement membrane matrix) and a method for inhibiting fibrosis in a subject in need thereof, comprising administering to the subject an effective amount of the cell permeable peptide(s) of the invention, which peptide(s) are dominant-negative mutants of wild-type GIV-CT (or a pharmaceutical composition comprising such peptide or a vector encoding such peptide). Non-limiting examples of useful dominant-negative mutants of wild-type GIV-CT include, e.g., F1685A (GEF-deficient), S1689D (GEF-deficient), S1675A (GEF-deficient), and Y1764F+Y1798F (non-phosphorylatable).
[0082] The invention further provides a method for modulating GIV-dependent signaling in myofibroblasts in various organs during fibrosis (e.g., in liver-resident myofibroblasts (hepatic stellate cells [HSCs]) during liver fibrosis as well as in myofibroblasts in the muscle and heart) in a subject in need thereof, comprising administering to the subject an effective amount of the cell permeable peptide of the invention or a pharmaceutical composition comprising such peptide or a vector encoding such peptide. Accordingly, the peptides of the invention can be used for treating (halting/reversing) organ fibrosis diseases, including without limitation, liver cirrhosis, liver fibrosis (e.g., non-alcoholic fatty liver disease [NAFLD], non-alcoholic steatohepatitis [NASH], alcoholic fatty liver disease, alcoholic steatohepatitis, hepatic steatosis), skeletal muscle fibrosis, skin fibrosis (e.g., scleroderma, skin fibrosis secondary to burns, keloids, hypertrophic post-surgical wounds), renal fibrosis (e.g., glomerulosclerosis, interstitial-tubular fibrosis), esophageal or gastro-intestinal fibrosis, bone marrow fibrosis (e.g., myelodysplastic syndrome), pulmonary fibrosis, peritoneal fibrosis, pancreatic fibrosis, post-radiation fibrosis, cardiac fibrosis and remodeling after myocardial infarction, brain fibrosis secondary to ischemia or infarcts, post-traumatic brain fibrosis, post-traumatic muscle fibrosis, and synovial/joint fibrosis.
[0083] The implications of the invention also include other genetic modalities expressing GIV-CT constructs, such as gene therapy in diverse disease conditions. Non-genetic exogenous modulation of the GIV-Gi signaling interface using cell-penetrable GIV-derived peptides is an effective strategy to reset pathologic signaling networks downstream multiple receptors in a diverse array of pathophysiologic conditions. Thus, TAT-GIV-CT peptides provide a novel and versatile tool to modulate the function of GIV resulting in manipulation of Gi activation downstream of multiple growth factors in different cell types and in a diverse array of pathophysiologic conditions.
[0084] In certain embodiments, the invention provides that the cell-permeable GIV-CT peptides are effective in exogenous modulation of Gi and EGFR signaling, and that TAT-GIV-CT peptides can be used as a versatile strategy to assemble RTKs-Gi complexes in diverse cell types and trigger activation of Gi downstream of a variety of growth factors. In contrast, the dominant negative GEF-deficient mutant FA peptides which inhibit the formation of RTK-Gi complexes, offer a strategy for inhibiting aberrant signaling via this pathway. Thus, TAT-GIV-CT-WT serves as a peptide agonist that enhances the RTK-Gi pathway for G protein activation, whereas the FA mutant peptide antagonizes it. Further, in other embodiments, the invention provides that the cell permeable GIV-CT peptides allow manipulation of a diverse array of complex GIV-dependent cellular process.
[0085] The impact of these findings is two-fold. First, it confirms that heterotrimeric G-proteins are activated exclusively by GPCRs. The recent work has revealed that RTKs can indeed interact with and activate Gi (30) during a variety of pathophysiologic processes (7, 14, 21) utilizing the C-terminus of GIV as a platform for such RTK-G protein cross-talk (25). The findings described here using TAT-GIV-CT peptides represent a significant advancement in an ability to access, interrogate and manipulate that platform, and thereby, modulate the cross-talk it facilitates. Second, G-proteins are an ideal target for therapeutic intervention because they serve as signal amplification switches, and potent and pathway-selective activators/inhibitors of a G protein can serve multiple purposes ranging from being a research tool to pharmacologic probe for use in experimental and clinical therapeutics (36). The technique defined here allows exogenous manipulation of the RTK-GIV-Gi pathway by enhancing or suppressing coupling of G protein with RTKs and their subsequent transactivation, in a dose dependent manner while minimizing the risk of tampering with other physiologic functions/interactions of G proteins/or other components within the network of modulators of G protein signaling (37).
[0086] The therapeutic advantages of using cell-permeable GIV-CT peptides for activation/inactivation of Gi are also many-fold. First, it circumvents the need to target individual receptors in diseases that are driven by multiple receptors. Second, GIV's SH2 like domain can directly bind multiple ligand-activated RTKs and re-wire several components of downstream signaling (
[0087] Thus, the invention provides cell-permeable peptides that allow exogenous modulation of the fundamental function of GIV, i.e., activation of Gi downstream of growth factor RTKs. These peptides provide a versatile tool to manipulate Gi activation downstream of multiple growth factors in different cell types and in a diverse array of pathophysiologic conditions.
Peptide Modifications and Administration
[0088] The peptides of the invention can be modified in various ways to improve their pharmacokinetic and other properties. Peptides can be modified at the amino (N-)terminus, and/or carboxy (C-)terminus and/or by replacement of one or more of the naturally occurring genetically encoded amino acids with an unconventional amino acid, modification of the side chain of one or more amino acid residues, peptide phosphorylation, and the like.
[0089] Amino terminus modifications include methylation (e.g., NHCH.sub.3 or N(CH.sub.3).sub.2), acetylation (e.g., with acetic acid or a halogenated derivative thereof such as -chloroacetic acid, -bromoacetic acid, or -iodoacetic acid), adding a benzyloxycarbonyl (Cbz) group, or blocking the amino terminus with any blocking group containing a carboxylate functionality defined by RCOO or sulfonyl functionality defined by RSO.sub.2, where R is selected from alkyl, aryl, heteroaryl, alkyl aryl, and the like, and similar groups. One can also incorporate a desamino acid at the N-terminus (so that there is no N-terminal amino group) to decrease susceptibility to proteases or to restrict the conformation of the peptide compound.
[0090] Carboxy terminus modifications include replacing the free acid with a carboxamide group or forming a cyclic lactam at the carboxy terminus to introduce structural constraints. One can also cyclize the peptides of the invention, or incorporate a desamino or descarboxy residue at the termini of the peptide, so that there is no terminal amino or carboxyl group, to decrease susceptibility to proteases or to restrict the conformation of the peptide. C-terminal functional groups of the compounds of the present invention include amide, amide lower alkyl, amide di(lower alkyl), lower alkoxy, hydroxy, and carboxy, and the lower ester derivatives thereof, and the pharmaceutically acceptable salts thereof.
[0091] One can replace the naturally occurring side chains of the 20 genetically encoded amino acids (or the stereoisomeric D-amino acids) with other side chains, for instance with groups such as alkyl, lower alkyl, cyclic 4-, 5-, 6-, to 7-membered alkyl, amide, amide lower alkyl, amide di(lower alkyl), lower alkoxy, hydroxy, carboxy and the lower ester derivatives thereof, and with 4-, 5-, 6-, to 7-membered heterocyclic. For example, proline analogues in which the ring size of the proline residue is changed from 5 members to 4, 6, or 7 members can be employed. Cyclic groups can be saturated or unsaturated, and if unsaturated, can be aromatic or non-aromatic. Heterocyclic groups preferably contain one or more nitrogen, oxygen, and/or sulfur heteroatoms. Examples of such groups include the furazanyl, furyl, imidazolidinyl, imidazolyl, imidazolinyl, isothiazolyl, isoxazolyl, morpholinyl (e.g. morpholino), oxazolyl, piperazinyl (e.g., 1-piperazinyl), piperidyl (e.g., 1-piperidyl, piperidino), pyranyl, pyrazinyl, pyrazolidinyl, pyrazolinyl, pyrazolyl, pyridazinyl, pyridyl, pyrimidinyl, pyrrolidinyl (e.g., 1-pyrrolidinyl), pyrrolinyl, pyrrolyl, thiadiazolyl, thiazolyl, thienyl, thiomorpholinyl (e.g., thiomorpholino), and triazolyl. These heterocyclic groups can be substituted or unsubstituted. Where a group is substituted, the substituent can be alkyl, alkoxy, halogen, oxygen, or substituted or unsubstituted phenyl.
[0092] Common examples of conventional amino acid replacements include stereoisomers (e.g., D-amino acids) and unnatural amino acids such as, for example, L-ornithine, L-homocysteine, L-homoserine, L-citrulline, 3-sulfino-L-alanine, N-(L-arginino)succinate, 3,4-dihydroxy-L-phenylalanine, 3-iodo-L-tyrosine, 3,5-diiodo-L-tyrosine, triiodothyronine, L-thyroxine, L-selenocysteine, N-(L-arginino)taurine, 4-aminobutylate, (R,S)-3-amino-2-methylpropanoate, a,a-disubstituted amino acids, N-alkyl amino acids, lactic acid, -alanine, 3-pyridylalanine, 4-hydroxyproline, O-phosphoserine, N-methylglycine, N-acetylserine, N-formylmethionine, 3-methylhistidine, 5-hydroxylysine, nor-leucine, and other similar amino acids and imino acids. A general method for site-specific incorporation of unnatural amino acids into proteins and peptides is described in Noren et al., Science, 244:182-188 (April 1989).
[0093] One can also readily modify peptides by phosphorylation, and other methods (e.g., as described in Hruby, et al. (1990) Biochem J. 268:249-262).
[0094] The peptide compounds of the invention also serve as structural models for non-peptidic compounds with similar biological activity. Those of skill in the art recognize that a variety of techniques are available for constructing compounds with the same or similar desired biological activity as the lead peptide compound, but with more favorable activity than the lead with respect to solubility, stability, and susceptibility to hydrolysis and proteolysis (see, e.g., Morgan and Gainor (1989) Ann. Rep. Med. Chem. 24:243-252). These techniques include replacing the peptide backbone with a backbone composed of phosphonates, amidates, carbamates, sulfonamides, secondary amines, and N-methylamino acids.
[0095] The present invention also provides conjugates of the disclosed peptide monomers. Thus, according to a preferred embodiment, the monomeric peptides of the present invention are dimerized or oligomerized, thereby enhancing their biological activity.
[0096] In one embodiment, the peptide monomers of the invention may be oligomerized using the biotin/streptavidin system. Biotinylated analogs of peptide monomers may be synthesized by standard techniques. For example, the peptide monomers may be C-terminally biotinylated. These biotinylated monomers are then oligomerized by incubation with streptavidin [e.g., at a 4:1 molar ratio at room temperature in phosphate buffered saline (PBS) or HEPES-buffered RPMI medium (Invitrogen) for 1 hour]. In a variation of this embodiment, biotinylated peptide monomers may be oligomerized by incubation with any one of a number of commercially available anti-biotin antibodies [e.g., goat anti-biotin IgG from Kirkegaard & Perry Laboratories, Inc. (Washington, D.C.)].
[0097] Linkers.
[0098] In other embodiments, the peptide monomers of the invention can be dimerized by covalent attachment to at least one linker moiety. The linker (L.sub.K) moiety can be a C.sub.1-12 linking moiety optionally terminated with one or two NH linkages and optionally substituted at one or more available carbon atoms with a lower alkyl substituent (e.g., NHRNH wherein R is a lower (C.sub.1-6) alkylene substituted with a functional group such as a carboxyl group or an amino group, such as, for example, a lysine residue or a lysine amide).
[0099] In an additional embodiment, polyethylene glycol (PEG) may serve as the linker L.sub.K that dimerizes two peptide monomers: for example, a single PEG moiety may be simultaneously attached to the N-termini of both peptide chains of a peptide dimer.
[0100] In yet another additional embodiment, the linker (L.sub.K) moiety is preferably, but not necessarily, a molecule containing two carboxylic acids and optionally substituted at one or more available atoms with an additional functional group such as an amine capable of being bound to one or more PEG molecules. Such a molecule can be depicted as:
CO(CH.sub.2).sub.nX(CH.sub.2).sub.mCO
[0101] where n is an integer from 0 to 10, m is an integer from 1 to 10, X is selected from O, S, N(CH.sub.2).sub.pNR.sub.1, NCO(CH.sub.2).sub.pNR.sub.1, and CHNR.sub.1, R.sub.1 is selected from H, Boc, Cbz, etc., and p is an integer from 1 to 10.
[0102] Linkers can be incorporated into the peptide during peptide synthesis. For example, where a linker L.sub.K moiety contains two functional groups capable of serving as initiation sites for peptide synthesis and a third functional group (e.g., a carboxyl group or an amino group) that enables binding to another molecular moiety, the linker may be conjugated to a solid support. Thereafter, two peptide monomers may be synthesized directly onto the two reactive nitrogen groups of the linker L.sub.K moiety in a variation of the solid phase synthesis technique.
[0103] In alternate embodiments where a peptide dimer is dimerized by a linker L.sub.K moiety, said linker may be conjugated to the two peptide monomers of a peptide dimer after peptide synthesis. Such conjugation may be achieved by methods well established in the art. In one embodiment, the linker contains at least two functional groups suitable for attachment to the target functional groups of the synthesized peptide monomers. For example, a linker with two free amine groups may be reacted with the C-terminal carboxyl groups of each of two peptide monomers. In another example, linkers containing two carboxyl groups, either preactivated or in the presence of a suitable coupling reagent, may be reacted with the N-terminal or side chain amine groups, or C-terminal lysine amides, of each of two peptide monomers.
[0104] Spacers.
[0105] A peptide monomer or dimer may further comprise one or more spacer moieties. Such spacer moieties may be attached to a peptide monomer or to a peptide dimer (e.g., such spacer moieties may be attached to the linker L.sub.K moiety that connects the monomers of a peptide dimer). For example, such spacer moieties may be attached to a peptide via the carbonyl carbon of a lysine linker, or via the nitrogen atom of an iminodiacetic acid linker. Such a spacer may connect a peptide to an attached water soluble polymer moiety or a protecting group.
[0106] In one embodiment, the spacer moiety is a C.sub.1-12 linking moiety optionally terminated with NH linkages or carboxyl (COOH) groups, and optionally substituted at one or more available carbon atoms with a lower alkyl substituent. In one embodiment, the spacer is RCOOH wherein R is a lower (C.sub.1-6) alkylene optionally substituted with a functional group such as a carboxyl group or an amino group that enables binding to another molecular moiety. For example, the spacer may be a glycine (G) residue, or an amino hexanoic acid.
[0107] In other embodiments, the spacer is NHRNH wherein R is a lower (C.sub.1-6) alkylene substituted with a functional group such as a carboxyl group or an amino group that enables binding to another molecular moiety. For example, the spacer may be a lysine (K) residue or a lysine amide (KNH.sub.2, a lysine residue wherein the carboxyl group has been converted to an amide moiety CONH.sub.2).
[0108] A spacer can be incorporated into the peptide during peptide synthesis. For example, where a spacer contains a free amino group and a second functional group (e.g., a carboxyl group or an amino group) that enables binding to another molecular moiety, the spacer may be conjugated to the solid support. Thereafter, the peptide may be synthesized directly onto the spacer's free amino group by standard solid phase techniques.
[0109] For example, a spacer containing two functional groups is first coupled to the solid support via a first functional group. Next a linker L.sub.K moiety having two functional groups capable of serving as initiation sites for peptide synthesis and a third functional group (e.g., a carboxyl group or an amino group) that enables binding to another molecular moiety is conjugated to the spacer via the spacer's second functional group and the linker's third functional group. Thereafter, two peptide monomers may be synthesized directly onto the two reactive nitrogen groups of the linker L.sub.K moiety in a variation of the solid phase synthesis technique. For example, a solid support coupled spacer with a free amine group may be reacted with a lysine linker via the linker's free carboxyl group.
[0110] In alternate embodiments where the peptide compounds contain a spacer moiety, said spacer may be conjugated to the peptide after peptide synthesis. Such conjugation may be achieved by methods well established in the art. In one embodiment, the linker contains at least one functional group suitable for attachment to the target functional group of the synthesized peptide. For example, a spacer with a free amine group may be reacted with a peptide's C-terminal carboxyl group. In another example, a linker with a free carboxyl group may be reacted with the free amine group of a peptide's N-terminus or of a lysine residue. In yet another example, a spacer containing a free sulfhydryl group may be conjugated to a cysteine residue of a peptide by oxidation to form a disulfide bond.
[0111] Water Soluble Polymer Moieties.
[0112] The peptide monomers, dimers, or multimers of the invention may further comprise one or more water soluble polymer moieties. Preferably, these polymers are covalently attached to the peptide compounds of the invention. Included with the below description, the U.S. patent application Ser. No. 10/844,933 and International Patent Application No. PCT/US04/14887, filed May 12, 2004, are incorporated by reference herein in their entirety.
[0113] In recent years, water-soluble polymers, such as polyethylene glycol (PEG), have been used for the covalent modification of peptides of therapeutic and diagnostic importance. Attachment of such polymers is thought to enhance biological activity, prolong blood circulation time, reduce immunogenicity, increase aqueous solubility, and enhance resistance to protease digestion (see, e.g., J. M. Harris, Ed., Biomedical and Biotechnical Applications of Polyethylene Glycol Chemistry, Plenum, New York, 1992; Knauf, et al. (1988) J. Biol. Chem. 263; 15064; Tsutsumi, et al. (1995) J. Controlled Release 33:447; Kita, et al. (1990) Drug Des. Delivery 6:157; Abuchowski, et al. (1977) J. Biol. Chem. 252:582; Beauchamp, et al. (1983) Anal. Biochem. 131:25; Chen, et al. (1981) Biochim. Biophy. Acta 660:293).
[0114] The water soluble polymers useful for the peptide compounds of the invention may be, for example, polyethylene glycol (PEG), copolymers of ethylene glycol/propylene glycol, carboxymethylcellulose, dextran, polyvinyl alcohol, polyvinyl pyrrolidone, poly-1,3-dioxolane, poly-1,3,6-trioxane, ethylene/maleic anhydride copolymer, polyaminoacids (either homopolymers or random copolymers), poly(n-vinyl pyrrolidone)polyethylene glycol, propropylene glycol homopolymers, polypropylene oxide/ethylene oxide copolymers, and polyoxyethylated polyols.
[0115] The water soluble polymer may be of any molecular weight, and may be branched or unbranched. A preferred PEG for use in the present invention comprises linear, unbranched PEG having a low molecular weight. It is understood that in a given preparation of PEG, the molecular weights will typically vary among individual molecules. Some molecules will weight more, and some less, than the stated molecular weight. Such variation is generally reflect by use of the word about to describe molecular weights of the PEG molecules.
[0116] Peptides, peptide dimers and other peptide-based molecules of the invention can be attached to water-soluble polymers (e.g., PEG) using any of a variety of chemistries to link the water-soluble polymer(s) to the receptor-binding portion of the molecule (e.g., peptide+spacer). A typical embodiment employs a single attachment junction for covalent attachment of the water soluble polymer(s) to the receptor-binding portion, however in alternative embodiments multiple attachment junctions may be used, including further variations wherein different species of water-soluble polymer are attached to the receptor-binding portion at distinct attachment junctions, which may include covalent attachment junction(s) to the spacer and/or to one or both peptide chains. In some embodiments, the dimer or higher order multimer will comprise distinct species of peptide chain (i.e., a heterodimer or other heteromultimer). By way of example and not limitation, a dimer may comprise a first peptide chain having a PEG attachment junction and the second peptide chain may either lack a PEG attachment junction or utilize a different linkage chemistry than the first peptide chain and in some variations the spacer may contain or lack a PEG attachment junction and said spacer, if PEGylated, may utilize a linkage chemistry different than that of the first and/or second peptide chains. An alternative embodiment employs a PEG attached to the spacer portion of the receptor-binding portion and a different water-soluble polymer (e.g., a carbohydrate) conjugated to a side chain of one of the amino acids of the peptide portion of the molecule.
