NUCLEIC ACID CONSTRUCT
20180100163 ยท 2018-04-12
Inventors
Cpc classification
C07K2319/33
CHEMISTRY; METALLURGY
C07K2319/06
CHEMISTRY; METALLURGY
C07K14/70596
CHEMISTRY; METALLURGY
C07K2319/04
CHEMISTRY; METALLURGY
C12N15/86
CHEMISTRY; METALLURGY
International classification
C12N15/86
CHEMISTRY; METALLURGY
C07K14/705
CHEMISTRY; METALLURGY
Abstract
The present invention provides a nucleic acid construct comprising the following structure: A-X-B in which A and B are nucleic acid sequences encoding a first and a second polypeptide of interest (POI); and X is a nucleic acid sequence which encodes a cleavage site, wherein either the first or second POI is a transmembrane protein which comprises an intracellular retention signal.
Claims
1. A nucleic acid construct comprising the following structure:
A-X-B in which (a) A and B are nucleic acid sequences encoding a first and a second polypeptide of interest (POI), and (b) X is a nucleic acid sequence which encodes a cleavage site, wherein either the first or second POI is a transmembrane protein which comprises an intracellular retention signal.
2. The nucleic acid construct according to claim 1 wherein the transmembrane protein comprises an endodomain which comprises the intracellular retention signal.
3. (canceled)
4. The nucleic acid construct according to claim 1 wherein the intracellular retention signal directs the transmembrane protein to a membrane-bound intracellular compartment.
5. The nucleic acid construct according to claim 1 wherein the intracellular retention signal directs the transmembrane protein to a lysozomal, endosomal or Golgi compartment.
6. The nucleic acid construct according to claim 1 wherein the intracellular retention signal is selected from the following group consisting of: an endocytosis signal; a Golgi retention signal; a trans-Golgi network (TGN) recycling signal; an endoplasmic reticulum (ER) retention signal; and a lysosomal sorting signal.
7-11. (canceled)
12. The nucleic acid construct according to claim 1 wherein the intracellular retention signal is proximal to a transmembrane domain of the transmembrane protein.
13. The nucleic acid construct according to claim 1 wherein the intracellular retention signal is distal to a transmembrane domain of the transmembrane protein.
14. The nucleic acid construct according to claim 1 wherein X is a nucleic acid sequence encoding a self-cleaving peptide, a furin cleavage site or a Tobacco Etch Virus cleavage site.
15. The nucleic acid construct according to claim 14, wherein X encodes a 2A self-cleaving peptide from an aphtho- or a cardiovirus or a 2A-like peptide.
16. The nucleic acid construct according to claim 1, wherein the transmembrane protein is a Chimeric-antigen receptor (CAR).
17. The nucleic acid construct according to claim 1, wherein each of the first and second POIs is a transmembrane protein; wherein at least one of the transmembrane proteins comprises an intracellular retention signal.
18. The nucleic acid construct according to claim 1 wherein one or both of the first and second POIs is a single pass transmembrane protein.
19. The nucleic acid construct according to claim 18 wherein one or both of the first and second POIs is a type I transmembrane protein.
20. A nucleic acid construct comprising the following structure:
A-X-B-Y-C in which (a) A, B and C are nucleic acid sequences encoding a first, second and third polypeptides of interest (POIs), and (b) X and Y are nucleic acid sequences which may be the same or different, each of which encodes a cleavage site, wherein at least two of the POIs are transmembrane proteins which comprise an intracellular retention signal.
21. The nucleic acid construct according to claim 20, wherein the at least two which are transmembrane proteins and which comprise an intracellular retention signal: (a) comprise different intracellular retention signals; and/or (b) have the intracellular retention signal located at a different position in the POI, such that when the nucleic acid is expressed in a cell, there is differential relative expression of the at least two POIs at the cell surface.
22. A vector comprising a nucleic acid construct according to claim 1.
23. A retroviral vector or a lentiviral vector or a transposon according to claim 22.
24. A cell comprising a nucleic acid construct according to claim 1.
25. A method for modulating the relative cell surface expression of a transmembrane protein expressed from a single nucleic acid construct with a second protein by including an intracellular retention signal in the nucleic acid sequence which encodes the transmembrane protein.
26. (canceled)
27. A cell comprising a vector according to claim 22.
Description
DESCRIPTION OF THE FIGURES
[0048]
[0049] (a) Two different promoters within the same cassette result in two different transcripts which each give rise to separate proteins. (b) Use of an Internal Ribosome Entry sequence (IRES) leads to a single transcript which is translated into two separate proteins. (c) Use of the FMDV 2A peptide results in a single transcript, and a single polyprotein which rapidly cleaves into two separate proteins.
[0050]
[0051] Tyrp1 is a type I transmembrane protein, 537aa long. The di-leucine motif, which retains the protein in the intracellular compartment, is indicated as a black rectangle on the cytoplasmic domain. (A) Tyrp1 (wt). Wild type Tyrp1 consists of a peptide signal, a luminal domain, a transmembrane domain, and a cytoplasmic domain. The cytoplasmic domain contains the di-leucine retention signal. (B) Tyrp1 (wt)-SG Linker- eGFP. This construct contains the wild type Tyrp1 simply fused to eGFP via a serine-glycine-glycine-glycine-serine linker. The Tyrp1-L-eGFP represents the cytoplasmic- proximal Tyrp1. (C) Tyrp1 Lumenal (LM)-Transmembrane (TM)- SG Linker- eGFP- Tyrp1 Cytoplasmic (CP). This construct constitutes the cytoplasmic- distal Tyrp1, since SG linker- eGFP interposes between the transmembrane and cytoplasmic domains. D: Tyrp1 Lumenal (LM)- Transmembrane (TM)-SG Linker- eGFP. This construct serves as the positive control, as the cytoplasmic domain containing the retention signal has been excluded. All constructs are co-expressed with IRES.CD34. Staining of transduced SupT1 cells is shown with intracellular and surface staining bottom left/right respectively.
[0052]
[0053] A construct was generated which co-expresses an anti-CD19 and an anti-CD33 CAR using a FMD-2A like peptide. Two variants of this construct were also generated: in the first variant, the di-leucine motif from TYRP1 was inserted into the anti-CD19 CAR endodomain just proximal to the TM domain; in the second variant the same TYRP1 di-lecuine motif was attached to the carboxy-terminus of the anti-CD19 CAR endodomain. PBMCs were isolated from blood and stimulated using PHA and IL-2. Two days later the cells were transduced on retronectin coated plates with retro virus containing the different CD19:CD33 CAR constructs. On day 5 the expression level of the two CARs translated by the construct was evaluated via flow cytometry using recombinant CD19-Fc and CD33-Fc fusions. A. Shows cartoon of the synthetic gene constructed to allow co-expression; B. Shows a cartoon of the subsequent pairs of proteins generated by the three constructs; C. Shows expression of the two receptors by flow-cytometry. In the original construct, both CARs are equally expressed. With incorporation of the di-leucine motif distally in the endodomain of the anti-CD19 CAR, the CD33 CAR expression remains constant but the CD19 expression drops to intermediate levels. With incorporation of the di-leucine motif proximally in the endodomain of the anti-CD19 CAR, the CD33 CAR expression remains constant, but the CD19 expression drops to low levels.
[0054]
[0055] A construct was generated which co-expresses an anti-CD19 and an anti-CD33 CAR using a FMD-2A like peptide. Two variants of this construct were also generated: in the first variant, the last 6aa from E3/19K (DEKKMP), which were found to be critical for its Golgi/ER retention ability, were attached to the carboxy-terminus of the anti-CD33 CAR endodomain; in the second variant, the entire cytosolic tail of adenovirus E3/19K protein was attached to the carboxy-terminus of the anti-CD33 CAR endodomain
[0056]
[0057] The constructs shown in
DETAILED DESCRIPTION
[0058] The present invention provides a nucleic acid construct comprising the following structure:
A-X-B
[0059] in which;
[0060] A and B are nucleic acid sequences encoding a first and a second polypeptide of interest (POI); and
[0061] X is a nucleic acid sequence which encodes a cleavage site,
[0062] wherein either the first or second POI is a transmembrane protein which comprises an intracellular retention signal.