[0117] A wide variety of polyethylene glycol (PEG) species may be used for PEGylation of the receptor-binding portion (peptides+spacer). Substantially any suitable reactive PEG reagent can be used. In preferred embodiments, the reactive PEG reagent will result in formation of a carbamate or amide bond upon conjugation to the receptor-binding portion. Suitable reactive PEG species include, but are not limited to, those which are available for sale in the Drug Delivery Systems catalog (2003) of NOF Corporation (Yebisu Garden Place Tower, 20-3 Ebisu 4-chome, Shibuya-ku, Tokyo 150-6019) and the Molecular Engineering catalog (2003) of Nektar Therapeutics (490 Discovery Drive, Huntsville, Ala. 35806). For example and not limitation, the following PEG reagents are often preferred in various embodiments: mPEG2-NHS, mPEG2-ALD, multi-Arm PEG, mPEG(MAL)2, mPEG2(MAL), mPEG-NH2, mPEG-SPA, mPEG-SBA, mPEG-thioesters, mPEG-Double Esters, mPEG-BTC, mPEG-ButyrALD, mPEG-ACET, heterofunctional PEGs (NH2-PEG-COOH, Boc-PEG-NHS, Fmoc-PEG-NHS, NHS-PEG-VS, NHS-PEG-MAL), PEG acrylates (ACRL-PEG-NHS), PEG-phospholipids (e.g., mPEG-DSPE), multiarmed PEGs of the SUNBRITE series including the GL series of glycerine-based PEGs activated by a chemistry chosen by those skilled in the art, any of the SUNBRITE activated PEGs (including but not limited to carboxyl-PEGs, p-NP-PEGs, Tresyl-PEGs, aldehyde PEGs, acetal-PEGs, amino-PEGs, thiol-PEGs, maleimido-PEGs, hydroxyl-PEG-amine, amino-PEG-COOH, hydroxyl-PEG-aldehyde, carboxylic anhydride type-PEG, functionalized PEG-phospholipid, and other similar and/or suitable reactive PEGs as selected by those skilled in the art for their particular application and usage.
[0118] The number of polymer molecules attached may vary; for example, one, two, three, or more water soluble polymers may be attached to a peptide of the invention. The multiple attached polymers may be the same or different chemical moieties (e.g., PEGs of different molecular weight). In some cases, the degree of polymer attachment (the number of polymer moieties attached to a peptide and/or the total number of peptides to which a polymer is attached) may be influenced by the proportion of polymer molecules versus peptide molecules in an attachment reaction, as well as by the total concentration of each in the reaction mixture. In general, the optimum polymer versus peptide ratio (in terms of reaction efficiency to provide for no excess unreacted peptides and/or polymer moieties) will be determined by factors such as the desired degree of polymer attachment (e.g., mono, di-, tri-, etc.), the molecular weight of the polymer selected, whether the polymer is branched or unbranched, and the reaction conditions for a particular attachment method.
[0119] There are a number of PEG attachment methods available to those skilled in the art (see, e.g., Goodson, et al. (1990) Bio/Technology 8:343; EP 0 401 384; Malik, et al., (1992) Exp. Hematol. 20:1028-1035; PCT Pub. No. WO 90/12874; U.S. Pat. No. 5,757,078; and U.S. Pat. No. 6,077,939). For example, activated PEG may be covalently bound to amino acid residues via a reactive group, such as a free amino group in N-terminal amino acid residues and lysine (K) residues or a free carboxyl group in C-terminal amino acid residues. Sulfhydryl groups (e.g., as found on cysteine residues) may also be used as a reactive group for attaching PEG. In addition, enzyme-assisted methods for introducing activated groups (e.g., hydrazide, aldehyde, and aromatic-amino groups) specifically at the C-terminus of a polypeptide have been described (Schwarz, et al. (1990) Methods Enzymol. 184:160; Rose, et al. (1991) Bioconjugate Chem. 2:154; Gaertner, et al. (1994) J. Biol. Chem. 269:7224).
[0120] For example, PEG molecules may be attached to peptide amino groups using methoxylated PEG (mPEG) having different reactive moieties. Such polymers include mPEG-succinimidyl succinate, mPEG-succinimidyl carbonate, mPEG-imidate, mPEG-4-nitrophenyl carbonate, and mPEG-cyanuric chloride. Similarly, PEG molecules may be attached to peptide carboxyl groups using methoxylated PEG with a free amine group (mPEG-NH.sub.2).
[0121] Where attachment of the PEG is non-specific and a peptide containing a specific PEG attachment is desired, the desired PEGylated compound may be purified from the mixture of PEGylated compounds. For example, if an N-terminally PEGylated peptide is desired, the N-terminally PEGylated form may be purified from a population of randomly PEGylated peptides (i.e., separating this moiety from other monoPEGylated moieties).
[0122] Site-specific PEGylation at the N-terminus, side chain, and C-terminus can be performed through (i) solid-phase synthesis (see, e.g., Felix, et al. (1995) Int. J. Peptide Protein Res. 46:253) or (ii) attaching a peptide to extremities of liposomal surface-grafted PEG chains in a site-specific manner through a reactive aldehyde group at the N-terminus generated by sodium periodate oxidation of N-terminal threonine (see, e.g., Zalipsky, et al. (1995) Bioconj. Chem. 6:705; this method is limited to polypeptides with N-terminal serine or threonine residues), or (iii) via a hydrazone, reduced hydrazone, oxime, or reduced oxime bond is described in U.S. Pat. No. 6,077,939.
[0123] In one method, selective N-terminal PEGylation may be accomplished by reductive alkylation which exploits differential reactivity of different types of primary amino groups (lysine versus the N-terminal) available for derivatization in a particular protein. Under the appropriate reaction conditions, a carbonyl group containing PEG is selective attached to the N-terminus of a peptide. For example, one may selectively N-terminally PEGylate the protein by performing the reaction at a pH which exploits the pK.sub.a differences between the -amino groups of a lysine residue and the -amino group of the N-terminal residue of the peptide. By such selective attachment, PEGylation takes place predominantly at the N-terminus of the protein, with no significant modification of other reactive groups (e.g., lysine side chain amino groups). Using reductive alkylation, the PEG should have a single reactive aldehyde for coupling to the protein (e.g., PEG proprionaldehyde may be used).
[0124] Site-specific mutagenesis is a further approach which may be used to prepare peptides for site-specific polymer attachment. By this method, the amino acid sequence of a peptide is designed to incorporate an appropriate reactive group at the desired position within the peptide. For example, WO 90/12874 describes the site-directed PEGylation of proteins modified by the insertion of cysteine residues or the substitution of other residues for cysteine residues.
[0125] Where PEG is attached to a spacer or linker moiety, similar attachment methods may be used. In this case, the linker or spacer contains a reactive group and an activated PEG molecule containing the appropriate complementary reactive group is used to effect covalent attachment. In preferred embodiments the linker or spacer reactive group contains a terminal amino group (i.e., positioned at the terminus of the linker or spacer) which is reacted with a suitably activated PEG molecule to make a stable covalent bond such as an amide or a carbamate. Suitable activated PEG species include, but are not limited to, mPEG-para-nitrophenylcarbonate (mPEG-NPC), mPEG-succinimidyl carbonate (mPEG-SC), and mPEG-succinimidyl propionate (mPEG-SPA). In other preferred embodiments, the linker or spacer reactive group contains a carboxyl group capable of being activated to form a covalent bond with an amine-containing PEG molecule under suitable reaction conditions. Suitable PEG molecules include mPEG-NH.sub.2 and suitable reaction conditions include carbodiimide-mediated amide formation or the like.
[0126] The peptides of the invention may be prepared by classical methods known in the art. These standard methods include exclusive solid phase synthesis, automated solid phase synthesis, partial solid phase synthesis methods, fragment condensation, classical solution synthesis, and recombinant DNA technology (See, e.g., Merrifield J. Am. Chem. Soc. 1963 85:2149 and Merrifield et al., 1982, Biochemistry, 21:502).
[0127] A preferred method for peptide synthesis is solid phase synthesis. Solid phase peptide synthesis procedures are well-known in the art (see, e.g., Stewart, Solid Phase Peptide Syntheses, Freeman and Co.: San Francisco, 1969; 2002/2003 General Catalog from Novabiochem Corp, San Diego, USA; Goodman, Synthesis of Peptides and Peptidomimetics, Houben-Weyl, Stuttgart 2002). In solid phase synthesis, synthesis is typically commenced from the C-terminal end of the peptide using an -amino protected resin. A suitable starting material can be prepared, for instance, by attaching the required -amino acid to a chloromethylated resin, a hydroxymethyl resin, a polystyrene resin, a benzhydrylamine resin, or the like. One such chloromethylated resin is sold under the trade name BIO-BEADS SX-1 by Bio Rad Laboratories (Richmond, Calif.). The preparation of the hydroxymethyl resin has been described (Bodonszky, et al. (1966) Chem. Ind. London 38:1597). The benzhydrylamine (BHA) resin has been described (Pietta and Marshall, 1970, Chem. Commun., 650), and the hydrochloride form is commercially available from Beckman Instruments, Inc. (Palo Alto, Calif.). For example, an -amino protected amino acid may be coupled to a chloromethylated resin with the aid of a cesium bicarbonate catalyst, according to the method described by Gisin (1973, Helv. Chim. Acta 56:1467).
[0128] After initial coupling, the -amino protecting group is removed, for example, using trifluoroacetic acid (TFA) or hydrochloric acid (HCl) solutions in organic solvents at room temperature. Thereafter, -amino protected amino acids are successively coupled to a growing support-bound peptide chain. The -amino protecting groups are those known to be useful in the art of stepwise synthesis of peptides, including: acyl-type protecting groups (e.g., formyl, trifluoroacetyl, acetyl), aromatic urethane-type protecting groups [e.g., benzyloxycarboyl (Cbz) and substituted Cbz], aliphatic urethane protecting groups [e.g., t-butyloxycarbonyl (Boc), isopropyloxycarbonyl, cyclohexyloxycarbonyl], and alkyl type protecting groups (e.g., benzyl, triphenylmethyl), fluorenylmethyl oxycarbonyl (Fmoc), allyloxycarbonyl (Alloc), and 1-(4,4-dimethyl-2, 6-dioxocyclohex-1-ylidene)ethyl (Dde).
[0129] The side chain protecting groups (typically ethers, esters, trityl, PMC (2,2,5,7,8-pentamethyl-chroman-6-sulphonyl), and the like) remain intact during coupling and is not split off during the deprotection of the amino-terminus protecting group or during coupling. The side chain protecting group must be removable upon the completion of the synthesis of the final peptide and under reaction conditions that will not alter the target peptide. The side chain protecting groups for Tyr include tetrahydropyranyl, tert-butyl, trityl, benzyl, Cbz, ZBrCbz, and 2,5-dichlorobenzyl. The side chain protecting groups for Asp include benzyl, 2,6-dichlorobenzyl, methyl, ethyl, and cyclohexyl. The side chain protecting groups for Thr and Ser include acetyl, benzoyl, trityl, tetrahydropyranyl, benzyl, 2,6-dichlorobenzyl, and Cbz. The side chain protecting groups for Arg include nitro, Tosyl (Tos), Cbz, adamantyloxycarbonyl mesitoylsulfonyl (Mts), 2,2,4,6,7-pentamethyldihydrobenzofurane-5-sulfonyl (Pbf), 4-methoxy-2,3,6-trimethyl-benzenesulfonyl (Mtr), or Boc. The side chain protecting groups for Lys include Cbz, 2-chlorobenzyloxycarbonyl (2-Cl-Cbz), 2-bromobenzyloxycarbonyl (2-Br-Cbz), Tos, or Boc.
[0130] After removal of the -amino protecting group, the remaining protected amino acids are coupled stepwise in the desired order. Each protected amino acid is generally reacted in about a 3-fold excess using an appropriate carboxyl group activator such as 2-(1H-benzotriazol-1-yl)-1,1,3,3 tetramethyluronium hexafluorophosphate (HBTU) or dicyclohexylcarbodimide (DCC) in solution, for example, in methylene chloride (CH.sub.2Cl.sub.2), N-methyl pyrrolidone, dimethyl formamide (DMF), or mixtures thereof.
[0131] After the desired amino acid sequence has been completed, the desired peptide is decoupled from the resin support by treatment with a reagent, such as trifluoroacetic acid (TFA) or hydrogen fluoride (HF), which not only cleaves the peptide from the resin, but also cleaves all remaining side chain protecting groups. When a chloromethylated resin is used, hydrogen fluoride treatment results in the formation of the free peptide acids. When the benzhydrylamine resin is used, hydrogen fluoride treatment results directly in the free peptide amide. Alternatively, when the chloromethylated resin is employed, the side chain protected peptide can be decoupled by treatment of the peptide resin with ammonia to give the desired side chain protected amide or with an alkylamine to give a side chain protected alkylamide or dialkylamide. Side chain protection is then removed in the usual fashion by treatment with hydrogen fluoride to give the free amides, alkylamides, or dialkylamides. In preparing the esters of the invention, the resins used to prepare the peptide acids are employed, and the side chain protected peptide is cleaved with base and the appropriate alcohol (e.g., methanol). Side chain protecting groups are then removed in the usual fashion by treatment with hydrogen fluoride to obtain the desired ester. The resultant peptide can be further purified using HPLC.
[0132] These procedures can also be used to synthesize peptides in which amino acids other than the 20 naturally occurring, genetically encoded amino acids are substituted at one, two, or more positions of any of the compounds of the invention. Synthetic amino acids that can be substituted into the peptides of the present invention include, but are not limited to, N-methyl, L-hydroxypropyl, L-3, 4-dihydroxyphenylalanyl, amino acids such as L- -hydroxylysyl and D- -methylalanyl, L--methylalanyl, amino acids, and isoquinolyl. D-amino acids and non-naturally occurring synthetic amino acids can also be incorporated into the peptides of the present invention.
[0133] In addition to chemical synthesis, the peptides of the present invention may be synthesized by employing recombinant DNA technology by expressing one or more polynucleotide comprising a peptide coding region. Thus, provided herein are isolated polynucleotides that encode the peptides of the present invention as well as recombinant vectors and host cells (both eukaryotic and prokaryotic) that have been genetically modified to express or overexpress the peptides of the present invention.
[0134] In one embodiment, the invention provides isolated polynucleotides (e.g., vectors) comprising nucleotide sequences encoding the peptides of the invention.
[0135] Expression may be achieved in any conventional expression system known in the art by isolating a DNA fragment encoding the peptide of interest and cloning into an expression vector.
[0136] Useful compounds of the present invention are not limited to peptides incorporating natural and/or non-natural amino acids. The invention also encompasses various peptidomimetics such as, e.g., peptoids (a class of peptidomimetics whose side chains are appended to the nitrogen atom of the peptide backbone, rather than to the -carbons). A number of non-peptide molecules having similar functional properties to the peptides of the invention can be developed to incorporate disparate chemical functional groups within a single molecule. These molecules are often referred to as scaffolding molecules, or scaffolds, since they can accommodate a wide range of chemical functionality and can be designed to present the chemical functional groups in a wide array of relative geometric orientations in space. Molecular scaffold systems include, but are not limited to, carbohydrates (see, e.g., Tamaruya et al., Angew Chem. Int. Ed. Engl., 2004, 43(21):2834-7), peptide nucleic acids (PNA's), (see, e.g., Peptide Nucleic Acids: Protocols and Applications, 2nd ed., Peter E. Nielsen, ed., Horizon Bioscience, 2004) and molecules not derived from biological precursors (see, e.g., Savinov and Austin, Org. Lett., 2002, 4(9):1419-22). The incorporation of this diverse a set of chemistries may require chemical protection of reactive functionality during synthesis. These techniques are well known in the art and can be found in references such as T. W. Green, P. G. M. Wuts, Protective Groups in Organic Synthesis, Wiley-Interscience, New York, 1999.
[0137] Peptides and their derivatives disclosed herein may be formulated as compositions together with a pharmaceutically acceptable carrier (such as an adjuvant or vehicle) and/or excipient, and/or diluents. Compositions of this invention may include pharmaceutically acceptable salts of the components therein. Pharmaceutically acceptable salts include the acid addition salts (formed with the free amino groups of the peptide) that are formed with inorganic acids such as, for example, hydrochloric or phosphoric acids, or such organic acids as acetic, tartaric, mandelic and the like. Salts formed with the free carboxyl groups can be derived from inorganic bases such as, for example, sodium, potassium, ammonium, calcium or ferric hydroxides, and such organic bases as isopropylamine, trimethylamine, 2-ethylamino ethanol, histidine, procaine and the like.
[0138] Pharmaceutically acceptable carriers are familiar to those skilled in the art and can include sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. Water or aqueous solution saline solutions and aqueous dextrose and glycerol solutions are preferably employed as carriers, particularly for injectable solutions. Suitable pharmaceutical carriers are described in Remington's Pharmaceutical Sciences by E. W. Martin. For compositions formulated as liquid solutions, acceptable carriers and diluents include saline and sterile water, and may optionally include antioxidants, buffers, bacteriostats, and other common additives. The compositions can also be formulated as pills, capsules, granules, or tablets which may contain, in addition to a peptide of this invention, diluents, dispersing and surface active agents, binders, and lubricants. Proper formulation is dependent upon the route of administration chosen.
[0139] The optimal therapeutically effective amount of a compound or composition of this invention may be determined experimentally, taking into consideration the exact mode of administration, the form in which the drug is administered, the indication toward which the administration is directed, the subject involved (e.g., body weight, health, age, sex, etc.), and the preference and experience of the physician or veterinarian in charge.
[0140] The efficacy of the peptides and compositions of this invention can be determined using the in vitro and in vivo assays described in the Examples section, below.
[0141] Following methodologies which are well-established in the art, effective doses and toxicity of the peptides and compositions of the present invention, which performed well in in vitro tests, can be determined in studies using small animal models (e.g., mice, rats or dogs) in which they have been found to be therapeutically effective and in which these drugs can be administered by the same route proposed for the human trials.
[0142] For any pharmaceutical composition used in the methods of the invention, dose-response curves derived from animal systems can be used to determine testing doses for administration to humans. In safety determinations for each composition, the dose and frequency of administration should meet or exceed those anticipated for use in any clinical trial.
[0143] As disclosed herein, the dose of the compound in the compositions of the present invention is determined to ensure that the dose administered continuously or intermittently will not exceed an amount determined after consideration of the results in test animals and the individual conditions of a patient. A specific dose naturally varies (and is ultimately decided according to the judgment of the practitioner and each patient's circumstances) depending on the dosage procedure, the conditions of a patient or a subject animal such as age, body weight, sex, sensitivity, feed, dosage period, drugs used in combination, seriousness of the disease, etc.
[0144] Toxicity and therapeutic efficacy of the compositions of the invention can be determined by standard pharmaceutical procedures in experimental animals, e.g., by determining the LD.sub.50 (the dose lethal to 50% of the population) and the ED.sub.50 (the dose therapeutically effective in 50% of the population). The dose ratio between therapeutic and toxic effects is the therapeutic index and it can be expressed as the ratio ED.sub.50/LD.sub.50.
[0145] All known peptide delivery methods can be used to deliver the peptides of the present invention to the target tissues. The specific type of delivery useful for a given peptide is determined by its specific size, flexibility, conformation, biochemical properties of constituent amino acids, and amino acid arrangement. Peptide composition also determines, in part, the degree of protein binding, enzymatic stability, cellular sequestration, uptake into non-target tissue, clearance rate, and affinity for protein carriers. Other aspects independent of peptide composition must also be considered, such as cerebral blood flow, diet, age, sex, species (for experimental studies), dosing route, and effects of existing pathological conditions.
[0146] The peptides and/or the pharmaceutical composition comprising the peptides of the invention can be administered to a subject (e.g., human or animal) in need via various administration routes, including, but not limited to, systemic administration, inhalation, topical, sublingual, oral, intranasal, and/or direct instillation (e.g, intratracheal instillation for lung treatment). Non-limiting examples of useful administration routes for the peptides and peptide-encoding vectors of the invention include, e.g., systemic (including tumor-targeted) administration, topical or local administration, administration to mucosal surfaces of mouth or bowel (e.g., by enema), and inhalation.
[0147] The peptides of the invention can be formulated for any suitable administration, with or without any pharmaceutically acceptable carrier, excipients, solvents, and/or solutions, and in certain proper dosage.
[0148] Examples of delivery methods useful for obtaining effective tissue delivery of the peptides of the invention (and effective passage through the blood-brain-barrier [BBB] in case of brain tissues), include, without limitation (reviewed, e.g., in Witt and Davis, AAPS Journal, 2006; 8(1): E76-E88):
(i) invasive procedures (e.g., direct injection [e.g., using an external pump or i.v. line], transient osmotic opening, shunts, and biodegradable implants);
(ii) pharmacologically-based approaches to increase the tissue delivery by chemical modification of the peptide molecule itself, or by the attachment or encapsulation of the peptide in a substance that increases permeability, stability, bioavailability, and/or receptor affinity; in addition, modification of a peptide structure and/or addition of constituents (e.g., lipophilicity enhancers, polymers, antibodies) may enhance local peptide concentration in the target tissue;
(iii) physiologic-based strategies which exploit various carrier mechanisms; these strategies can be combined, dependent of the nature of a given peptide, creating hybrid peptides, resulting in synergistic delivery and end-effect.
[0149] Specific examples of peptide modifications and methods useful for improving delivery of the peptides of the invention include, without limitation, lipidization (e.g., methylation, dimethylation, or halogenation of constituent amino acids or acylation or alkylation of the N-terminal amino acid), structural modification to enhance stability (e.g., use of D-amino acids, N-acylation, or cyclization, e.g., via a disulfide-bridge or via a hydrazide bridge), glycosylation (e.g., adding simple sugars such as, e.g., glucose or xylose), increasing affinity for nutrient transporters (e.g., adding hexose or large neutral amino acid carriers which facilitate delivery of substrates to the brain), forming a prodrug by conjugating a peptide to a molecule with a known transporter activity or to a lipophilicity enhancer, which is cleaved at or near the site of action (e.g., using esterification [with, e.g., aromatic benzoyl esters or branched chain tertiary butyl esters] or amidation of amino, hydroxyl, or carboxylic acid-containing peptides; also, redox system-mediated delivery to the brain may be facilitated using conjugation to a methyldihydropyridine carrier and subsequent oxidation by NADH-linked dehydrogenases in the brain, which results in a quaternary ammonium salt, which does not cross back through the BBB endothelium), vector-based delivery (e.g., by coupling a peptide to a substance that increases the affinity to and transport across biological membranes via receptor-mediated or absorptive-mediated endocytosis followed by peptide release via enzymatic cleavage [e.g., conjugation of a peptide to murine monoclonal antibody (OX26) to the transferrin or conjugation to cationized albumin to increase brain uptake]), cationization to increase membrane entry via absorptive-mediated endocytosis, and polymer conjugation/encapsulation (e.g., conjugation to poly(ethylene glycol) [PEG] or poly(styrene maleic acid) or encapsulation via micro- or nano-particles [e.g., polymeric nanoparticles ranging in size between 10 and 1000 nm, which have a polysorbate overcoating such as, e.g., polysorbate-80], liposomes [e.g., surface-modified long-circulating liposomes grafted with a flexible hydrophilic polymer such as, e.g., PEG and/or liposomes composed of a phospholipid bilayer such as, e.g., pluronic copolymer P85, that act as a carrier for both hydrophilic and hydrophobic peptides], micelles [e.g., stable polymeric micelles prepared from amphiphilic PEG-phospholipid conjugates], or cell ghosts). Reviewed in Torchilin and Lukyanov, D D T, 2003, 8(6): 259-266; Egleton and Davis, NeuroRx, 2005, 2: 44-53; Witt and Davis, AAPS Journal, 2006; 8(1): E76-E88.
[0150] Regardless of the delivery method used, an important aspect of the present invention is to keep the size of the resulting delivered peptide sufficiently small (e.g., by using cleavable conjugates).
[0151] Oral Delivery.
[0152] Contemplated for use herein are oral solid dosage forms, which are described generally in Remington's Pharmaceutical Sciences, 18th Ed. 1990 (Mack Publishing Co. Easton Pa. 18042) at Chapter 89, which is herein incorporated by reference. Solid dosage forms include tablets, capsules, pills, troches or lozenges, cachets, pellets, powders, or granules. Also, liposomal or proteinoid encapsulation may be used to formulate the present compositions (as, for example, proteinoid microspheres reported in U.S. Pat. No. 4,925,673). Liposomal encapsulation may be used and the liposomes may be derivatized with various polymers (e.g., U.S. Pat. No. 5,013,556). A description of possible solid dosage forms for the therapeutic is given by Marshall, K. In: Modern Pharmaceutics Edited by G. S. Banker and C. T. Rhodes Chapter 10, 1979, herein incorporated by reference. In general, the formulation will include a peptide of the invention (or chemically modified forms thereof) and inert ingredients which allow for protection against the stomach environment, and release of the biologically active material in the intestine.
[0153] Also contemplated for use herein are liquid dosage forms for oral administration, including pharmaceutically acceptable emulsions, solutions, suspensions, and syrups, which may contain other components including inert diluents; adjuvants such as wetting agents, emulsifying and suspending agents; and sweetening, flavoring, and perfuming agents.
[0154] As discussed above, the peptides may be chemically modified so that oral delivery of the derivative is efficacious. Generally, the chemical modification contemplated is the attachment of at least one moiety to the component molecule itself, where said moiety permits (a) increase in peptide stability (e.g., by inhibition of proteolysis) and (b) efficient uptake into the blood stream from the stomach or intestine. As discussed above, common delivery-improving peptide modifications include PEGylation or the addition of moieties such as propylene glycol, copolymers of ethylene glycol and propylene glycol, carboxymethyl cellulose, dextran, polyvinyl alcohol, polyvinyl pyrrolidone, polyproline, poly-1,3-dioxolane and poly-1,3,6-tioxocane (see, e.g., Abuchowski and Davis (1981) Soluble Polymer-Enzyme Adducts, in Enzymes as Drugs. Hocenberg and Roberts, eds. (Wiley-Interscience: New York, N.Y.) pp. 367-383; and Newmark, et al. (1982) J. Appl. Biochem. 4:185-189).
[0155] For oral formulations, the location of release may be the stomach, the small intestine (the duodenum, the jejunum, or the ileum), or the large intestine. One skilled in the art has available formulations which will not dissolve in the stomach, yet will release the material in the duodenum or elsewhere in the intestine. Preferably, the release will avoid the deleterious effects of the stomach environment, either by protection of the peptide (or derivative) or by release of the peptide (or derivative) beyond the stomach environment, such as in the intestine.
[0156] To ensure full gastric resistance a coating impermeable to at least pH 5.0 is essential. Examples of the more common inert ingredients that are used as enteric coatings are cellulose acetate trimellitate (CAT), hydroxypropylmethylcellulose phthalate (HPMCP), HPMCP 50, HPMCP 55, polyvinyl acetate phthalate (PVAP), Eudragit L30D, Aquateric, cellulose acetate phthalate (CAP), Eudragit L, Eudragit S, and Shellac. These coatings may be used as mixed films.
[0157] A coating or mixture of coatings can also be used on tablets, which are not intended for protection against the stomach. This can include sugar coatings, or coatings which make the tablet easier to swallow. Capsules may consist of a hard shell (such as gelatin) for delivery of dry therapeutic (i.e. powder), for liquid forms a soft gelatin shell may be used. The shell material of cachets could be thick starch or other edible paper. For pills, lozenges, molded tablets or tablet triturates, moist massing techniques can be used.
[0158] The peptide (or derivative) can be included in the formulation as fine multiparticulates in the form of granules or pellets of particle size about 1 mm. The formulation of the material for capsule administration could also be as a powder, lightly compressed plugs, or even as tablets. These therapeutics could be prepared by compression.
[0159] Colorants and/or flavoring agents may also be included. For example, the peptide (or derivative) may be formulated (such as by liposome or microsphere encapsulation) and then further contained within an edible product, such as a refrigerated beverage containing colorants and flavoring agents.
[0160] One may dilute or increase the volume of the peptide (or derivative) with an inert material. These diluents could include carbohydrates, especially mannitol, lactose, anhydrous lactose, cellulose, sucrose, modified dextrans and starch. Certain inorganic salts may be also be used as fillers including calcium triphosphate, magnesium carbonate and sodium chloride. Some commercially available diluents are Fast-Flo, Emdex, STA-Rx 1500, Emcompress, and Avicel.
[0161] Disintegrants may be included in the formulation of the therapeutic into a solid dosage form. Materials used as disintegrates include but are not limited to starch, including the commercial disintegrant based on starch, Explotab. Sodium starch glycolate, Amberlite, sodium carboxymethylcellulose, ultramylopectin, sodium alginate, gelatin, orange peel, acid carboxymethyl cellulose, natural sponge and bentonite may all be used. The disintegrants may also be insoluble cationic exchange resins. Powdered gums may be used as disintegrants and as binders. and can include powdered gums such as agar, Karaya or tragacanth. Alginic acid and its sodium salt are also useful as disintegrants.
[0162] Binders may be used to hold the peptide (or derivative) agent together to form a hard tablet and include materials from natural products such as acacia, tragacanth, starch and gelatin. Others include methyl cellulose (MC), ethyl cellulose (EC) and carboxymethyl cellulose (CMC). Polyvinyl pyrrolidone (PVP) and hydroxypropylmethyl cellulose (HPMC) could both be used in alcoholic solutions to granulate the peptide (or derivative).
[0163] An antifrictional agent may be included in the formulation of the peptide (or derivative) to prevent sticking during the formulation process. Lubricants may be used as a layer between the peptide (or derivative) and the die wall, and these can include but are not limited to; stearic acid including its magnesium and calcium salts, polytetrafluoroethylene (PTFE), liquid paraffin, vegetable oils and waxes. Soluble lubricants may also be used such as sodium lauryl sulfate, magnesium lauryl sulfate, polyethylene glycol of various molecular weights, Carbowax 4000 and 6000.
[0164] Glidants that might improve the flow properties of the drug during formulation and to aid rearrangement during compression might be added. The glidants may include starch, talc, pyrogenic silica and hydrated silicoaluminate.
[0165] To aid dissolution of the peptide (or derivative) into the aqueous environment a surfactant might be added as a wetting agent. Surfactants may include anionic detergents such as sodium lauryl sulfate, dioctyl sodium sulfosuccinate and dioctyl sodium sulfonate. Cationic detergents might be used and could include benzalkonium chloride or benzethomium chloride. The list of potential nonionic detergents that could be included in the formulation as surfactants are lauromacrogol 400, polyoxyl 40 stearate, polyoxyethylene hydrogenated castor oil 10, 50 and 60, glycerol monostearate, polysorbate 20, 40, 60, 65 and 80, sucrose fatty acid ester, methyl cellulose and carboxymethyl cellulose. These surfactants could be present in the formulation of the protein or derivative either alone or as a mixture in different ratios.
[0166] Additives which potentially enhance uptake of the peptide (or derivative) are for instance the fatty acids oleic acid, linoleic acid and linolenic acid.
[0167] Controlled release oral formulations may be desirable. The peptide (or derivative) could be incorporated into an inert matrix which permits release by either diffusion or leaching mechanisms, e.g., gums. Slowly degenerating matrices may also be incorporated into the formulation. Some enteric coatings also have a delayed release effect. Another form of a controlled release is by a method based on the Oros therapeutic system (Alza Corp.), i.e. the drug is enclosed in a semipermeable membrane which allows water to enter and push drug out through a single small opening due to osmotic effects.
[0168] Other coatings may be used for the formulation. These include a variety of sugars which could be applied in a coating pan. The peptide (or derivative) could also be given in a film coated tablet and the materials used in this instance are divided into 2 groups. The first are the nonenteric materials and include methyl cellulose, ethyl cellulose, hydroxyethyl cellulose, methylhydroxy-ethyl cellulose, hydroxypropyl cellulose, hydroxypropyl-methyl cellulose, sodium carboxy-methyl cellulose, providone and the polyethylene glycols. The second group consists of the enteric materials that are commonly esters of phthalic acid.
[0169] A mix of materials might be used to provide the optimum film coating. Film coating may be carried out in a pan coater or in a fluidized bed or by compression coating.
[0170] Parenteral Delivery.
[0171] Preparations according to this invention for parenteral administration include sterile aqueous or non-aqueous solutions, suspensions, or emulsions. Examples of non-aqueous solvents or vehicles are propylene glycol, polyethylene glycol, vegetable oils, such as olive oil and corn oil, gelatin, and injectable organic esters such as ethyl oleate. Such dosage forms may also contain adjuvants such as preserving, wetting, emulsifying, and dispersing agents. They may be sterilized by, for example, filtration through a bacteria retaining filter, by incorporating sterilizing agents into the compositions, by irradiating the compositions, or by heating the compositions. They can also be manufactured using sterile water, or some other sterile injectable medium, immediately before use.
[0172] Administration by Inhalation and Intranasal Administration.
[0173] The present invention encompasses any delivery device that is suitable for administration by inhalation or intranasal administration of the compositions of the invention. Preferably, such means administers a metered dosage of the composition. The composition of the present invention may be packed in any appropriate form or container as long as a means is provided to deliver the composition to the oral or lung or nasal mucosa. Non-limiting examples of useful delivery devices include, e.g., instillation catheters, droppers, unit-dose containers, squeeze bottles pump sprays, airless and preservative-fee sprays, compressed air nebulizers, metered-dose inhalers, insufflators and pressurized metered dose inhalers. For administration of a liquid in drop form, compositions of the invention can be placed in a container provided with a conventional dropper/closure device, e.g. comprising a pipette or the like, preferably delivering a substantially fixed volume of composition/drop. For administration of an aqueous solution as a spray, the aqueous solution may be dispensed in spray form by a variety of methods known to those skilled in the art. For example, such compositions will be put up in an appropriate atomising device, e.g. in a pump-atomiser, or the like. The atomising device will be provided with appropriate means, such as a spray adaptor for delivery of the aqueous spray to the naris. Preferably it will be provided with means ensuring delivery of a substantially fixed volume of composition/actuation (i.e. per spray-unit). Examples of nasal sprays include nasal actuators produced by Ing. Erich Pfeiffer GmbH, Radolfzell, Germany (see U.S. Pat. No. 4,511,069, U.S. Pat. No. 4,778,810, U.S. Pat. No. 5,203,840, U.S. Pat. No. 5,860,567, U.S. Pat. No. 5,893,484, U.S. Pat. No. 6,227,415, and U.S. Pat. No. 6,364,166. Additional aerosol delivery forms may include, e.g., compressed air-, jet-, ultrasonic-, and piezoelectric nebulizers. Alternatively the spray may be bottled under pressure in an aerosol device. The propellant may be a gas or a liquid (e.g. a fluorinated and/or chlorinated hydrocarbon). The spray composition may be suspended or dissolved in a liquid propellant. Stabilizing and/or suspending agents and/or co-solvents may be present. A dry powder may be readily dispersed in an inhalation device as described in U.S. Pat. No. 6,514,496 and Garcia-Arieta et al., Biol. Pharm. Bull. 2001; 24: 1411-1416. If desired a powder or liquid may be filled into a soft or hard capsule or in a single dose device adapted for nasal administration. The powder may be sieved before filled into the capsules such as gelatine capsules. The delivery device may have means to break open the capsule. The powdery nasal composition can be directly used as a powder for a unit dosage form. The contents of the capsule or single dose device may be administered using e.g. an insufflator. Preferably it will be provided with means ensuring dosing of a substantially fixed amount of composition.
[0174] In another embodiment, the composition of the invention can be provided as a nasal insert having the peptide(s) of the invention. The insert may be retained in the naris, but flushed by the nasal mucus, and may be designed to release the Peptide, fragment or derivative of the invention at the same place in the naris. Suitable nasal insert types include nasal plugs, tampons and the like. Further examples of nasal inserts, their characteristics and preparation are described in EP 490806.
[0175] Delivery devices are important not only for delivering the peptides of the invention, but also for providing an appropriate environment for storage. This would include protection from microbial contamination and chemical degradation. The device and formulation should be compatible so as to avoid potential leaching or adsorption. The delivery device (or its packaging) can be optionally provided with a label and/or with instructions for use.
[0176] The peptides of the invention can be administered using any standard administration route and technique known in the art. The peptides can also be delivered using a vector (such as a viral vector) with the ability to express a peptide of this invention.
The Therapeutic Target and its Potential Clinical Relevance
[0177] The invention further defines activation of Gi by GIV's GEF function as a central node that coordinately enhances the physiologic insulin response and its deregulation herald insulin resistance (IR). Because this node also serves as the point of convergence for the antagonistic actions of fatty acids and insulin sensitizers, selective modulation of this node emerges as a promising and precise strategy to treat T2DM and other conditions where IR plays a central pathophysiologic role.
[0178] In certain embodiments, the invention provides that activation of Gi by GIV-GEF is required for glucose uptake in skeletal muscles, and cell permeant GIV-derived peptides can effectively reserve insulin resistance in skeletal muscle. In other embodiments, the invention provides that GIV binds ligand activated InsR kinase activity and autophosphorylation, and modulates multiple tiers of metabolic insulin signaling via its GEF function. In yet other embodiments, the invention provides that GIV directly binds and modulates the localization and functional phosphorylation of IRS1. In certain embodiments, the invention provides that GIV provides the necessary molecular basis for IRS1 to serve as a common conduit for metabolic response downstream of receptors other than InsR. Further, the invention provides that GIV enhances tyrosine phosphorylation of IRS1, maximizes PM-recruitment, and coordinates membrane trafficking within the insulin response cascade.
[0179] In certain embodiments, the invention provides that phosphorylation of GIV-GEF motif at S1689 position by PKC triggers lipid-induced insulin resistance, and TZDs, like piloglitazone, release the phosphoinhibition on GIV-GEF, suggesting that reversible phosphorylation of GIV-GEF at S1689 and inhibition of the GEF function via which GIV activates Gi, serves as a molecular switch for flipping skeletal muscles between insulin-sensitive and resistant states. In yet other embodiments, the invention provides that GIV-GEF is a target for the antagonist actions of fatty acids and insulin sensitizers. Since many of GIV's modules, not just its C-terminal GEF motif may play a role in integrating signaling events with vesicular trafficking and cytoskeletal changes to orchestrate glucose uptake after insulin simulation, selective modulation of GIV-GEF emerges as a therapeutic strategy for reversal of IR.