Transmembrane Protein
[0063] The present invention enables modulation of the relative expression of a transmembrane surface protein. The transmembrane surface protein is a protein which, in the absence of an intracellular retention signal, is expressed at the cell surface. When expressed at the cell surface at least one domain of the transmembrane protein is exoplasmic (i.e. on the exterior of the cell).
[0064] The transmembrane protein may be a single-pass transmembrane protein, i.e. it may comprise a single transmembrane domain or it may comprise multiple transmembrane domains.
[0065] Transmembrane proteins may be classified by topology i.e. with reference to the position of the N- and C-terminal domains. Types I, II, and III transmembrane proteins are single-pass molecules, while type IV trans-membrane proteins are multiple-pass molecules. Type I transmembrane proteins are anchored to the lipid membrane with a stop-transfer anchor sequence and have their N-terminal domains targeted to the ER lumen during synthesis (and the extracellular space, when the mature form is located on the plasma membrane). Type II and III are anchored with a signal-anchor sequence, with type II being targeted to the ER lumen with its C-terminal domain, while type III have their N-terminal domains targeted to the ER lumen. Type IV is subdivided into IV-A, with their N-terminal domains targeted to the cytosol and IV-B, with an N-terminal domain targeted to the lumen.
[0066] The transmembrane protein(s) of the present invention may be any of the types I-IV.
[0067] The transmembrane domain may be any protein structure which is thermodynamically stable in a membrane. This is typically an alpha helix comprising of several hydrophobic residues. The transmembrane domain of any transmembrane protein can be used to supply the transmembrane portion. The presence and span of a transmembrane domain of a protein can be determined by those skilled in the art using the TMHMM algorithm (http://www.cbs.dtu.dk/services/TMHMM-2.0/). Further, given that the transmembrane domain of a protein is a relatively simple structure, i.e a polypeptide sequence predicted to form a hydrophobic alpha helix of sufficient length to span the membrane, an artificially designed TM domain may also be used (U.S. Pat. No. 7,052,906 B1 describes synthetic transmembrane components).
[0068] The transmembrane domain may be derived from CD28, which gives good stability.
[0069] The structure and processing of Type I transmembrane proteins is well known in the art. Such proteins typically comprise an extracellular domain, a transmembrane domain and an intracellular endodomain and are single-pass molecules with a single ?-helix passing through the cell membrane.
[0070] Type I transmembrane proteins typically have a signal peptide which is quickly recognized by the endoplasmic reticulum (ER) and the protein in translation is therefore quickly re-directed into the ER. A hydrophobic helix locks then anchors the protein in the membrane of the ER.
[0071] As mentioned above, Type I transmembrane proteins are anchored to the lipid membrane with a stop-transfer anchor sequence. The stop-transfer sequence halts the further translocation of the polypeptide and acts as a transmembrane anchor.
[0072] As used herein, the term Type I transmembrane protein encompasses any protein which comprises a Type I transmembrane domain and a stop-transfer anchor sequence and is, in the absence of an exogenous intracellular retention signal, targeted for expression on the cell surface.
[0073] Various type 1 transmembrane proteins which are suitable for use in the present invention are known in the art. Such proteins include, but are not limited to inhibitory receptors, stimulatory receptors, cytokine receptors and G-Proteins.
[0074] The transmembrane protein(s) may be a T-cell receptor ? or ? chain.
[0075] The transmembrane protein(s) may be a Chimeric Antigen Receptor (CAR).
[0076] CARs are proteins which graft an antigen binding domain to the effector function of a T-cell. Their usual form is that of a type I transmembrane domain protein with an antigen recognizing amino terminus, a spacer, a transmembrane domain all connected to a compound endodomain which transmits T-cell survival and activation signals.
[0077] The antigen binding domain may be derived from an antibody or antibody mimetic, or it may be another entity which specifically binds the antigen, such as a ligand.
[0078] The most common form of these molecules are fusions of single-chain variable fragments (scFv) derived from monoclonal antibodies which recognize a target antigen, fused via a spacer and a trans-membrane domain to a signaling endodomain. Such molecules result in activation of the T-cell in response to recognition by the scFv of its target. When T cells express such a CAR, they recognize and kill target cells that express the target antigen. Several CARs have been developed against tumour associated antigens, and adoptive transfer approaches using such CAR-expressing T cells are currently in clinical trial for the treatment of various cancers.
[0079] It is also possible for the signalling endodomain to be present on a separate molecule. The term CAR in connection with the present invention also encompasses a molecule which comprises an antigen binding domain connected to a transmembrane domain. Such a CAR may be capable of interacting with an intracellular signalling domain in order to stimulate T-cell activation.
[0080] In the present invention, either of the nucleic acid sequences A or B may be a nucleic acid sequence which encodes a transmembrane protein comprising an intracellular retention signal.
[0081] Most transmembrane proteins of interest are only active, or are predominantly active when at the cell membrane. Therefore causing a proportion of the protein to be retained intracellularly reduces the relative expression of the protein at the cell surface and therefore reduces the relative activity of the protein.
Signal Sequence
[0082] The transmembrane protein may also comprise a signal sequence so that when the transmembrane protein is expressed inside a cell the nascent protein is directed to the endoplasmic reticulum (ER).
[0083] The core of the signal peptide may contain a long stretch of hydrophobic amino acids that has a tendency to form a single alpha-helix. The signal peptide may begin with a short positively charged stretch of amino acids, which helps to enforce proper topology of the polypeptide during translocation. At the end of the signal peptide there is typically a stretch of amino acids that is recognized and cleaved by signal peptidase. Signal peptidase may cleave either during or after completion of translocation to generate a free signal peptide and a mature protein. The free signal peptides are then digested by specific proteases.
[0084] The signal peptide may be at the amino terminus of the molecule.
Cleavage Site
[0085] The present nucleic acid construct comprises a sequence encoding a cleavage site positioned between nucleic acid sequences which encode first and second polypeptides, such that first and second polypeptides can be expressed as separate entities.
[0086] The cleavage site may be any sequence which enables the polypeptide comprising the first and second POIs to become separated.
[0087] The term cleavage is used herein for convenience, but the cleavage site may cause the first and second POIs to separate into individual entities by a mechanism other than classical cleavage. For example, for the Foot-and-Mouth disease virus (FMDV) 2A self-cleaving peptide (see below), various models have been proposed for to account for the cleavage activity: proteolysis by a host-cell proteinase, autoproteolysis or a translational effect (Donnelly et al (2001) J. Gen. Virol. 82:1027-1041). The exact mechanism of such cleavage is not important for the purposes of the present invention, as long as the cleavage site, when positioned between nucleic acid sequences which encode first and second polypeptides, causes the first and second polypeptides to be expressed as separate entities.
[0088] The cleavage site may be a furin cleavage site.
[0089] Furin is an enzyme which belongs to the subtilisin-like proprotein convertase family. The members of this family are proprotein convertases that process latent precursor proteins into their biologically active products. Furin is a calcium-dependent serine endoprotease that can efficiently cleave precursor proteins at their paired basic amino acid processing sites. Examples of furin substrates include proparathyroid hormone, transforming growth factor beta 1 precursor, proalbumin, pro-beta-secretase, membrane type-1 matrix metalloproteinase, beta subunit of pro-nerve growth factor and von Willebrand factor. Furin cleaves proteins just downstream of a basic amino acid target sequence (canonically, Arg-X-(Arg/Lys)-Arg) and is enriched in the Golgi apparatus.
[0090] The cleavage site may be a Tobacco Etch Virus (TEV) cleavage site.
[0091] TEV protease is a highly sequence-specific cysteine protease which is chymotrypsin-like proteases. It is very specific for its target cleavage site and is therefore frequently used for the controlled cleavage of fusion proteins both in vitro and in vivo. The consensus TEV cleavage site is ENLYFQ\S (where \ denotes the cleaved peptide bond). Mammalian cells, such as human cells, do not express TEV protease. Thus in embodiments in which the present nucleic acid construct comprises a TEV cleavage site and is expressed in a mammalian cellexogenous TEV protease must also expressed in the mammalian cell.
[0092] The cleavage site may encode a self-cleaving peptide.