[0180] Various publications, including patents, published applications, technical articles and scholarly articles are cited throughout the specification. Each of these cited publications is incorporated by reference herein, in its entirety.
[0181] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which the invention pertains. Other specifically defined terms are to be construed in a manner consistent with the definition provided herein. Although any methods and materials similar or equivalent to those described herein can be used in the practice for testing of the present invention, the preferred materials and methods are described herein. In describing and claiming the present invention, the following terminology will be used.
[0182] Other embodiments and uses are apparent to one skilled in the art in light of the present disclosures. Those skilled in the art will appreciate that numerous changes and modifications can be made to the embodiments of the invention and that such changes and modifications can be made without departing from the spirit of the invention. It is, therefore, intended that the appended claims cover all such equivalent variations as fall within the true spirit and scope of the invention.
[0183] Throughout the specification various citations are referenced, and the entire content of each is hereby incorporated by reference. The following example is provided to describe the invention in more detail. It is intended to illustrate, not to limit the invention.
EXAMPLES
Example 1
Therapeutic Effects of Cell-Permeant Peptides that Activate G Proteins Downstream of Growth Factors
[0184] This example provides cell-permeable GIV-CT peptides and their effects to activate G proteins downstream of growth factor. Here, cell-permeable GIV-CT peptides were developed by fusing a TAT-peptide transduction domain (TAT-PTD) to the minimal modular elements of GIV that are necessary and sufficient for activation of Gi downstream of RTKs, and used them to engineer signaling networks and alter cell behavior. In the presence of an intact GEF motif, TAT-GIV-CT peptides enhanced diverse processes in which GIV's GEF function has previously been implicated; e.g., 2D cell migration after scratch-wounding, invasion of cancer cells, myofibroblast activation and collagen production and finally, metabolic insulin response in skeletal muscles. Furthermore, topical application of TAT-GIV-CT peptides enhanced wound repair in mice in a GEF-dependent manner. Thus, TAT-GIV peptides provide a novel and versatile tool to manipulate Gi activation downstream of growth factors in a diverse array of pathophysiologic conditions.
Experimental Procedures
[0185] Reagents and Antibodies.
[0186] Unless otherwise indicated, all reagents were of analytical grade and obtained from Sigma-Aldrich. Cell culture media were purchased from Invitrogen. Epidermal growth factor (EGF), insulin was purchased from Invitrogen and Novagen, respectively. All restriction endonucleases and Escherichia coli strain DH5 were purchased from New England Biolabs. E. coli BL21 (DE3 strain) and phalloidin-Texas Red were purchased from Invitrogen. DAPI was purchased from Molecular Probes (Invitrogen). PfuUltra DNA polymerase was purchased from Stratagene. Goat anti-rabbit and goat anti-mouse Alexa Fluor 680 or IRDye 800 F(ab)2 used for Odyssey Infrared Imaging were from Li-Cor Biosciences. Mouse mAbs against hexahistidine (His) and -tubulin were obtained from Sigma-Aldrich. Rabbit anti-GIV-CT (T-13) was from Santa Cruz Biotechnology, and phospho-Akt (S473), phosphor SMAD2/3 and phosphoEGFR (Y1068) were from Cell Signaling. Rabbit anti-PKC was obtained from GeneTex.
[0187] Plasmid Constructs, Mutagenesis, and Protein Expression.
[0188] Cloning of TAT-GIV-CT was carried out by amplifying a short flexible linker (
[0189] Lentiviral vectors for Cre-inducible stable depletion of GIV in HeLa cells lines were designed as follows. First, shRNA targets for GIV in its 3 UTR were identified using the pSicoOligomaker 1.5 software. Hairpin loops were cloned containing a sequence (hGIVsh GGAATGTACTATATAGCAA, SEQ ID NO: 15; GenBank Accession No. BAE44387.1, AB201172.1; Entrez Gene: CCDC88A) against human GIV into the pSico-PGK-puro vector. The numbers in parenthesis indicate the nucleotide positions in the mRNA of GIV (GenBank Accession no. AB201172.1). Cloning of control shLUC viruses (targeting luciferase) have been described (47).
[0190] TAT-constructs were expressed using BL21(DE3)-pLysS (Invitrogen) and Terrific Broth (BioPioneer) supplemented with additives as per auto-induction protocols outlined by Studier F (48). Briefly, cultures of bacteria were grown at 300 rpm at 37 C. for 5 h, then at 25 C. overnight. Cells were lysed in 10 mL of buffer [20 mM Tris, 10 mM Imidazole, 400 mM NaCl, 1% (vol:vol) Sarkosyl, 1% (vol:vol) Triton X-100, 2 mM DTT, 2 mM Na3oV4 and protease inhibitor mixture (Roche Diagnostics) (pH 7.4)], sonicated (3 30 s), cleared at 12,000 g for 20 min at 4 C. and affinity-purified on Ni-NTA agarose resin (Qiagen) (4 h at 4 C.). Proteins were eluted in elution buffer [20 mM Tris, 300 mM Imidazole, 400 mM NaCl, pH 7.4], dialyzed overnight against TBS containing 400 mM NaCl and stored at 80 C.
[0191] GST and GST-Gi3 fusion constructs were expressed in E. coli strain BL21(DE3) (Invitrogen) and purified as described previously (44, 49, 50). Briefly, bacterial cultures were induced overnight at 25 C. with 1 mM isopropyl -D-1-thiogalactopyranoside (IPTG). Pelleted bacteria from 1 L of culture were resuspended in 10 mL GST-lysis buffer [25 mM Tris-HCl, pH 7.5, 20 mM NaCl, 1 mM EDTA, 20% (vol:vol) glycerol, 1% (vol:vol) Triton X-100, 2protease inhibitor mixture (Complete EDTA-free, Roche Diagnostics)] or His-lysis buffer [50 mM NaH2PO4 pH 7.4, 300 mM NaCl, 10 mM imidazole, 1% (vol:vol) Triton X-100, 2 protease inhibitor mixture (Complete EDTA-free, Roche Diagnostics)] for GST or His-fused proteins, respectively. After sonication (420 s, 1 min between cycles), lysates were centrifuged at 12,000 g at 4 C. for 20 min. Solubilized proteins were affinity purified on glutathione-Sepharose 4B beads (GE Healthcare) or HisPur Cobalt Resin (Pierce). Proteins were eluted, dialyzed overnight against PBS and stored at 80 C.
[0192] Cell Culture, Lysis, and Quantitative Immunoblotting.
[0193] HeLa and MDA MB231 cells were cultured according to ATCC guidelines in the presence of DMEM supplemented with 10% FBS and antibiotics. The L2 human hepatic stellate cell line was obtained from Scott Friedman (Mount Sinai, N.Y.) and were cultured in DMEM media containing 2% FBS according to previously published guidelines (51). Unless otherwise indicated, for assays involving serum starvation, serum concentration was reduced to 0.2% overnight for HeLa cells and 0% for L2 cells. Whole-cell lysates were prepared after washing cells with PBS before resuspending cells in lysis buffer [20 mM Hepes, pH 7.2, 5 mM Mg acetate, 125 mM K-acetate, 0.4% Triton X-100, 1 mM DTT, supplemented with sodium orthovanadate (500 M), phosphatase (Sigma) and protease (Roche) inhibitor mixtures], and boiling them in sample buffer.
[0194] For immunoblotting, protein samples were separated by SDS/PAGE and transferred to PVDF membranes (Millipore). Membranes were blocked with PBS supplemented with 5% nonfat milk (or with 5% BSA when probing for phosphorylated proteins) before incubation with primary antibodies. Infrared imaging with two-color detection and quantification were performed using a Li-Cor Odyssey imaging system (50, 52, 53). Primary antibodies were diluted as follows: anti-His 1:1,000; anti-GIV/Girdin (T-13) 1:500; antiphospho EGFR 1068 (1:1000); anti-phospho-Akt (Ser473) 1:250; anti-Akt 1:500; anti-Gi3 1:333; anti-pan-GP 1:250; anti- tubulin 1: 2,000. All Odyssey images were processed using Image J software (NIH) and assembled for presentation using Photoshop and Illustrator software (Adobe).
[0195] Lentivirus Production and Generation of HeLa Cells Stably Depleted of GIV.
[0196] The lentiviral packaging plasmid psPAX2 and envelope plasmid pMD2G were obtained from University of California (San Diego). To prepare virus stocks, 293T cells were cotransfected with shRNA LUC (luciferase) or GIV constructs (10.5 g), together with pCMV-VSVG envelope (3.8 g), pMDLgp-RRE (7 g) and pRSV-Rev (2.6 g) constructs, using Calcium Phosphate transfection mix [2 M CaCl2, 2 Hepes Buffered Saline: 280 mM NaCl, 50 mM Hepes, 1.5 mM Na2HPO4, pH 7.05]. The media was changed after 24 h, and virus-containing medium was collected after 36-48 h. The viral stocks were centrifuged and filtered through a 0.45-m filter to remove any nonadherent 293T cells. Young passages of HeLa cells were infected with a mixture of 0.5 mL of shRNA lentivirus-containing medium and 0.5 mL DMEM with 10% FBS. The medium was changed 24 h postinfection and replaced with fresh DMEM. Selection of stable cells was initiated at 48 h with 2.5 g/mL Puromycin (Invitrogen). Pooled stable cells were subsequently maintained in complete media supplemented with 2.5 g/mL Puromycin. AdCre, Crerecombinase expressing adenovirus (commercially obtained from the Transfer Vector Core at the University of Iowa) was used to trigger GIV depletion 48-72 h before using the cells for experiments.
[0197] Immunofluorescence.
[0198] HeLa cell lines were fixed at room temperature with 3% paraformaldehyde for 20-25 min, permeabilized (0.2% Triton X-100) for 45 min and incubated for 1 h each with primary and then secondary antibodies as described (7). Dilutions of antibodies and reagents were as follows: His (1:500); Phalloidin (1:1,000); DAPI (1: 2,000); secondary goat anti-rabbit (594) and goat anti-mouse (488) Alexa-conjugated antibodies (1:500). Coverslips were mounted with ProLong Gold (Life Technologies). Cells were imaged on a Leica SPE confocal microscope using a 63 oil objective using 488, 561, and 405 laser lines for excitation. Images were scanned using a line-average of 3. All images were processed using ImageJ software and assembled into figure panels using Photoshop and Illustrator (Adobe).
[0199] In Vitro GST Pulldown Assays.
[0200] Purified GST-Gi3 or GST alone (5 g) were immobilized on glutathione-Sepharose beads and incubated with binding buffer [50 mM Tris-HCl (pH 7.4), 100 mM NaCl, 0.4% (vol:vol) Nonidet P-40, 10 mM MgCl2, 5 mM EDTA, 30 M GDP, 2 mM DTT, protease inhibitor mixture] for 90 min at room temperature as described (49, 50, 52, 54). TAT-GIV-CT (amino acids 1,660-1,870) proteins (3 g) were added to each tube, and binding reactions were carried out for 4 h at 4 C. with constant tumbling. Beads were washed (four times) with 1 mL of wash buffer [4.3 mM Na2HPO4, 1.4 mM KH2PO4 (pH 7.4), 137 mM NaCl, 2.7 mM KCl, 0.1% (vol:vol) Tween 20, 10 mM MgCl2, 5 mM EDTA, 30 M GDP, 2 mM DTT] and reduced in Laemmli's sample buffer at 37 C. Immunoblot analysis was performed by infrared imaging following the manufacturer's protocols using an Odyssey imaging system (Li-Cor Biosciences).
[0201] Fret Studies.
[0202] HeLa cells stably depleted of GIV by shRNA were grown to 60-70% confluence in sterile 35 mm MatTek glass bottom dishes. One microgram each of various donor and acceptor plasmid constructs were transfected with Trans-IT-LT1 transfection reagent (Minis Bio LLC) using manufacturer's protocol. Cells were starved overnight in serum-free DMEM (Gibco), transduced the following morning with TAT proteins for 30 min, washed with PBS and subsequently the media was switched to DMEM without phenol red before live cell imaging. EGF stimulation was carried out 4 h after TAT transduction. Fluorescence microscopy studies were conducted on single cells in mesoscopic regime to avoid inhomogeneities from samples as previously rationalized by Midde et al. (55-57). Olympus FV1000 inverted confocal laser scanning microscope was used for live cell FRET imaging (UCSD-Neuroscience core facility). The microscope is stabilized on a vibration proof platform, caged in temperature controlled (37 C.) and CO2 (5%) supplemented chamber. A 601.49 N. An oil immersed objective designed to minimize chromatic aberration and enhance resolution for 405-605 nm imaging was used. Olympus Fluoview inbuilt software was used for data acquisition through the method of sensitized emission. A 405 nm laser diode was used to excite ECFP and 515 nm Argon-ion laser was used to excite EYFP. The bandwidth of spectral emission was adjusted through grating to minimize bleed through. Enhanced CFP emission was collected from 425 to 500 nm and EYFP emission was collected through 535-600 nm and passed through a 50 nm confocal pinhole before being sent to photomultiplier tube to reject out of plane focused light. Every field of view is imaged sequentially through ECFPex/ECFPem, ECFPex/EYFPem and EYFPex/EYFPem (3 excitation and emission combinations) and saved as donor, transfer and acceptor image files through an inbuilt wizard.
[0203] To obtain the FRET images and efficiency of energy transfer values a RiFRET plugin in Image J software was used (58). FRET images were obtained by pixel-by-pixel ratiometric intensity method and efficiency of transfer was calculated by the ratio of intensity in transfer channel to the quenched (corrected) intensity in the donor channel. Cells transfected with CFP and YFP alone were imaged under all three previously mentioned excitation and emission combinations and are used to correct for cross-talk. Furthermore, untransfected cells and a field of view without cells were imaged to correct for background, autofluorescence and light scattering. Cells chosen for imaging were ensured for identical expression of donor and acceptor probes by the photons collected in individual channels.
[0204] Cell Migration and Invasion Assays.
[0205] Scratch-wound assays were done as described (49). Briefly, monolayer cultures (100% confluent) of HeLa cells were incubated first in a 0.2% serum media over night. The following morning, monolayers of HeLa cells were first transduced with TAT peptides for 30 min, then washed three times with PBS and placed again in a 0.2% serum media for 1 h 30 min before scratch-wounding. The wounds were created using a 20 L pipette tip. Transduction with TAT peptides was repeated at 12 h into the wound healing assay (a total of two times). Healing wounds were monitored by phase-contrast microscopy over the next 24 h and serially photographed using a Canon digital SLR camera. To quantify cell migration (expressed as percent of wound closure) the acquired images were analyzed using Image J software to measure open wound area. Results were expressed as % closure by calculating the difference between the wound area at 0 h, 12 h and that at 24 h divided by the area at 0 h100. Invasion assays were performed using Corning Transwell plates according to the manufacturer's protocol.
[0206] Briefly, after a serum starvation overnight, MDA MB231 cells were first transduced with TAT peptides for 30 min as above. Transduced cells were trypsinized, counted, and placed in a Corning transwell permeable support coated with Cultrex Basement Membrane Extract (710.sup.4 cells per well). Media without FBS but containing EGF ligand (50 nM) was placed within the bottom chamber of each well to trigger directional 3D invasion. As done in the 2D migration assays, transduction with TAT peptides was repeated one more time 10-12 h into the assay (total of two times). At 22-24 h, a Q-tip was used to meticulously remove all cells from the surface of the permeable membrane facing the upper chamber. Cells that had successfully invaded to the side of the permeable membrane facing the bottom chamber were visualized by staining the membrane with crystal violet. To quantify cell invasion (expressed as number of invasive cells/high power field) 10-12 random fields per membrane insert per condition were analyzed for number of crystal violet stained cells. Assays were repeated four times.
[0207] RNA Isolation and Quantitative PCR.
[0208] For measurement of collagen and SMA mRNA levels in L2 HSCs we followed the protocols exactly as before (59). Briefly, total RNA was isolated using an RNeasy kit (QIAGEN) as per the manufacturer's protocol. First-strand cDNA was synthesized using SuperScript II reverse transcriptase (Invitrogen), followed by ribonuclease H treatment (Invitrogen) before performing quantitative realtime PCR. Reactions omitting reverse transcriptase were performed in each experiment as negative controls. Reactions were then run on a real-time PCR system (ABI StepOnePlus; Applied Biosystems). Gene expression was detected with SYBR green (Invitrogen), and relative gene expression was determined by normalizing to GAPDH using the .sub.T method. The sequences of primers used in this work are identical to what were used previously (59).
[0209] Dermal Wound Healing in Mice.
[0210] Under general anesthesia, two 6-mm diameter punch biopsy wounds were created on the shaved dorsal surface of 8 wk old female C56BL/6 wild-type mice under sterile conditions. Wounds were then treated with 15 g (500 pmol) of TAT proteins every 24 h for 8 d after injury, and photographed every 48 h over that period, and wound area was manually traced by placing a transparent film over the wound and tracing the outline with a permanent marker. To measure the wound area, the edges of the dermis were determined as the wound edge. This method has been shown to be superior in estimating healing rates of irregular wounds (60). The tracing was then scanned and measured using an image analysis program (NIH Image J Software). Five mice, each with 2 wounds (a total of 10 wounds) were studied in each treatment arm, and their rate of closure was analyzed. These studies were carried out in a blinded manner such that aliquots of purified TAT proteins were prepared and color coded before their arrival at the animal facility. Consequently, the personnel who performed dermal punch biopsies, daily treatment with TAT proteins, photography and measurement of wound area was blinded to the identity of the compound. The study protocol (
[0211] TAT-Protein Expression and Purification.
[0212] Cloning of TAT-GIV-CT was carried out by amplifying a short flexible linker (see
[0213] TAT Protein Transduction.
[0214] For TAT-protein transduction, cells were incubated with 400-800 nM of the TAT-proteins for 30 min at 37 C. prior to three washes with PBS and addition of fresh growth media. For analysis of EGF signaling, subconfluent monolayers of HeLa cells were treated with TAT proteins for 30 min, washed with PBS, and subsequently stimulated with EGF (50 nM) at 4 h after TAT transduction. For scratch-wound assays, HeLa monolayers were treated with TAT proteins before and at 12 h after wounding. For cancer cell invasion assays, highly invasive MDA MB 231 breast cancer cells were plated in 6-well dishes, treated with TAT-peptides for 30 min and subsequently lifted and placed in transwell chamber in the presence of serum-free media. For L2 myofibroblast activation assays, cells were first treated with TAT-proteins for 30 min, starved in serum-free media, and subsequently treated with 1.5 ng/ml TGF- for 24 h. TAT-protein transduction was repeated every 8 h during the course of TGF stimulation (total 3 treatments). For assays involving insulin stimulation of TAT-treated L6 myotubes, such stimulation was carried out 90 min after transduction. In each case, whole cell lysates prepared from cells in duplicate wells were analyzed for signaling pathways and TAT-protein uptake by immunoblotting.
[0215] Scratch-Wounding and Migration Index.
[0216] Scratch-wound assays were done as described previously (13). Briefly, monolayer cultures (100% confluent) of HeLa cells were incubated first in a 0.2% serum media over night. The following morning, monolayers of HeLa cells were first transduced with TAT peptides for 30 min, then washed 3 times with PBS and placed again in a 0.2% serum media for 1 h 30 min before scratch-wounding. Transduction with TAT peptides was repeated at 12 h into the wound healing assay (a total of 2 times). Healing wounds were monitored by phase-contrast microscopy over the next 24 h and migration index was quantified (expressed as % wound closure) by measuring the wounded area using Image J software.