[0093] A self-cleaving peptide refers to a peptide which functions such that when the polypeptide comprising the first and second POIs and the self-cleaving peptide is produced, it is immediately cleaved or separated into distinct and discrete first and second polypeptides without the need for any external cleavage activity.
[0094] The self-cleaving peptide may be a 2A self-cleaving peptide from an aphtho- or a cardiovirus. The primary 2A/2B cleavage of the aptho- and cardioviruses is mediated by 2A cleaving at its own C-terminus. In apthoviruses, such as foot-and-mouth disease viruses (FMDV) and equine rhinitis A virus, the 2A region is a short section of about 18 amino acids, which, together with the N-terminal residue of protein 2B (a conserved proline residue) represents an autonomous element capable of mediating cleavage at its own C-terminus.
[0095] The C-terminal 19 amino acids of the longer cardiovirus protein, together with the N-terminal proline of 2B mediate cleavage with an efficiency approximately equal to the apthovirus FMDV 2a sequence. Cardioviruses include encephalomyocarditis virus (EMCV) and Theiler's murine encephalitis virus (TMEV).
[0096] Mutational analysis of EMCV and FMDV 2A has revealed that the motif DxExNPGP is intimately involved in cleavage activity (Donelly et al (2001) as above).
[0097] The cleavage site of the present invention may comprise the amino acid sequence: Dx.sub.1Ex.sub.2NPGP, where x.sub.1 and x.sub.2 are any amino acid. X.sub.1 may be selected from the following group: I, V, M and S. X.sub.2 may be selected from the following group: T, M, S, L, E, Q and F.
[0098] For example, the cleavage site may comprise one of the amino acid sequences shown in Table 1.
TABLE-US-00001 TABLE1 Motif Presentin: DIETNPGP PicornavirusesEMCB, (SEQIDNo.1) EMCD,EMCPV21 DVETNPGP PicornavirusesMENGOand (SEQIDNo.2) TMEBEAN;Insectvirus DCV,ABPV DVEMNPGP PicornavirusesTMEGD7and (SEQIDNo.3) TMEBEAN DVESNPGP PicornavirusesFMDA10, (SEQIDNo.4) FMDA12,FMDC1,FMD01K, FMDSAT3,FMDVSAT2, ERAV;InsectvirusCrPV DMESNPGP PicornavirusFMDV01G (SEQIDNo.5) DVELNPGP PicornavirusERBV;Porcine (SEQIDNo.6) rotavirus DVEENPGP PicornavirusPTV-1;Insect (SEQIDNo.7) virusTaV;Trypanosoma TSR1 DIELNPGP BovineRotavirus,human (SEQIDNo.8) rotavirus DIEQNPGP TrypanosomaAP (SEQIDNo.9) endonuclease DSEFNPGP BacterialsequenceT. (SEQIDNo.10) maritima
[0099] The cleavage site, based on a 2A sequence may be, for example 15-22 amino acids in length. The sequence may comprise the C-terminus of a 2A protein, followed by a proline residue (which corresponds to the N-terminal proline of 2B).
[0100] Mutational studies have also shown that, in addition to the naturally occurring 2A sequences, some variants are also active. The cleavage site may correspond to a variant sequence from a naturally occurring 2A polypeptide, have one, two or three amino acid substitutions, which retains the capacity to induce the cleavage of a polyprotein sequence into two or more separate proteins.
[0101] The cleavage sequence may be selected from the following which have all been shown to be active to a certain extent (Donnelly et al (2001) as above):
TABLE-US-00002 (SEQIDNo.11) LLNFDLLKLAGDVESNPGP (SEQIDNo.12) LLNFDLLKLAGDVQSNPGP (SEQIDNo.13) LLNFDLLKLAGDVEINPGP (SEQIDNo.14) LLNFDLLKLAGDVEFNPGP (SEQIDNo.15) LLNFDLLKLAGDVESHPGP (SEQIDNo.16) LLNFDLLKLAGDVESEPGP (SEQIDNo.17) LLNFDLLKLAGDVESQPGP (SEQIDNo.18) LLNFDLLKLAGDVESNPGG
[0102] Based on the sequence of the DxExNPGP a motif, 2A-like sequences have been found in picornaviruses other than aptho- or cardioviruses, picornavirus-like insect viruses, type C rotaviruses and repeated sequences within Trypanosoma spp and a bacterial sequence (Donnelly et al (2001) as above). The cleavage site may comprise one of these 2A-like sequences, such as:
TABLE-US-00003 (SEQIDNo.19) YHADYYKQRLIHDVEMNPGP (SEQIDNo.20) HYAGYFADLLIHDIETNPGP (SEQIDNo.21) QCTNYALLKLAGDVESNPGP (SEQIDNo.22) ATNFSLLKQAGDVEENPGP (SEQIDNo.23) AARQMLLLLSGDVETNPGP (SEQIDNo.24) RAEGRGSLLTCGDVEENPGP (SEQIDNo.25) TRAEIEDELIRAGIESNPGP (SEQIDNo.26) TRAEIEDELIRADIESNPGP (SEQIDNo.27) AKFQIDKILISGDVELNPGP (SEQIDNo.28) SSIIRTKMLVSGDVEENPGP (SEQIDNo.29) CDAQRQKLLLSGDIEQNPGP (SEQIDNo.30) YPIDFGGFLVKADSEFNPGP
[0103] The cleavage site may comprise the 2A-like sequence shown as SEQ ID No. 24 (RAEGRGSLLTCGDVEENPGP).
[0104] It has been shown that including an N-terminal extension of between 5 and 39 amino acids can increase activity (Donnelly et al (2001) as above). In particular, the cleavage sequence may comprise one of the following sequences or a variant thereof having, for example, up to 5 amino acid changes which retains cleavage site activity:
TABLE-US-00004 (SEQIDNo.31) VTELLYRMKRAETYCPRPLAIHPTEARHKQKIVAPVKQTLNFDLLKLAGD VESNPGP (SEQIDNo.32) LLAIHPTEARHKQKIVAPVKQTLNFDLLKLAGDVESNPGP (SEQIDNo.33) EARHKQKIVAPVKQTLNFDLLKLAGDVESNPGP (SEQIDNo.34) APVKQTLNFDLLKLAGDVESNPGP INTRACELLULARRETENTIONSIGNAL
[0105] The nucleic acid construct of the present invention comprises a sequence which encodes a transmembrane protein comprising an intracellular retention signal.
[0106] Protein targeting or protein sorting is the biological mechanism by which proteins are transported to the appropriate destinations in the cell or outside of it. Proteins can be targeted to the inner space of an organelle, different intracellular membranes, plasma membrane, or to exterior of the cell via secretion. This delivery process is carried out based on sequence information contain in the protein itself.
[0107] Proteins synthesised in the rough endoplasmic reticulum (ER) of eukaryotic cells use the exocytic pathway for transport to their final destinations. Proteins lacking special sorting signals are vectorially transported from the ER via the Golgi and the trans-Golgi network (TGN) to the plasma membrane. Other proteins have targeting signals for incorporation into specific organelles of the exocytic pathway, such as endosomes and lysosomes.
[0108] Lysosomes are acidic organelles in which endogenous and internalised macromolecules are degraded by luminal hydolases. Endogenous macromolecules reach the lysosome by being sorted in the TGN from which they are transported to endosomes and then lysosomes.
[0109] The targeting signals used by a cell to sort proteins to the correct intracellular location may be exploited by the present invention. The signals may be broadly classed into the following types:
[0110] i) endocytosis signals
[0111] ii) Golgi retention signals
[0112] iii) TGN recycling signals
[0113] iv) ER retention signals
[0114] v) lysosomal sorting signals
[0115] Intracellular retention signal refers to an amino acid sequence which directs the protein in which it is encompassed to a cellular compartment other than the cell surface membrane or to the exterior of the cell.
[0116] The intracellular retention signal causes a reduction in the amount of the transmembrane protein expressed on the surface of a cell compared to an equivalent, control transmembrane protein which does not comprise an intracellular retention signal.
[0117] In other words, the proportion of translated transmembrane protein comprising an intracellular retention signal which is expressed on at the cell surface is less than the proportion of an equivalent amount of an equivalent, translated control transmembrane protein which does not comprise an intracellular retention signal.