[0217] Tumor Cell Invasion Assays:
[0218] Invasion assays were performed using Corning Transwell plates according to the manufacturer's protocol. Transduced cells were trypsinized, counted and placed in a Corning transwell permeable support coated with Cultrex Basement Membrane Extract (710.sup.4 cells/well). Media without FBS but containing EGF ligand (50 nM) was placed within the bottom chamber of each well to trigger directional 3D invasion. trandsuction with TAT peptides was repeated one more time 10-12 h into the assay (total of 2 times). Cells that had successfully invaded to the side of the permeable membrane facing the bottom chamber were visualized by staining the membrane with crystal violet. Cell invasion (expressed as number of invasive cells/high power field) was quantified by analyzing 10-12 random fields/membrane insert/condition for number of crystal violet stained cells.
[0219] Data Analysis and Other Methods.
[0220] All experiments were repeated at least three times, and results were presented either as one representative experiment or as averageSD or S.E.M. Statistical significance was assessed with the Student's t test. *p<0.05; ** p<0.01; *** p<0.001; **** p<0.0001. Protein structure analysis and visualization were performed using ICM Browser Pro software (Molsoft Inc).
Results and Discussion
[0221] Generation of Cell-Permeable Peptides Comprised of Key Modules Derived from GIV.
[0222] To generate the cell-permeable peptides, a validated strategy of building the multi-modular fluorescent GIV biosensors was followed (25). Because TAT-tags provide a reliable means for direct protein transduction into the cell, without inducing toxicity or cell death (26-28), the cell-permeable peptides were generated by fusing the C-terminus of GIV (1660-1870 residues) at its N-terminus with the TAT peptide transduction domain (TAT-PTD) (
[0223] Cell-Permeable GIV-CT Peptides are Effective in Exogenous Modulation of Gi and EGFR Signaling.
[0224] Several biochemical and functional assays were carried out to determine if TAT-GIV-CT peptides are indeed functional. First, the ability of TAT-GIV-CT peptides binding to Gi was assessed in vitro. Consistent with the known binding properties of GEFs, TAT-GIV-CT-WT bound inactive (i.e., GDP-loaded GST-Gi3) (
[0225] To analyze the effects of TAT-GIV-CT peptide on cells, cellular uptake of these peptides was first tested in HeLa cells. HeLa cells were chosen in this study because this is a well-accepted model system and has been extensively used to characterize the role of GIV in our prior work (16, 18, 29, 30). Incubation of HeLa cells with 400-800 nM TAT-GIV-CT peptides for 30 min resulted in efficient uptake (90-100% cells by immunofluorescence) with no observed toxicity (
[0226] Next, it was determined if TAT-GIV-CT peptides can modulate Gi and epidermal growth factor (EGF) signaling in HeLa cells. Responses to EGF were studied because EGF is the ligand for EGF receptor (EGFR), the prototype member of the RTK superfamily and has been extensively used to study the cellular functions of GIV (8, 9, 25), and because the structural basis for GIV's interaction with EGFR is most well understood (24). To determine if TAT-GIV-CT peptides can exogenously modulate Gi activation downstream of EGFR, a previously validated assay was used in which activation of Gi is monitored by dissociation of fluorescently tagged Gi and G subunits with a resultant loss of fluorescence resonance energy transfer (FRET) (31-33). To ensure that the observed changes in FRET are not due to a dominant negative effect of TAT-GIV-CT transduction and to minimize any potential interference posed by endogenous full length GIV, these assays were carried out in HeLa cells depleted of endogenous GIV by shRNA (
[0227] It was found that, when GIV-depleted HeLa cells co-expressing Gi1-YFP (internal tag), CFP-G.sub.i (N-terminal tag) and G.sub.2 (untagged) were stimulated with EGF, no significant loss of FRET was observed, i.e., Gi heterotrimer did not dissociate into Gi-YFP and CFP-G subunits at the PM within 5 min (
[0228] Consistent with the central role of GIV's GEF function in the enhancement of EGFR autophosphorylation (9, 30) and PI3K-Akt signals downstream (7, 29), transduction with TAT-GIV-CT-FA inhibited receptor autophoshorylation (as determined by phosphorylation at Y1068 and Y1173 on EGFR tail (
[0229] Taken together, it was concluded that TAT-GIV-CT peptides represent the smallest, functionally autonomous units that effectively combine the cell-permeant properties of TAT to exogenously engineer many key signaling properties of GIV in cells.
[0230] Cell-Permeable GIV-CT Proteins Allow Manipulation of a Diverse Array of Complex GIV-Dependent Cellular Processes.
[0231] Next, it was determined if TAT-GIV-CT peptides can exogenously modulate complex, multi-receptor driven cellular phenotypes previously attributed to full length GIV, e.g., cell migration (8, 9) (
[0232] Next, the effect of TAT-GIV-CT peptides on cancer cell invasion through polypropylene membranes that are pre-coated with basement membrane protein was analyzed in a 3-D Transwell assay (
[0233] Next, it was determined if the cell-permeable GIV peptides can modulate another recently defined function of GIV, i.e., activation of myofibroblasts and collagen synthesis in response to chronic injuries (14) (
[0234] Taken together, it is concluded that cell-permeable GIV-CT peptides represent a versatile strategy to modulate various growth factor responses, in diverse cell types, to modulate a wide array of cellular processes driven by GIV-GEF.
[0235] Cell-Permeable GIV-CT-WT Peptides Accelerate Wound Healing in Mice.
[0236] The therapeutic potential of TAT-GIV-CT peptides was analyzed in vivo in the modulation of the complex, multi-receptor driven process of dermal wound-healing in mice. The rationale to study wound healing was multi-factorial. First, wound healing is a multi-receptor driven process that involves coordination of diverse cell populations and cellular processes. Second, the ubiquitous expression of GIV in all cell types involved in healing, the transcriptional upregulation of GIV after wounding, and the role GIV-GEF in many of those cells/processes has been well documented (7, 8, 11, 13, 14, 17, 18, 22, 35) (
[0237] Of the many pathophysiologic processes modulated by TAT-GIV-CT (
REFERENCES
[0238] 1. Schlessinger J (2014) Receptor tyrosine kinases: Legacy of the first two decades. Cold Spring Harb Perspect Biol 6(3). [0239] 2. Gilman A G (1987) G proteins: Transducers of receptor-generated signals. Annu Rev. Biochem 56:615-649. [0240] 3. Daub H, Weiss F U, Wallasch C, Ullrich A (1996) Role of transactivation of the EGF receptor in signalling by G-protein-coupled receptors. Nature 379(6565):557-560. [0241] 4. Natarajan K, Berk B C (2006) Crosstalk coregulation mechanisms of G protein-coupled receptors and receptor tyrosine kinases. Methods Mol Biol 332:51-77. [0242] 5. Pierce K L, Luttrell L M, Lefkowitz R J (2001) New mechanisms in heptahelical receptor signaling to mitogen activated protein kinase cascades. Oncogene 20(13): 1532-1539. [0243] 6. Marty C, Ye R D (2010) Heterotrimeric G protein signaling outside the realm of seven transmembrane domain receptors. Mol Pharmacol 78(1):12-18. [0244] 7. Garcia-Marcos M, Ghosh P, Farquhar M G (2009) GIV is a nonreceptor GEF for G alpha i with a unique motif that regulates Akt signaling. Proc Natl Acad Sci USA 106(9):3178-3183. [0245] 8. Enomoto A, et al. (2005) Akt/PKB regulates actin organization and cell motility via Girdin/APE. Dev Cell 9(3):389-402. [0246] 9. Ghosh P, et al. (2010) A Galphai-GIV molecular complex binds epidermal growth factor receptor and determines whether cells migrate or proliferate. Mol Biol Cell 21(13):2338-2354. [0247] 10. Jiang P, et al. (2008) An actin-binding protein Girdin regulates the motility of breast cancer cells. Cancer Res 68(5):1310-1318. [0248] 11. Kitamura T, et al. (2008) Regulation of VEGF-mediated angiogenesis by the Akt/PKB substrate Girdin. Nat Cell Biol 10(3):329-337. [0249] 12. Garcia-Marcos M, Ear J, Farquhar M G, Ghosh P (2011) A GDI (AGS3) and a GEF (GIV) regulate autophagy by balancing G protein activity and growth factor signals. Mol Biol Cell 22(5):673-686. [0250] 13. Ghosh P, Garcia-Marcos M, Bornheimer S J, Farquhar M G (2008) Activation of Galphai3 triggers cell migration via regulation of GIV. J Cell Biol 182(2):381-393. [0251] 14. Lopez-Sanchez I, et al. (2014) GIV/Girdin is a central hub for profibrogenic signaling networks during liver fibrosis. Nat Commun 5:4451. [0252] 15. Garcia-Marcos M, Ghosh P, Farquhar M G (2015) GIV/Girdin transmits signals from multiple receptors by triggering trimeric G protein activation. J Biol Chem 290(11): 6697-6704. [0253] 16. Lopez-Sanchez I, et al. (2013) Protein kinase C-theta (PKC) phosphorylates and inhibits the guanine exchange factor, GIV/Girdin. Proc Natl Acad Sci USA 110(14): 5510-5515. [0254] 17. Ghosh P, Garcia-Marcos M, Farquhar M G (2011) GIV/Girdin is a rheostat that fine tunes growth factor signals during tumor progression. Cell Adhes Migr 5(3): 237-248. [0255] 18. Dunkel Y, et al. (2012) STAT3 protein up-regulates G-interacting vesicle-associated protein (GIV)/Girdin expression, and GIV enhances STAT3 activation in a positive feedback loop during wound healing and tumor invasion/metastasis. J Biol Chem 287(50):41667-41683. [0256] 19. Ohara K, et al. (2012) Involvement of Girdin in the determination of cell polarity during cell migration. PLoS ONE 7(5):e36681. [0257] 20. Natsume A, et al. (2012) Girdin maintains the stemness of glioblastoma stem cells. Oncogene 31(22):2715-2724. [0258] 21. Wang H M T, Taupin V, Eguchi A, Ghosh P, Farquhar M G (2014) GIV/Girdin links VEGF signaling to Akt survival signaling in podocytes independent of nephrin. J Am Soc Nephrol, in press. [0259] 22. Miyake H, et al. (2011) The actin-binding protein Girdin and its Akt-mediated phosphorylation regulate neointima formation after vascular injury. Circ Res 108(10): 1170-1179. [0260] 23. Garcia-Marcos M, et al. (2011) Expression of GIV/Girdin, a metastasis-related protein, predicts patient survival in colon cancer. FASEB J 25(2):590-599. [0261] 24. Lin C, et al. (2014) Structural basis for activation of trimeric Gi proteins by multiple growth factor receptors via GIV/Girdin. Mol Biol Cell 25(22):3654-3671. [0262] 25. Midde K K, et al. (2015) Multimodular biosensors reveal a novel platform for activation of G proteins by growth factor receptors. Proc Natl Acad Sci USA 112(9): E937-E946. [0263] 26. Becker-Hapak M, Dowdy S F (2003) Protein transduction: generation of full-length transducible proteins using the TAT system. Curr Protocols Cell Biol, Chapter 20: Unit 20 22. [0264] 27. van den Berg A, Dowdy S F (2011) Protein transduction domain delivery of therapeutic macromolecules. Curr Opin Biotechnol 22(6):888-893. [0265] 28. Wadia J S, Stan R V, Dowdy S F (2004) Transducible TAT-HA fusogenic peptide enhances escape of TAT-fusion proteins after lipid raft macropinocytosis. Nat Med 10(3): 310-315. [0266] 29. Lin C, et al. (2011) Tyrosine phosphorylation of the G-interacting protein GIV promotes activation of phosphoinositide 3-kinase during cell migration. Sci Signal 4(192):ra64. [0267] 30. Lin C, et al. (2014) Structural basis for activation of trimeric Gi proteins by multiple growth factor receptors via GIV/Girdin. Mol Biol Cell 25(22):3654-3671. [0268] 31. Janetopoulos C, Jin T, Devreotes P (2001) Receptor-mediated activation of heterotrimeric G-proteins in living cells. Science 291(5512):2408-2411. [0269] 32. Gibson S K, Gilman A G (2006) Gialpha and Gbeta subunits both define selectivity of G protein activation by alpha2-adrenergic receptors. Proc Natl Acad Sci USA 103(1): 212-217. [0270] 33. Bnemann M, Frank M, Lohse M J (2003) Gi protein activation in intact cells involves subunit rearrangement rather than dissociation. Proc Natl Acad Sci USA 100(26): 16077-16082. [0271] 34. Sarvazyan N A, Remmers A E, Neubig R R (1998) Determinants of gi1alpha and beta gamma binding. Measuring high affinity interactions in a lipid environment using flow cytometry. J Biol Chem 273 (14): 7934-7940. [0272] 35. Ito T, et al. (2013) Girdin and its phosphorylation dynamically regulate neonatal vascular development and pathological neovascularization in the retina. Am J Pathol 182(2):586-596. [0273] 36. Iiri T, Farfel Z, Bourne H R (1998) G-protein diseases furnish a model for the turn-on switch. Nature 394(6688):35-38. [0274] 37. Siderovski D P, Willard F S (2005) The GAPs, GEFs, and GDIs of heterotrimeric G-protein alpha subunits. Int J Biol Sci 1(2):51-66. [0275] 38. Slep K C, et al. (2008) Molecular architecture of Galphao and the structural basis for RGS16-mediated deactivation. Proc Natl Acad Sci USA 105(17):6243-6248. [0276] 39. Studier F W (2005) Protein production by auto-induction in high density shaking cultures. Protein Expr Purif 41(1):207-234. [0277] 40. Midde K, et al. (2013) Comparison of orientation and rotational motion of skeletal muscle cross-bridges containing phosphorylated and dephosphorylated myosin regulatory light chain. J Biol Chem 288(10):7012-7023. [0278] 41. Borejdo J, Rich R, Midde K (2012) Mesoscopic analysis of motion and conformation of cross-bridges. Biophys Rev 4(4):299-311. [0279] 42. Midde K, et al. (2014) Membrane topology of human presenilin-1 in SK-N-SH cells determined by fluorescence correlation spectroscopy and fluorescent energy transfer.
Cell Biochem Biophys 70(2):923-932.
[0280] 43. Midde K K, et al. (2015) Multimodular biosensors reveal a novel platform for activation of G proteins by growth factor receptors. Proc Natl Acad Sci USA 112(9):E937-E946. [0281] 44. Garcia-Marcos M, Ghosh P, Farquhar M G (2009) GIV is a nonreceptor GEF for G alpha I with a unique motif that regulates Akt signaling. Proc Natl Acad Sci USA 106(9): 3178-3183. [0282] 45. Bnemann M, Frank M, Lohse M J (2003) Gi protein activation in intact cells involves subunit rearrangement rather than dissociation. Proc Natl Acad Sci USA 100(26): 16077-16082. [0283] 46. Gibson S K, Gilman A G (2006) Gialpha and Gbeta subunits both define selectivity of G protein activation by alpha2-adrenergic receptors. Proc Natl Acad Sci USA 103(1): 212-217. [0284] 47. Shah M, Baterina O Y, Jr, Taupin V, Farquhar M G (2013) ARH directs megalin to the endocytic recycling compartment to regulate its proteolysis and gene expression. J Cell Biol 202(1):113-127. [0285] 48. Studier F W (2005) Protein production by auto-induction in high density shaking cultures. Protein Expr Purif 41(1):207-234. [0286] 49. Ghosh P, Garcia-Marcos M, Bornheimer S J, Farquhar M G (2008) Activation of Galphai3 triggers cell migration via regulation of GIV. J Cell Biol 182(2):381-393. [0287] 50. Ghosh P, et al. (2010) A Galphai-GIV molecular complex binds epidermal growth factor receptor and determines whether cells migrate or proliferate. Mol Biol Cell 21(13):2338-2354. [0288] 51. Xu L, et al. (2005) Human hepatic stellate cell lines, LX-1 and LX-2: new tools for analysis of hepatic fibrosis. Gut 54(1):142-151. [0289] 52. Garcia-Marcos M, et al. (2012) Functional characterization of the guanine nucleotide exchange factor (GEF) motif of GIV protein reveals a threshold effect in signaling. Proc Natl Acad Sci USA 109(6):1961-1966. [0290] 53. Garcia-Marcos M, Ghosh P, Ear J, Farquhar M G (2010) A structural determinant that renders G alpha(i) sensitive to activation by GIV/girdin is required to promote cell migration. J Biol Chem 285(17):12765-12777. [0291] 54. Lin C, et al. (2011) Tyrosine phosphorylation of the G-interacting protein GIV promotes activation of phosphoinositide 3-kinase during cell migration. Sci Signal 4(192):ra64. [0292] 55. Midde K, et al. (2013) Comparison of orientation and rotational motion of skeletal muscle cross-bridges containing phosphorylated and dephosphorylated myosin regulatory light chain. J Biol Chem 288(10):7012-7023. [0293] 56. Borejdo J, Rich R, Midde K (2012) Mesoscopic analysis of motion and conformation of cross-bridges. Biophys Rev 4(4):299-311. [0294] 57. Midde K, et al. (2014) Membrane topology of human presenilin-1 in SK-N-SH cells determined by fluorescence correlation spectroscopy and fluorescent energy transfer. Cell Biochem Biophys 70(2):923-932. [0295] 58. Roszik J, Lisboa D, Szollosi J, Vereb G (2009) Evaluation of intensity-based ratiometric FRET in image cytometry-approaches and a software solution. Cytometry 75(9): 761-767. [0296] 59. Lopez-Sanchez I, et al. (2014) GIV/Girdin is a central hub for profibrogenic signaling networks during liver fibrosis. Nat Commun 5:4451. [0297] 60. Chang A C, Dearman B, Greenwood J E (2011) A comparison of wound area measurement techniques: visitrak versus photography. Eplasty 11:e18. [0298] 61. Dunkel Y, et al. (2012) STAT3 protein up-regulates G-interacting vesicle-associated protein (GIV)/Girdin expression, and GIV enhances STAT3 activation in a positive feedback loop during wound healing and tumor invasion/metastasis. J Biol Chem 287(50):41667-41683. [0299] 62. Lin C, et al. (2014) Structural basis for activation of trimeric Gi proteins by multiple growth factor receptors via GIV/Girdin. Mol Biol Cell 25(22):3654-3671. [0300] 63. Garcia-Marcos M, Ear J, Farquhar M G, Ghosh P (2011) A GDI (AGS3) and a GEF (GIV) regulate autophagy by balancing G protein activity and growth factor signals. Mol Biol Cell 22(5):673-686. [0301] 64. Wang H M T, Taupin V, Eguchi A, Ghosh P, Farquhar M G (2014) GIV/Girdin links VEGF signaling to Akt survival signaling in podocytes independent of nephrin. J Am Soc Nephrol, in press. [0302] 65. Mittal Y, Pavlova Y, Garcia-Marcos M, Ghosh P (2011) Src homology domain 2-containing protein-tyrosine phosphatase-1 (SHP-1) binds and dephosphorylates G(alpha)-interacting, vesicle-associated protein (GIV)/Girdin and attenuates the GIV-phosphatidylinositol 3-kinase (PI3K)-Akt signaling pathway. J Biol Chem 286(37):32404-32415.
Example 2
Activation of G Proteins by GIV-GEF is a Pivot Point for Insulin Resistance and Sensitivity
[0303] Insulin resistance (IR) is a metabolic disorder characterized by impaired insulin signaling and cellular glucose uptake. The current paradigm for insulin signaling centers upon the insulin receptor (InsR) and its substrate IRS1; the latter is believed to be the sole conduit for post-receptor signaling. This example shows that GIV, a Guanidine Exchange Factor (GEF) for the trimeric G protein, Gi, is another major hierarchical conduit for the metabolic insulin response. By virtue of its ability to directly bind InsR, IRS1 and PI3K, GIV serves as a key hub in the immediate post-receptor level which coordinately enhances the metabolic insulin response and glucose uptake in myotubes via its GEF function. Site-directed mutagenesis or phosphoinhibition of GIV-GEF by the fatty-acid/PKC pathway triggers IR. Insulin sensitizers reverse phosphoinhibition of GIV and reinstates insulin sensitivity. Evidence is provided for such reversible regulation of GIV-GEF in skeletal muscles from patients with IR. Thus, GIV is an essential upstream component that couples InsR to G-Protein signaling to enhance the metabolic insulin response, and impairment of such coupling triggers IR. Further, evidence is also provided that GIV-GEF serves as therapeutic target for exogenous manipulation of physiologic insulin response and reversal of IR in skeletal muscles.
[0304] Therefore, this example provides a single multi-modular signal transducer, GIV as a critical node in metabolic insulin signaling. Based on its ability to cross-talk with all these key mediators of metabolic insulin signaling, it is demonstrated that GIV is a key determinant of insulin sensitivity in physiology and its phosphoregulation by PKC triggers IR.
Experimental Procedures
[0305] Plasmids Constructs and Protein Expression.
[0306] Cloning of Gi3 into pGEX-4T-1 (GST-Gi3) or into pcDNA 3.1 plasmid, GIV-CT (aa 1660-1870) into pET28b (His-GIV CT) and RNA interference-resistant GIV constructs (Enomoto et al., 2005) into p3XFLAG-CMV-14 plasmid (GIV-FLAG) have been described previously (Garcia-Marcos et al., 2010; Garcia-Marcos et al., 2009; Ghosh et al., 2008). The following constructs were gifts from other investigators: IRS1-HA from Michael Quon (U Maryland) (Kim et al., 2005); GST-tagged IRS1 domains (N: aa 2-516, M: aa 526-859 and C: 900-1235) from Xia-Jian Sun (University of Maryland) (Qiao et al., 1999) and CFP-pYIRS1-NSH2p85-YFP (phocus-2nes) from Yoshio Umezawa (University of Tokyo) (Sato et al., 2002). Expression and purification of GST, GST-Gi3 and His-GIV CT using Bl21(DE3) (Invitrogen) were done as described previously (Garcia-Marcos et al., 2009; Ghosh et al., 2010; Ghosh et al., 2008). Bacterial cultures were induced overnight at 25 C. with 1 mM isopropyl -D-1-thiogalactopyranoside (IPTG). Pelleted bacteria from 1 L of culture were re-suspended in 10 ml GST-lysis buffer [25 mM Tris-HCl, pH 7.5, 20 mM NaCl, 1 mM EDTA, 20% (v:v) glycerol, 1% (v:v) Triton X-100, 2 protease inhibitor cocktail (Complete EDTA-free, Roche Diagnostics)] or His-lysis buffer [50 mM NaH.sub.2PO.sub.4 pH 7.4, 300 mM NaCl, 10 mM imidazole, 1% (v:v) Triton X-100, 2 protease inhibitor cocktail (Complete EDTA-free, Roche Diagnostics)] for GST or His-fused proteins, respectively. After sonication (330 s), lysates were centrifuged at 12,000 g at 4 C. for 20 min. Solubilized proteins were affinity purified on glutathione-Sepharose 4B beads (GE Healthcare) or HisPur Cobalt Resin (Pierce). Proteins were eluted, dialyzed overnight against PBS and stored at 80 C.
[0307] GIV and Gi3 mutants were generated using specific primers (sequences available upon request) following the manufacturer's instructions (QuickChange II, Stratagene). TAT-GIV-CT-WT and TAT-GIV-CT-F1685A (TAT-GIV-CT-FA) constructs were prepared by cloning GIV-CT (aa 1660-1870) between NcoI and KpnI cloning sites within the pTAT-HA vector [gift from Steven Dowdy (Nagahara et al., 1998)]. A linker (GGSGHSG; SEQ ID NO: 11) was added between the HA-tag and the N-terminal sequence of GIV CT.
[0308] TAT-constructs were expressed using BL21(DE3)-pLysS (Invitrogen) and Terrific Broth (BioPioneer) supplemented with additives as per auto-induction protocols outlined by Studier F (Studier, 2005). Briefly, cultures of bacteria were grown at 300 rpm at 37 C. for 5 h, then at 25 C. overnight. Cells were lysed in 10 ml of buffer [50 mM NaH.sub.2PO.sub.4, 10 mM Imidazole, 400 mM NaCl, 1% (v:v) Sarkosyl, 1% (v:v) Triton X-100 and protease inhibitor mixture (Roche Diagnostics) (pH 7.4)], sonicated (330 s), cleared at 12,000g for 20 min at 4 C. and affinity-purified on Ni-NTA agarose resin (Quiagen) (overnight at 4 C.). Proteins were eluted in elution buffer [50 mM NaH.sub.2PO.sub.4, 300 mM Imidazole, 400 mM NaCl, pH 7.4] and dialyzed overnight against TBS containing 400 mM NaCl.
[0309] Immunofluorescence and Confocal Microscopy.
[0310] Cells were fixed with 3% PFA in PBS for 25 min at room temperature, treated with 0.1 M glycine for 10 min, and subsequently blocked and permeabilized with PBS containing 3% BSA and 0.2% Triton X-100 (or only with 3% BSA in PBS buffer for surface labeling experiments where non-permeabilizing conditions were used) for 45 min at room temperature prior to antibody staining. Dilutions of antibodies are as follows: anti-phospho-GIV-Tyr1764 (1:200) (Ventana/Roche and Spring Biosciences); anti-HA (1:300) (Covance); anti-GFP, mouse anti-InsR and mouse anti-phospho-IRS1 (1:200) from Santa Cruz Biotechnologies; DAPI 1:1,000 (Molecular Probes); Secondary goat anti-rabbit (594) and goat anti-mouse (488) Alexa conjugated antibodies (1:500) from Molecular Probes. Coverslips were mounted with ProLong Gold (Life Technologies). Cells were imaged on a Leica SPE confocal microscope using a 63 oil objective using 488, 561 and 405 laser lines for excitation. Images were scanned using a line-average of 3. All images were processed using ImageJ software and assembled into figure panels using Photoshop and Illustrator (Adobe).
[0311] Cell Culture, Transfection, Immunoblotting, Immunofluorescence and Protein-Protein Interaction Assays.
[0312] These assays were carried out exactly as described before (Ghosh et al, 2010; Ghosh et al, 2008). All Odyssey images were processed using ImageJ software (NIH) and assembled for presentation using Photoshop and Illustrator software (Adobe). HeLa, Cos7 and L6 cells were cultured according to ATCC guidelines. Low passage (3 to 8) L6 myoblasts were cultured under non-differentiating conditions in -MEM (Invitrogen) media supplemented with 10% FBS and differentiated into myotubes by switching to 2% FBS media for 6-7 days.
[0313] Transfection was carried out with GeneJuice (Novagen) for DNA plasmids or Oligofectamine (Invitrogen) for siRNA oligos according to manufacturer's protocols. Silencer negative Control scrambled (Scr) siRNA used as control was purchased from Ambion and the previously validated (Enomoto et al., 2005) GIV siRNA sequence used was custom-ordered from Dharmacon. For TAT-construct transduction, cells were incubated with 300-800 nM of the TAT-proteins for 30 min at 37 C. prior to three washes with PBS and addition of fresh growth media. For assays involving insulin (Novagen) stimulation of TAT-treated cells, such stimulation was carried out 90 min after transduction.
[0314] Generation of Stable Cell Lines.
[0315] HeLa cell lines stably expressing GIV-3FLAG-WT, FA or SD mutants were extensively used in previous work (Lopez-Sanchez et al., 2013). GIV-3FLAG expression was 1-2 fold compared to the levels of endogenous GIV. L6 stable cell lines expressing GIV-3FLAG constructs or L6 stable cell lines expressing Gi3 WT or Gi3-W258F (Gi3-WF) constructs were selected as previously described (Garcia-Marcos et al., 2009; Lopez-Sanchez et al., 2013) with the neomycin analog G418 (Cellgro) at 500 g/ml. Expression of various GIV constructs in L6 cells were confirmed as 1-1.5 fold above the endogenous levels by immunoblotting. In all experiments using stable cells, the endogenous GIV was depleted using GIV siRNA such that the cells exclusively expressed the desirable siRNA-resistant GIV mutant at near-physiologic levels. Similarly, Gi3 expression was confirmed by immunoblotting with anti-Gi3 antibody and expression was 1.5-2 fold above the endogenous levels. Control shRNA and GIV shRNA Cos7 stable cell lines were selected with 2 g/ml of Puromycin (GIBCO). The shGIV sequence used was previously validated (Enomoto et al., 2005) and is identical to the sequence of GIV siRNA. Depletion of GIV was verified using GIV-CT antibody with an efficiency of 95%.
[0316] Sodium Palmitate, Pioglitazone and Other Treatments.
[0317] Unless otherwise indicated, serum starvation of cells for use in experiments involving insulin stimulation was carried out by growing cells overnight in the presence of no serum (i.e., 0% FBS) in the case of Cos7 and L6 cells, or in the presence of 0.2% FBS in the case of HeLa cells. To induce IR, cells were pre-treated with Sodium Palmitate (PA; Sigma-Aldrich) (0.5 mM, stock solution at 5 mM/5% FFA-free BSA in ethanol) or vehicle control (5% FFA-free BSA in ethanol) for 16 h. To reverse IR with TZDs, cells were treated with 50 M Pioglitazone (Pio) (Sigma-Aldrich) or DMSO (vehicle control) for 18 h prior to stimulation with 100 nM insulin. Treatment with PKC pseudo-substrate inhibitor (Santa Cruz Biotechnologies) was performed at 10 M for 16 h.
[0318] Cell Lysis and Immunoblot Analysis.
[0319] Whole cell lysates were prepared after washing cells with cold PBS prior to resuspending and boiling them in sample buffer. Cell lysates used as a source of proteins for pulldown assays or immunoprecipitation were prepared by breaking cells during passage through a 28-gauge needle in the presence of lysis buffer [20 mM Hepes (pH 7.2), 5 mM Mg-acetate, 125 mM K-acetate, 0.4% Triton X-100, 1 mM DTT, supplemented with sodium orthovanadate (500 M), phosphatase (Sigma), and Protease (Roche) inhibitor cocktails] at 4 C. Crude lysates were cleared of insoluble particles/debris by centrifugation at 10,000g for 10 minutes.
[0320] Protein samples for immunoblotting were run on SDS/PAGE gels and transferred onto PVDF membranes (Millipore). Membranes were blocked with PBS containing 5% non-fat milk (or with 5% BSA when probing for phosphorylated proteins) before incubation with primary antibodies. GIV was detected using rabbit anti-GIV coiled-coil (Millipore) (1:500); GIV-CT (Santa Cruz Biotechnologies) (1:500); phospho-Tyr1764-GIV (1:500) and phospho-Ser1689-GIV (21.sup.st Century Biochemicals) (1:250) antibodies. Other antibodies used in this work include rabbit polyclonal antibodies against Gi3 (1:333), pan-GP (1:250) and phospho-IRS1 (1:500) from Santa Cruz Biotechnologies; and phospho-Akt (1:250); total Akt (1:250); phospho-ERK (1:250); phospho-AS160 (1:250); total InsR (1:500) and total IRS1 (1:500) from Cell signaling. Mouse monoclonal Abs against phospho-InsR (1:250), His (1:1000), -tubulin (1:1000), GFP (1:500) from Santa Cruz Biotechnologies, and control IgG (Bio-Rad Laboratories) were commercially obtained. Goat anti-rabbit and goat anti-mouse Alexa Fluor 680 or IRDye 800 F(ab).sub.2 secondary antibodies were purchased from Li-Cor Biosciences. Images were processed with ImageJ software (NIH) and assembled as figure panels using Photoshop and Illustrator software (Adobe).
[0321] Glucose Uptake Assay.
[0322] Glucose uptake assays were performed without the use of radioisotopes as described previously (Yamamoto et al., 2006). HeLa and L6 cells grown in 6-well plates were stimulated with insulin in KRH Buffer [50 mM HEPES, 137 mM NaCl, 4.7 mM KCl, 1.85 mM CaCl.sub.2, 1.3 mM MgSO.sub.4, and 0.1% (w/v) BSA-FFA free, pH 7.4]. Cells were incubated with 1 mM 2-deoxyglucose (2-DG) for 20 min, washed, and subsequently lysed with 0.1 N NaOH. The lysates were transferred into eppendorf tubes and samples were incubated in a water bath maintained at 80 C. for 45 min to degrade endogenous NAD(P)H and NAD(P).sup.+. An equal volume each of 0.1 N HCl and Triethanolamine (200 mM TEA, pH 8.1) buffer were added to each tube. Samples were subsequently mixed with assay solution [50 mM TEA, 0.02% BSA-FFA free, 10 M NAD(P).sup.+, 0.2 U/ml Diaphorase, 6 nM Resazurin sodium, 15 U/ml G6PDH (Santa Cruz Biotechnologies)] and incubated at 37 C. for 90 min. Fluorescence intensity (.sub.ex=550 nM, .sub.em=590 nM) was determined using a Tecan Inifinite M1000 PRO and normalized to total protein, as determined using BCA assay (Thermo Scientific).
[0323] GST Pulldown Assays and Immunoprecipitation.
[0324] Purified GST-Gi3, GST-tagged IRS1 domains or GST alone were immobilized on glutathione-Sepharose beads (GE Healthcare) for 1 h at room temperature as described before (Garcia-Marcos et al., 2012; Ghosh et al., 2010; Ghosh et al., 2008; Lin et al., 2011). L6 lysates or His-GIV CT protein were added to each tube, and binding reactions were carried out for 4 h at 4 C. with constant tumbling in binding buffer [50 mM Tris-HCl (pH 7.4), 100 mM NaCl, 0.4% (v:v) Nonidet P-40, 10 mM MgCl.sub.2, 5 mM EDTA, 2 mM DTT, protease inhibitor mixture]. Beads were washed (4) with 1 mL of wash buffer [4.3 mM Na.sub.2HPO.sub.4, 1.4 mM KH.sub.2PO.sub.4 (pH 7.4), 137 mM NaCl, 2.7 mM KCl, 0.1% (v:v) Tween 20, 10 mM MgCl.sub.2, 5 mM EDTA, 2 mM DTT] and bound complexes were eluted by boiling in Laemmli's sample buffer. When GST-Gi3 was used in the assay, both binding buffer and washing buffer were supplemented with 30 M GDP and bound proteins were eluted by incubating at 37 C.
[0325] For Immunoprecipitation,
[0326] cell lysates (2 mg of protein) were incubated for 3 h at 4 C. with 2 g anti-HA, phospho-InsR, anti-GFP mAbs or pre-immune control mouse IgG. Protein G Sepharose beads (GE Healthcare) were added and incubated at 4 C. for an additional 60 min. Beads were washed and bound immune complexes were eluted by boiling in Laemmli's sample buffer (Garcia-Marcos et al., 2011; Ghosh et al., 2010; Ghosh et al., 2008).
[0327] dSTORM and FRET Imaging.
[0328] Direct Stochastic Optical Reconstruction Microscopy imaging was performed to reveal the interaction endogenous Gi3 and active InsR at molecular level (Huang et al., 2010). Control shRNA and GIV shRNA Cos7 stable cells were starved and stimulated with 100 nM insulin and stained with anti-Gi3 (1:30) (Calbiochem) and phosho-InR antibodies. Slides were sealed in STORM buffer [20% Glucose, 500 g/ml Glucose Oxidase, 40 g/ml Catalase and 0.1 M Cysteamine (MEA) dissolved in PBS] and imaged using Nikon Eclipse Ti super resolution microscope (Moores Cancer Center Core Facility).
[0329] FRET assays were performed using the intracellular phosphorylation biosensors custom (phocus-2nes) (Sato et al., 2002). Resonance energy transfer from CFP to YFP denotes phosphorylation of the Y941 residue of IRS-1 substrate and binding of the SH2 domain of PI3K revealing activation of the PI3K pathway upon stimulation with insulin. GIV shRNA Cos-7 stable cells were transfected with phocus-2nes and GIV-WT-FLAG or GIV-S1689D-FLAG. Cells were starved and stimulated with insulin, and stained with anti-FLAG antibody following the standard immunofluorescence protocol. Leica laser scanning confocal microscope was used to generate optical slices of 0.5 m thickness and the Z plane that resolved most of the plasma membrane was imaged through sensitized emission. FRET efficiency was computed on a pixel by pixel basis from normalized ratiometric images obtained in individual channels (donor, acceptor and FRET) (Roszik et al., 2009). Region of Interest (ROI) were drawn along the plasma membrane and analyzed for FRET to determine sub-cellular phosphorylation of IRS1 upon insulin stimulation.
[0330] Patient Samples.
[0331] Biopsies of vastus lateralis muscle used for GIV phosphorylation analysis were collected in the Special Diagnostic and Treatment Unit (SDTU) of the Veterans Affairs Medical Center (San Diego, Calif.) and the General Clinical Research Center (GCRC) (University of California, San Diego, Calif.). Muscle samples were collected from healthy normal cycling women or women with PCOS before and after pioglitazone (45 mg/d, for 6 months) (Aroda et al., 2009). After collection, muscle tissue was immediately frozen in liquid nitrogen. The experimental protocol was approved by the Human Research Protection Program of the University of California (San Diego, Calif.). Informed written consent was obtained from all subjects after explanation of the protocol.
[0332] Data Analysis and Statistics.
[0333] All experiments were repeated at least three times, and results were presented either as one representative experiment or as averageS.D or S.E.M. Statistical significance was assessed with two-tailed Student's t-test.
Results and Discussion
[0334] Activation of Gi by GIV-GEF is Required for Glucose Uptake in Skeletal Muscles.
[0335] To determine the role of GIV-GEF in insulin resistance, differentiated L6 rat skeletal myotubes were used. The rationale for this choice was guided by two facts: 1) although both adipocytes and skeletal muscles are sites for IR, full-length GIV is expressed more abundantly in skeletal muscles than in mature adipocytes (Uhlen et al, 2010); and 2) a recent study showed that levels of expression of GIV mRNA in skeletal muscle biopsies from normal subjects tracks with insulin sensitivity, as measured by a hyperinsulinemic-euglycemic clamp (Hartung et al, 2013). It was found that depletion of GIV in L6 myotubes (by 80-85%;
[0336] Next, it was determined if phosphoinhibition of GIV's GEF at Ser1689 by PKC (Lopez-Sanchez et al, 2013) also inhibits glucose uptake. It was found that glucose uptake in cells expressing the constitutively phosphoinhibited S1689D mutant of GIV (GIV-SD) was half as efficient compared to those expressing GIV-WT (
[0337] To further pinpoint impairment of Gi activation by GIV-GEF as the cause, glucose uptake was monitored in L6 myotubes stably expressing either wild-type (Gi3-WT) or a dominant negative W258F mutant of Gi3, henceforth referred to as Gi3-WF (
[0338] GIV Binds Ligand Activated InsR and Modulates Multiple Tiers of Metabolic Insulin Signaling Via its GEF Function.
[0339] To determine how GIV's GEF function affects the insulin signaling cascade, key components of metabolic insulin signaling in L6 myotubes responding to insulin were analyzed. Immunoblotting for phosphoproteins revealed that insulin triggered activation of GIV at 5 min, coincides with peak autophosphorylation of InsR, and is followed by sustained phosphoactivation of IRS1 and Akt and phosphoinhibition of the GSV-associated Rab-GAP AS160 (
[0340] Previous work showed that GIV's C-terminal SH2-like domain directly binds autophosphorylated cytoplasmic tails of multiple RTKs, including InsR (Lin et al, 2014; Midde et al, 2015). In L6 myotubes, active GIV[pY1764] coimmunoprecipitated with ligand-activated InsR-IRS1 complexes (
GIV Directly Binds and Modulates the Localization and Functional Phosphorylation of IRS1
[0341] Next, it was further investigated how GI affects the phosphorylation/activation of IRS1, which is a major adaptor for the metabolic insulin responses. Because the hypophosphorylation of IRS1 observed by immunoblotting L6 myotubes and HeLa cells expressing the GEF-deficient, SD phosphomimetic mutant do not provide enough information about the spatial and temporal dynamics of IRS1 phospho-dephosphorylation in cells, a genetically encoded fluorescent biosensor, phocus-2nes (Sato et al, 2002) was used in fluorescence resonance energy transfer (FRET) studies. This biosensor shows energy transfer only when Y941 on IRS1 is phosphorylated and presents a docking site for the NSH2 domain of p85 (PI3K), thereby providing a readout of the function of such phosphorylation (
[0342] To further pinpoint if GIV's GEF function is essential for the recruitment of IRS1 to ligand-activated InsR, first, insulin-triggered translocation of IRS1 from the cytosol to the PM was studied in Cos7 cells expressing WT or SD GIV mutant (
[0343] Because of the global effect of GIV depletion observed on IRS1 localization, recruitment and phosphoactivation, it was determined if GIV binds IRS1. GIV coimmunoprecipitated with IRS1 before and after insulin stimulation (
[0344] GIV-GEF is a Target for the Antagonist Actions of Fatty Acids and Insulin Sensitizers.
[0345] Because PKC is the kinase that orchestrates lipid-induced insulin resistance (Haasch et al, 2006), it was determined whether fatty acids induce IR in part by phosphoinhibition of GIV-GEF at S1689 by PKC. When IR was induced in L6 cells using albumin-conjugated sodium palmitate (PA), which is known to activate PKC (Griffin et al, 1999), it was found that phosphorylation of GIV at S1689 was enhanced, GIV's ability to bind Gi was reduced and phosphorylation of GIV at Y1764 was suppressed (
[0346] Next, it was investigated whether phosphoinhibition of GIV-GEF by PKC in L6 myotubes plays a role in mediating the antagonistic effects of PA and Pio in the induction and reversal of IR, respectively. PA induced IR in L6-GIV-WT cells, as determined by a blunted glucose-uptake response to insulin (
[0347] The physiologic significance of these observations in cultured L6 myotubes was confirmed by findings in patients with IR, where chronic treatment with Pio reduced the phosphoinhibition of GIV-GEF and enhanced phosphorylation of Akt in skeletal muscles (vastus lateralis) of obese type II diabetic patients (
[0348] Cell-Permeant GIV-Derived Peptides can Effectively Reverse IR in Skeletal Muscle.
[0349] To investigate whether GIV-GEF can serve as a therapeutic target for exogenous modulation of IR, a recently validated recombinant, cell permeant TAT-tagged GIV-CT peptides (WT and GEF-deficient FA mutant peptides spanning GIV's GEF and SH2-like domains,
Discussion
[0350] Phosphoinhibition of GIV-GEF by PKC triggers lipid-induced insulin resistance; dephosphorylation of GIV-GEF reinstates insulin sensitivity, provided GIV-GEF plays a major role as a dominant conduit for insulin response in the skeletal muscle, and identification of key phosphoevents that allow this GEF to serve as a decisive pivot/node for cellular insulin response in physiology and disease (
[0351] Reversible phosphorylation of GIV at S1689 by PKC, and the ability of this single phosphoevent to modulate the InsR-GIV-Gi signaling axis is a critical determinant of cellular insulin responses. It was demonstrated that this phosphoevent alone is sufficient to mimic fatty-acid-induced IR and that fatty acids require such phosphorylation to induce IR. Although this study dissected the interplay between GIV and PKC in lipid-induced IR, because GIV can intercept signaling downstream of multiple classes of receptors (GPCRs and RTKs) and non-RTKs alike [reviewed in (Garcia-Marcos et al, 2015)], and is an enhancer of STAT3 as well as its transcriptional target (Dunkel et al, 2012), it my suggest that GIV is a central node for other major triggers of IR, i.e., inflammation, suppression of adiponectin, leptin resistance, etc, which also require activation of PKC (Anderson et al, 2006; Itani et al, 2000; Lin et al, 2000; Shulman, 2000) and/or the JAK-STAT3 pathway (Mashili et al, 2013; Wunderlich et al, 2013).
[0352] It was also shown that TZDs like Pioglitazone release the phosphoinhibition on GIV-GEF and restore its function. Such restoration was essential for TZD action because TZDs failed to reverse IR and reinstate insulin sensitivity in cells expressing the constitutively phosphomimic GIV-S1689D mutant. Because chronic TZD therapy does not suppress PKC (Markova et al, 2010), the reduction in levels of GIV phosphorylation at S1689 observed after TZD therapy is likely to be a consequence of dephosphorylation by one of the many S/T phosphatases that are activated by TZDs in a PPAR-dependent manner (Altiok et al, 1997; Cho et al, 2006; Pugazhenthi & Khandelwal, 1998; Sharma et al, 2004). Regardless of the mechanism(s) involved, these results indicate that GIV is a major target of TZDs that can account, in part, for TZD action on skeletal muscle. It is concluded that reversible phosphorylation at S1689 and inhibition of the GEF function, via which GIV activates Gi, serves as a molecular switch for flipping skeletal muscles between insulin-sensitive and resistant states. Because GIV specifically binds Gi, and not Gq/11 (Le-Niculescu et al, 2005), these findings do not account for the previously described role of yet another G protein, Gq/11 in insulin response (Imamura et al, 1999).
[0353] GIV's GEF function modulates several tiers within the metabolic insulin signaling cascade. It was demonstrated that activation of Gi by GIV impacts many tiers within the insulin signaling cascade and that phosphoinhibition of GIV's GEF function antagonizes them all. It was shown previously that GIV directly binds autophosphorylated cytoplasmic tails of ligand-activated InsR via its C-terminal SH2-like module (Lin et al, 2014). Both SH2-like module and GIV's GEF functions are critical for coupling of G proteins to ligand-activated InsR (Garcia-Marcos et al, 2011; Lin et al, 2014; Midde et al, 2015). Here, it was shown that at the level of the receptor, activation of Gi via GIV's GEF motif is required for maximal autophosphorylation and activation of InsR and recruitment and phosphoactivation of its major substrate, IRS1. The sites of autophosphorylation on InsR that GIV enhanced, i.e., Y1150 and Y1151, are required for maximal activation of the InsR kinase (White et al, 1988), and a failure to activate InsR kinase in skeletal muscles has been implicated in IR (Goodyear et al, 1995; Maegawa et al, 1991; Nolan et al, 1994). Although it is unclear how activation of Gi by GIV may enhance receptor autophosphorylation, it has been previously shown that activation of Gi is implicated in the enhancement of InsR autophosphorylation (Kreuzer et al, 2004) and activation of Gi by GIV's GEF function can similarly enhance autophosphorylation of yet another RTK, EGFR (Ghosh et al, 2010). In both instances, suppression of protein tyrosine phosphatases (PTPs) has been implicated as the mechanism for enhanced receptor autophosphorylation (Lin et al, 2014; Moxham & Malbon, 1996). Because GIV directly binds ligand-activated InsR (Lin et al, 2014) and triggers the formation of InsR-Gi complexes at the PM, it suggests that the formation of such InsR-GIV-Gi complexes suppresses the recruitment and/or activation of key PTPases. It is concluded that the GIV-Gi axis enhances cellular insulin response by increasing Ins kinase activity and autophosphorylation, two upstream events in insulin signaling.
[0354] At the immediate post-receptor level, it is demonstrated that GIV binds and modulates the functions of IRS1. Activation of Gi by GIV enhanced the recruitment of IRS1 to the ligand-activated receptors at the PM, triggered robust tyrosine phosphorylation at Y632 and Y941 on IRS1 and enhanced the formation of IRS1-p85(PI3K) complexes. Unlike the ligand-dependent nature of InsR-GIV (current work) or InsR-IRS1 (Sun et al, 1991) interactions, the GIV-IRS1 interaction was constitutive and direct, and this binding involves the C-terminal region of GIV and the N-terminal region of IRS1. The latter contains a phosphotyrosine binding domain (PTB), which is responsible for the direct interaction of IRS1 with InsR (Eck et al, 1996). These findings of InsR-GIV-IRS1 complexes upon insulin stimulation suggest that GIV may bind IRS1 at a distinct site where the autophosphorylated cytoplasmic tail of InsR docks within the PTB. The enhanced recruitment of IRS1 to InsR in the presence of GIV suggests that GIV may serve as a signal amplifier at the immediate post-receptor level by facilitating the recruitment of more IRS1 adaptors per activated InsR. Due to recent experimental evidence that questions the exclusivity of IRS1 for InsR (Knowlden et al, 2008) and because GIV is capable of binding multiple RTKs (e.g., EGFR, PDGFR, VEGFR) (Lin et al, 2014; Lopez-Sanchez et al, 2014), suggesting that GIV provides the necessary molecular basis for IRS1 to serve as a common conduit for metabolic response observed downstream of receptors other than InsR.
[0355] Although the precise mechanism of GIV-IRS1 interaction remains uncertain, this interaction adds GIV to the lengthy list of proteins that IRS1 scaffolds within the insulin signaling cascade (White, 2006). The finding that GIV enhanced tyrosine phosphorylation of IRS1 is consistent with the concomitant increase in the kinase activity of InsR and enhanced recruitment of IRS1 to the PM, the latter is a pre-requisite for maximal tyrosine phosphorylation of IRS1 (Myers et al, 1995; Voliovitch et al, 1995). The studies presented here conclude that GIV is required for maximal PM-recruitment and tyrosine phosphorylation of IRS1, both key events implicated in metabolic insulin signaling via IRS1. In doing so, and by virtue of its ability to directly bind and bring together several other components of the metabolic insulin response (InsR, IRS1, G proteins, actin, PI3K, Akt) GIV serves as an integral hub at the immediate post-receptor which fine-tunes IRS1-dependent metabolic insulin signaling.
[0356] Further downstream, the PI3K-Akt signaling pathway was maximally enhanced in the presence of an intact GIV-GEF, and a major pathway downstream of Akt was triggered, i.e., phosphoinhibition of the Rab-GAP AS160. Prior studies have demonstrated that docking of GSVs at the PM requires activation of Rab proteins (Lansey et al, 2012; Miinea et al, 2005; Sun et al, 2010) in response to insulin (Bai et al, 2007). By triggering the phosphoinhibition of Rab-GAP AS160, GIV's GEF function is likely to affect the exocytosis of GSVs via potentiation of Rab GTPases. The studies presented in this example conclude that GIV functionally interacts with and enhances key signaling events that can also coordinate membrane trafficking within the insulin response cascade, and in doing so, it exemplifies a molecular basis for the observed engagement between these events during insulin-triggered glucose uptake into cells (Leto & Saltiel, 2012).
[0357] Although these studies have specifically dissected the role of GIV's GEF function in coordinating key signaling events that comprise the metabolic insulin response, it is notable that the GEF motif merely represents a 30-35 aa stretch within a 1871 aa long, multimodular protein, which is comprised of several other key functional modules that may take part in other key aspects of glucose uptake. One such well-defined module is GIV's SH2-like domain, which is necessary and sufficient for GIV to directly bind autophosphorylated cytoplasmic tail of InsR; without a functional SH2-like domain, GIV can neither bind InsR, nor facilitate the formation of InsR-G protein complexes (Lin et al, 2014). Another such module, whose boundaries remain to be defined, but appears to be functionally distinct from the GEF module is a region within GIV's C-terminus that directly binds IRS1; it is possible that selective inhibition of GIV-IRS1 interaction may also impair the metabolic insulin response and glucose uptake. The recent findings that GIV regulates cargo trafficking from the ERGIC to the Golgi (Lo et al, 2015) raises the possibility that GIV may also play a role in regulating GLUT4 trafficking from the Golgi to GSVs. Additionally, GIV is also known to regulate clathrin-mediated endocytosis and endocytic trafficking (Beas et al, 2012; Weng et al, 2014), two processes that are closely intertwined with and key determinants of the kinetics of GLUT4 trafficking, glucose uptake and downregulation of insulin receptor signaling. Because the actin cytoskeleton has also been described as a tether for GSVs (Stockli et al, 2011), it is possible that another previously characterized module that enables GIV to remodel the cortical actin cytoskeleton further aids in GSV exocytosis and glucose uptake (Enomoto et al, 2005; Ghosh et al, 2010). Thus, it is likely that many of GIV's modules, and not just its C-terminal GEF motif may play a role in integrating signaling events with vesicular trafficking and cytoskeletal changes to orchestrate glucose uptake after insulin stimulation.
[0358] Selective modulation of GIV-GEF emerges as a therapeutic strategy for reversal of IR. It was found that cell-penetrable GIV peptides were as effective as TZDs in their ability to reverse fatty-acid-induced IR in a GEF-dependent way, and thus, activation of Gi via GIV's GEF mimics the action and matches the potency of TZDs. Because postprandial lipotoxicity can also suppress GIV expression in skeletal muscles (
REFERENCES
[0359] Altiok S, Xu M, Spiegelman BM (1997) PPARgamma induces cell cycle withdrawal: inhibition of E2F/DP DNA-binding activity via down-regulation of PP2A. Genes & development 11: 1987-1998. [0360] Anderson K, Fitzgerald M, Dupont M, Wang T, Paz N, Dorsch M, Healy A, Xu Y, Ocain T, Schopf L, Jaffee B, Picarella D (2006) Mice deficient in PKC theta demonstrate impaired in vivo T cell activation and protection from T cell-mediated inflammatory diseases. Autoimmunity 39: 469-478. [0361] Aroda V R, Ciaraldi T P, Burke P, Mudaliar S, Clopton P, Phillips S, Chang R J, Henry R R (2009) Metabolic and hormonal changes induced by pioglitazone in polycystic ovary syndrome: a randomized, placebo-controlled clinical trial. The Journal of clinical endocrinology and metabolism 94: 469-476. [0362] Bai L, Wang Y, Fan J, Chen Y, Ji W, Qu A, Xu P, James D E, Xu T (2007) Dissecting multiple steps of GLUT4 trafficking and identifying the sites of insulin action. Cell metabolism 5: 47-57. [0363] Beas A O, Taupin V, Teodorof C, Nguyen L T, Garcia-Marcos M, Farquhar M G (2012) Galphas promotes EEA1 endosome maturation and shuts down proliferative signaling through interaction with GIV (Girdin). Molecular biology of the cell 23: 4623-4634. [0364] Carter A M (2005) Inflammation, thrombosis and acute coronary syndromes. Diabetes & vascular disease research: official journal of the International Society of Diabetes and Vascular Disease 2: 113-121. [0365] Chen J F, Guo J H, Moxham C M, Wang H Y, Malbon C C (1997) Conditional, tissue-specific expression of Q205L G alpha i2 in vivo mimics insulin action. J Mol Med (Berl) 75: 283-289. [0366] Cho D H, Choi Y J, Jo S A, Ryou J, Kim J Y, Chung J, Jo I (2006) Troglitazone acutely inhibits protein synthesis in endothelial cells via a novel mechanism involving protein phosphatase 2A-dependent p70 S6 kinase inhibition. American journal of physiology Cell physiology 291: C317-326. [0367] Ciaraldi T P, Maisel A (1989) Role of guanine nucleotide regulatory proteins in insulin stimulation of glucose transport in rat adipocytes. Influence of bacterial toxins. The Biochemical journal 264: 389-396. [0368] Dawson, K., Aviles-Hernandez, A., Cushman, S. W., and Malide, D. (2001). Insulin-regulated trafficking of dual-labeled glucose transporter 4 in primary rat adipose cells. Biochemical and biophysical research communications 287, 445-454. [0369] Dunkel Y, Ong A, Notani D, Mittal Y, Lam M, Mi X, Ghosh P (2012) STAT3 protein up-regulates Galpha-interacting vesicle-associated protein (GIV)/Girdin expression, and GIV enhances STAT3 activation in a positive feedback loop during wound healing and tumor invasion/metastasis. The Journal of biological chemistry 287: 41667-41683. [0370] Eck M J, Dhe-Paganon S, Trub T, Nolte R T, Shoelson S E (1996) Structure of the IRS-1 PTB domain bound to the juxtamembrane region of the insulin receptor. Cell 85: 695-705. [0371] Enomoto A, Murakami H, Asai N, Morone N, Watanabe T, Kawai K, Murakumo Y, Usukura J, Kaibuchi K, Takahashi M (2005) Akt/PKB regulates actin organization and cell motility via Girdin/APE. Developmental cell 9: 389-402. [0372] Fleming I, MacKenzie S J, Vernon R G, Anderson N G, Houslay M D, Kilgour E (1998) Protein kinase C isoforms play differential roles in the regulation of adipocyte differentiation. The Biochemical journal 333 (Pt 3): 719-727. [0373] Flores-Riveros J R, Sibley E, Kastelic T, Lane M D (1989) Substrate phosphorylation catalyzed by the insulin receptor tyrosine kinase. Kinetic correlation to autophosphorylation of specific sites in the beta subunit. The Journal of biological chemistry 264: 21557-21572. [0374] Garcia-Marcos, M., Kietrsunthorn, P. S., Pavlova, Y., Adia, M. A., Ghosh, P., and Farquhar, M. G. (2012). Functional characterization of the guanine nucleotide exchange factor (GEF) motif of GIV protein reveals a threshold effect in signaling. Proceedings of the National Academy of Sciences of the United States of America 109, 1961-1966. [0375] Garcia-Marcos M, Ear J, Farquhar M G, Ghosh P (2011) A GDI (AGS3) and a GEF (GIV) regulate autophagy by balancing G protein activity and growth factor signals. Molecular biology of the cell 22: 673-686. [0376] Garcia-Marcos M, Ghosh P, Ear J, Farquhar M G (2010) A structural determinant that renders G alpha(i) sensitive to activation by GIV/girdin is required to promote cell migration. The Journal of biological chemistry 285: 12765-12777. [0377] Garcia-Marcos M, Ghosh P, Farquhar M G (2009) GIV is a nonreceptor GEF for G alpha i with a unique motif that regulates Akt signaling. Proc Natl Acad Sci USA 106: 3178-3183. [0378] Garcia-Marcos M, Ghosh P, Farquhar M G (2015) GIV/Girdin transmits signals from multiple receptors by triggering trimeric G protein activation. The Journal of biological chemistry 290: 6697-6704. [0379] Ghosh P, Beas A O, Bornheimer S J, Garcia-Marcos M, Forry E P, Johannson C, Ear J, Jung B H, Cabrera B, Carethers J M, Farquhar M G (2010) A G{alpha}i-GIV molecular complex binds epidermal growth factor receptor and determines whether cells migrate or proliferate. Molecular biology of the cell 21: 2338-2354. [0380] Ghosh P, Garcia-Marcos M, Bornheimer S J, Farquhar M G (2008) Activation of Galphai3 triggers cell migration via regulation of GIV. J Cell Biol 182: 381-393. [0381] Gohla A, Klement K, Nurnberg B (2007) The heterotrimeric G protein G(i3) regulates hepatic autophagy downstream of the insulin receptor. Autophagy 3: 393-395. [0382] Goodyear L J, Giorgino F, Sherman L A, Carey J, Smith R J, Dohm G L (1995) Insulin receptor phosphorylation, insulin receptor substrate-1 phosphorylation, and phosphatidylinositol 3-kinase activity are decreased in intact skeletal muscle strips from obese subjects. The Journal of clinical investigation 95: 2195-2204. [0383] Griffin M E, Marcucci M J, Cline G W, Bell K, Barucci N, Lee D, Goodyear L J, Kraegen E W, White M F, Shulman G I (1999) Free fatty acid-induced insulin resistance is associated with activation of protein kinase C theta and alterations in the insulin signaling cascade. Diabetes 48: 1270-1274. [0384] Haasch D, Berg C, Clampit J E, Pederson T, Frost L, Kroeger P, Rondinone C M (2006) PKCtheta is a key player in the development of insulin resistance. Biochemical and biophysical research communications 343: 361-368. [0385] Haga, Y., Ishii, K., and Suzuki, T. (2011). N-glycosylation is critical for the stability and intracellular trafficking of glucose transporter GLUT4. The Journal of biological chemistry 286, 31320-31327. [0386] Hartung A, Ordelheide A M, Staiger H, Melzer M, Haring H U, Lammers R (2013) The Akt substrate Girdin is a regulator of insulin signaling in myoblast cells. Biochimica et biophysica acta 1833: 2803-2811. [0387] Hoehn K L, Hohnen-Behrens C, Cederberg A, Wu L E, Turner N, Yuasa T, Ebina Y, James D E (2008) IRS1-independent defects define major nodes of insulin resistance. Cell metabolism 7: 421-433. [0388] Huang B, Babcock H, Zhuang X (2010) Breaking the diffraction barrier: super-resolution imaging of cells. Cell 143: 1047-1058. [0389] Hwang H, Bowen B P, Lefort N, Flynn C R, De Filippis E A, Roberts C, Smoke C C, Meyer C, Hojlund K, Yi Z, Mandarino L J (2010) Proteomics analysis of human skeletal muscle reveals novel abnormalities in obesity and type 2 diabetes. Diabetes 59: 33-42. [0390] Imamura T, Vollenweider P, Egawa K, Clodi M, Ishibashi K, Nakashima N, Ugi S, Adams J W, Brown J H, Olefsky J M (1999) G alpha-q/11 protein plays a key role in insulin-induced glucose transport in 3T3-L1 adipocytes. Molecular and cellular biology 19: 6765-6774. [0391] Itani S I, Zhou Q, Portes W J, MacDonald K G, Dohm G L (2000) Involvement of protein kinase C in human skeletal muscle insulin resistance and obesity. Diabetes 49: 1353-1358. [0392] Jans, A., Konings, E., Goossens, G. H., Bouwman, F. G., Moors, C. C., Boekschoten, M. V., Afman, L. A., Muller, M., Mariman, E. C., and Blaak, E. E. (2012). PUFAs acutely affect triacylglycerol-derived skeletal muscle fatty acid uptake and increase postprandial insulin sensitivity. The American journal of clinical nutrition 95, 825-836. [0393] Kahn B B, Flier J S (2000) Obesity and insulin resistance. The Journal of clinical investigation 106: 473-481. [0394] Kanoh Y, Ishizuka T, Morita H, Ishizawa M, Miura A, Kajita K, Kimura M, Suzuki T, Sakuma H, Yasuda K (2000) Effect of pertussis toxin on insulin-induced signal transduction in rat adipocytes and soleus muscles. Cellular signalling 12: 223-232. [0395] Kim J K, Fillmore J J, Sunshine M J, Albrecht B, Higashimori T, Kim D W, Liu Z X, Soos T J, Cline G W, O'Brien W R, Littman D R, Shulman G I (2004) PKC-theta knockout mice are protected from fat-induced insulin resistance. The Journal of clinical investigation 114: 823-827. [0396] Kim, J. A., Yeh, D. C., Ver, M., Li, Y., Carranza, A., Conrads, T. P., Veenstra, T. D., Harrington, M. A., and Quon, M. J. (2005). Phosphorylation of Ser24 in the pleckstrin homology domain of insulin receptor substrate-1 by Mouse Pelle-like kinase/interleukin-1 receptor-associated kinase: cross-talk between inflammatory signaling and insulin signaling that may contribute to insulin resistance. The Journal of biological chemistry 280, 23173-23183. [0397] Knowlden J M, Jones H E, Barrow D, Gee J M, Nicholson R I, Hutcheson I R (2008) Insulin receptor substrate-1 involvement in epidermal growth factor receptor and insulin-like growth factor receptor signalling: implication for Gefitinib (Iressa) response and resistance. Breast cancer research and treatment 111: 79-91. [0398] Kreuzer J, Nurnberg B, Krieger-Brauer H I (2004) Ligand-dependent autophosphorylation of the insulin receptor is positively regulated by Gi-proteins. The Biochemical journal 380: 831-836. [0399] Krook A, Moller D E, Dib K, O'Rahilly S (1996) Two naturally occurring mutant insulin receptors phosphorylate insulin receptor substrate-1 (IRS-1) but fail to mediate the biological effects of insulin. Evidence that IRS-1 phosphorylation is not sufficient for normal insulin action. The Journal of biological chemistry 271: 7134-7140. [0400] Krupinski J, Rajaram R, Lakonishok M, Benovic J L, Cerione R A (1988) Insulin-dependent phosphorylation of GTP-binding proteins in phospholipid vesicles. The Journal of biological chemistry 263: 12333-12341. [0401] Lansey M N, Walker N N, Hargett S R, Stevens J R, Keller S R (2012) Deletion of Rab GAP AS160 modifies glucose uptake and GLUT4 translocation in primary skeletal muscles and adipocytes and impairs glucose homeostasis. American journal of physiology Endocrinology and metabolism 303: E1273-1286. [0402] Le-Niculescu H, Niesman I, Fischer T, DeVries L, Farquhar M G (2005) Identification and characterization of GIV, a novel Galpha i/s-interacting protein found on COPI, endoplasmic reticulum-Golgi transport vesicles. The Journal of biological chemistry 280: 22012-22020. [0403] Le Roith D, Zick Y (2001) Recent advances in our understanding of insulin action and insulin resistance. Diabetes care 24: 588-597. [0404] Leto D, Saltiel A R (2012) Regulation of glucose transport by insulin: traffic control of GLUT4. Nature reviews Molecular cell biology 13: 383-396. [0405] Li Y, Soos T J, Li X, Wu J, Degennaro M, Sun X, Littman D R, Birnbaum M J, Polakiewicz R D (2004) Protein kinase C Theta inhibits insulin signaling by phosphorylating IRS1 at Ser(1101). The Journal of biological chemistry 279: 45304-45307. [0406] Lin C, Ear J, Midde K, Lopez-Sanchez I, Aznar N, Garcia-Marcos M, Kufareva I, Abagyan R, Ghosh P (2014) Structural basis for activation of trimeric Gi proteins by multiple growth factor receptors via GIV/Girdin. Molecular biology of the cell. [0407] Lin C, Ear J, Pavlova Y, Mittal Y, Kufareva I, Ghassemian M, Abagyan R, Garcia-Marcos M, Ghosh P (2011) Tyrosine phosphorylation of the Galpha-interacting protein GIV promotes activation of phosphoinositide 3-kinase during cell migration. Sci Signal 4: ra64. [0408] Lin X, O'Mahony A, Mu Y, Geleziunas R, Greene W C (2000) Protein kinase C-theta participates in NF-kappaB activation induced by CD3-CD28 costimulation through selective activation of IkappaB kinase beta. Molecular and cellular biology 20: 2933-2940. [0409] Lo I C, Gupta V, Midde K K, Taupin V, Lopez-Sanchez I, Kufareva I, Abagyan R, Randazzo P A, Farquhar M G, Ghosh P (2015) Activation of Galphai at the Golgi by GIV/Girdin imposes finiteness in Arf1 signaling. Developmental cell 33: 189-203. [0410] Lopez-Sanchez I, Dunkel Y, Roh Y S, Mittal Y, De Minicis S, Muranyi A, Singh S, Shanmugam K, Aroonsakool N, Murray F, Ho S B, Seki E, Brenner D A, Ghosh P (2014) GIV/Girdin is a central hub for profibrogenic signalling networks during liver fibrosis. Nat Commun 5: 4451. [0411] Lopez-Sanchez I, Garcia-Marcos M, Mittal Y, Aznar N, Farquhar M G, Ghosh P (2013) Protein kinase C-theta (PKCtheta) phosphorylates and inhibits the guanine exchange factor, GIV/Girdin. Proc Natl Acad Sci USA 110: 5510-5515. [0412] Lovejoy, J. C. (2002). The influence of dietary fat on insulin resistance. Current diabetes reports 2, 435-440. [0413] Ma G, Aznar N, Kangrioloulos N, Midde K, Lopez-Sanchez I, Dunkel Y, Sato E., R. G, Ghosh P (2015) Therapeutic Effects of Cell-Permeant GIV peptides that Activate G Proteins downstream of Growth Factors. Accepted, In press, PNAS. [0414] Maegawa H, Shigeta Y, Egawa K, Kobayashi M (1991) Impaired autophosphorylation of insulin receptors from abdominal skeletal muscles in nonobese subjects with NIDDM. Diabetes 40: 815-819. [0415] Markova I, Zidek V, Musilova A, Simakova M, Mlejnek P, Kazdova L, Pravenec M (2010) Long-term pioglitazone treatment augments insulin sensitivity and PKC-epsilon and PKC-theta activation in skeletal muscles in sucrose fed rats. Physiological research/Academia Scientiarum Bohemoslovaca 59: 509-516. [0416] Mashili F, Chibalin A V, Krook A, Zierath J R (2013) Constitutive STAT3 phosphorylation contributes to skeletal muscle insulin resistance in type 2 diabetes. Diabetes 62: 457-465. [0417] Midde K K, Aznar N, Laederich M B, Ma G S, Kunkel M T, Newton A C, Ghosh P (2015) Multimodular biosensors reveal a novel platform for activation of G proteins by growth factor receptors. Proc Natl Acad Sci USA 112: E937-946. [0418] Miinea C P, Sano H, Kane S, Sano E, Fukuda M, Peranen J, Lane W S, Lienhard G E (2005) AS160, the Akt substrate regulating GLUT4 translocation, has a functional Rab GTPase-activating protein domain. The Biochemical journal 391: 87-93. [0419] Moxham C M, Malbon C C (1996) Insulin action impaired by deficiency of the G-protein subunit G ialpha2. Nature 379: 840-844. [0420] Myers M G, Jr., Grammer T C, Brooks J, Glasheen E M, Wang L M, Sun X J, Blenis J, Pierce J H, White M F (1995) The pleckstrin homology domain in insulin receptor substrate-1 sensitizes insulin signaling. The Journal of biological chemistry 270: 11715-11718. [0421] Nagahara, H., Vocero-Akbani, A. M., Snyder, E. L., Ho, A., Latham, D. G., Lissy, N. A., Becker-Hapak, M., Ezhevsky, S. A., and Dowdy, S. F. (1998). Transduction of full-length TAT fusion proteins into mammalian cells: TAT-p27Kip1 induces cell migration. Nature medicine 4, 1449-1452. [0422] Nolan J J, Freidenberg G, Henry R, Reichart D, Olefsky J M (1994) Role of human skeletal muscle insulin receptor kinase in the in vivo insulin resistance of noninsulin-dependent diabetes mellitus and obesity. The Journal of clinical endocrinology and metabolism 78: 471-477. [0423] O'Brien R M, Houslay M D, Milligan G, Siddle K (1987) The insulin receptor tyrosyl kinase phosphorylates holomeric forms of the guanine nucleotide regulatory proteins Gi and Go. FEBS letters 212: 281-288. [0424] Pessin J E, Saltiel A R (2000) Signaling pathways in insulin action: molecular targets of insulin resistance. The Journal of clinical investigation 106: 165-169. [0425] Pugazhenthi S, Khandelwal R L (1998) Insulin action on protein phosphatase-1 activation is enhanced by the antidiabetic agent pioglitazone in cultured diabetic hepatocytes. Molecular and cellular biochemistry 182: 185-191. [0426] Qiao, L. Y., Goldberg, J. L., Russell, J. C., and Sun, X. J. (1999). Identification of enhanced serine kinase activity in insulin resistance. The Journal of biological chemistry 274, 10625-10632. [0427] Roszik, J., Lisboa, D., Szollosi, J., and Vereb, G. (2009). Evaluation of intensity-based ratiometric FRET in image cytometryapproaches and a software solution. Cytometry Part A: the journal of the International Society for Analytical Cytology 75, 761-767. [0428] Rothenberg P L, Kahn C R (1988) Insulin inhibits pertussis toxin-catalyzed ADP-ribosylation of G-proteins. Evidence for a novel interaction between insulin receptors and G-proteins. The Journal of biological chemistry 263: 15546-15552. [0429] Rundek T, Gardener H, Xu Q, Goldberg R B, Wright C B, Boden-Albala B, Disla N, Paik M C, Elkind M S, Sacco R L (2010) Insulin resistance and risk of ischemic stroke among nondiabetic individuals from the northern Manhattan study. Archives of neurology 67: 1195-1200. [0430] Sakurai-Yageta, M., Recchi, C., Le Dez, G., Sibarita, J. B., Daviet, L., Camonis, J., D'Souza-Schorey, C., and Chavrier, P. (2008). The interaction of IQGAP1 with the exocyst complex is required for tumor cell invasion downstream of Cdc42 and RhoA. The Journal of cell biology 181, 985-998. [0431] Saltiel A R, Kahn C R (2001) Insulin signalling and the regulation of glucose and lipid metabolism. Nature 414: 799-806. [0432] Sato M, Ozawa T, Inukai K, Asano T, Umezawa Y (2002) Fluorescent indicators for imaging protein phosphorylation in single living cells. Nature biotechnology 20: 287-294. [0433] Schmitz-Peiffer C, Browne C L, Oakes N D, Watkinson A, Chisholm D J, Kraegen E W, Biden T J (1997) Alterations in the expression and cellular localization of protein kinase C isozymes epsilon and theta are associated with insulin resistance in skeletal muscle of the high-fat-fed rat. Diabetes 46: 169-178. [0434] Sharma C, Pradeep A, Pestell R G, Rana B (2004) Peroxisome proliferator-activated receptor gamma activation modulates cyclin D1 transcription via beta-catenin-independent and cAMP-response element-binding protein-dependent pathways in mouse hepatocytes. The Journal of biological chemistry 279: 16927-16938. [0435] Shulman G I (2000) Cellular mechanisms of insulin resistance. The Journal of clinical investigation 106: 171-176. [0436] Song X, Zheng X, Malbon C C, Wang H (2001) Galpha i2 enhances in vivo activation of and insulin signaling to GLUT4. The Journal of biological chemistry 276: 34651-34658. [0437] Stockli J, Fazakerley D J, James D E (2011) GLUT4 exocytosis. Journal of cell science 124: 4147-4159. [0438] Studier, F. W. (2005). Protein production by auto-induction in high density shaking cultures. Protein expression and purification 41, 207-234. [0439] Sun X J, Rothenberg P, Kahn C R, Backer J M, Araki E, Wilden P A, Cahill D A, Goldstein B J, White M F (1991) Structure of the insulin receptor substrate IRS-1 defines a unique signal transduction protein. Nature 352: 73-77. [0440] Sun Y, Bilan P J, Liu Z, Klip A (2010) Rab8A and Rab13 are activated by insulin and regulate GLUT4 translocation in muscle cells. Proc Natl Acad Sci USA 107: 19909-19914. [0441] Taniguchi C M, Emanuelli B, Kahn C R (2006) Critical nodes in signalling pathways: insights into insulin action. Nature reviews Molecular cell biology 7: 85-96. [0442] Thorburn A W, Gumbiner B, Bulacan F, Wallace P, Henry R R (1990) Intracellular glucose oxidation and glycogen synthase activity are reduced in non-insulin-dependent (type II) diabetes independent of impaired glucose uptake. The Journal of clinical investigation 85: 522-529. [0443] Uhlen M, Oksvold P, Fagerberg L, Lundberg E, Jonasson K, Forsberg M, Zwahlen M, Kampf C, Wester K, Hober S, Wernerus H, Bjorling L, Ponten F (2010) Towards a knowledge-based Human Protein Atlas. Nature biotechnology 28: 1248-1250. [0444] Voliovitch H, Schindler D G, Hadari Y R, Taylor S I, Accili D, Zick Y (1995) Tyrosine phosphorylation of insulin receptor substrate-1 in vivo depends upon the presence of its pleckstrin homology region. The Journal of biological chemistry 270: 18083-18087. [0445] Weng L, Enomoto A, Miyoshi H, Takahashi K, Asai N, Morone N, Jiang P, An J, Kato T, Kuroda K, Watanabe T, Asai M, Ishida-Takagishi M, Murakumo Y, Nakashima H, Kaibuchi K, Takahashi M (2014) Regulation of cargo-selective endocytosis by dynamin 2 GTPase-activating protein girdin. EMBO J 33: 2098-2112. [0446] White M F (2006) Regulating insulin signaling and beta-cell function through IRS proteins. Canadian journal of physiology and pharmacology 84: 725-737. [0447] White M F, Shoelson S E, Keutmann H, Kahn C R (1988) A cascade of tyrosine autophosphorylation in the beta-subunit activates the phosphotransferase of the insulin receptor. The Journal of biological chemistry 263: 2969-2980. [0448] Wunderlich C M, Hovelmeyer N, Wunderlich F T (2013) Mechanisms of chronic JAK-STAT3-SOCS3 signaling in obesity. Jak-Stat 2: e23878. [0449] Xiong, X., Xu, Q., Huang, Y., Singh, R. D., Anderson, R., Leof, E., Hu, J., and Ling, K. (2012). An association between type Igamma PI4P 5-kinase and Exo70 directs E-cadherin clustering and epithelial polarization. Molecular biology of the cell 23, 87-98. [0450] Yamamoto N, Sato T, Kawasaki K, Murosaki S, Yamamoto Y (2006) A nonradioisotope, enzymatic assay for 2-deoxyglucose uptake in L6 skeletal muscle cells cultured in a 96-well microplate. Analytical biochemistry 351: 139-145. [0451] Yu C, Chen Y, Cline G W, Zhang D, Zong H, Wang Y, Bergeron R, Kim J K, Cushman S W, Cooney G J, Atcheson B, White M F, Kraegen E W, Shulman G I (2002) Mechanism by which fatty acids inhibit insulin activation of insulin receptor substrate-1 (IRS-1)-associated phosphatidylinositol 3-kinase activity in muscle. The Journal of biological chemistry 277: 50230-50236
[0452] The present invention is not to be limited in scope by the specific embodiments described herein. Indeed, various modifications of the invention in addition to those described herein will become apparent to those skilled in the art from the foregoing description. Such modifications are intended to fall within the scope of the appended claims.
All patents, applications, publications, test methods, literature, and other materials cited herein are hereby incorporated by reference in their entirety as if physically present in this specification.