[0118] For example, the amount of the transmembrane protein comprising an intracellular retention signal which is expressed on the surface of a cell may be less than 75%, less than 50%, less than 25% or less than 10% of the amount of an equivalent control transmembrane protein which does not comprise an intracellular retention signal.
[0119] Constructs which express a polyprotein that is subsequently cleaved by a protease are generally limited by the fact the expression of the peptides from the polyprotein is limited to a 1:1 ratio. However, in the present invention, the inclusion of an intracellular retention signal in the transmembrane protein means that its expression on the cell surface can be modulated (e.g. reduced compared to an equivalent control transmembrane protein which does not comprise an intracellular retention signal). As such the ratio of the transmembrane protein which comprises the intracellular retention signal expressed on the cell surface compared to the expression of the second protein expressed in the polyprotein may be, for example about 1:1.5, of from 1:1.5-1:2, 1:2-1:3, 1:3-1:4, 1:4-1:5, or more than 1:5.
[0120] The amount of a transmembrane protein expressed on the surface of a cell may be determined using methods which are known in the art, for example flow cytometry or fluorescence microscopy.
[0121] The intracellular retention signal may direct the transmembrane protein away from the secretory pathway during translocation from the ER.
[0122] The intracellular retention signal may direct the transmembrane protein to an intracellular compartment or complex. The intracellular retention signal may direct the transmembrane protein to a membrane-bound intracellular compartment.
[0123] For example, the intracellular retention signal may direct the protein to a lysosomal, endosomal or Golgi compartment (trans-Golgi Network, TGN).
[0124] Within a normal cell, proteins arising from biogenesis or the endocytic pathway are sorted into the appropriate intracellular compartment following a sequential set of sorting decisions. At the plasma membrane, proteins can either remain at the cell surface or be internalised into endosomes. At the TGN, the choice is between going to the plasma membrane or being diverted to endosomes. In endosomes, proteins can either recycle to the plasma membrane or go to lysosomes. These decisions are governed by sorting signals on the proteins themselves.
[0125] Lysosomes are cellular organelles that contain acid hydrolase enzymes that break down waste materials and cellular debris. The membrane around a lysosome allows the digestive enzymes to work at the pH they require. Lysosomes fuse with autophagic vacuoles (phagosomes) and dispense their enzymes into the autophagic vacuoles, digesting their contents.
[0126] An endosome is a membrane-bounded compartment inside eukaryotic cells. It is a compartment of the endocytic membrane transport pathway from the plasma membrane to the lysosome and provides an environment for material to be sorted before it reaches the degradative lysosome. Endosomes may be classified as early endosomes, late endosomes, or recycling endosomes depending on the time it takes for endocytosed material to reach them. The intracellular retention signal used in the present invention may direct the protein to a late endosomal compartment.
[0127] The Golgi apparatus is part of the cellular endomembrane system, the Golgi apparatus packages proteins inside the cell before they are sent to their destination; it is particularly important in the processing of proteins for secretion.
[0128] There is a considerable body of knowledge which has arisen from studies investigating the sorting signals present in known proteins, and the effect of altering their sequence and/or position within the molecule (Bonifacino and Traub (2003) Ann. Rev. Biochem. 72:395-447; Braulke and Bonifacino (2009) Biochimica and Biophysica Acta 1793:605-614; Griffith (2001) Current Biology 11:R226-R228; Mellman and Nelson (2008) Nat Rev Mol Cell Biol. 9:833-845; Dell{grave over ( )}Angelica and Payne (2001) Cell 106:395-398; Schafer et al (1995) EMBO J. 14:2424-2435; Trejo (2005) Mol. Pharmacol. 67:1388-1390). Numerous studies have shown that it is possible to insert one or more sorting signals into a protein of interest in order to alter the intracellular location of a protein of interest (Pelham (2000) Meth. Enzymol. 327:279-283).
[0129] It is therefore perfectly possible to select a sorting signal having a desired localisation property and include it within a protein of interest in order to direct the intracellular location of that protein. In connection with the present application, it is therefore possible to select a sorting signal having the desired amount of reduction of expression at the plasma membrane.
[0130] The optimal position of the sorting signal in the nascent protein of interest may depend on the type of transmembrane protein (i.e. types I-IV) and whether the C-terminus is on the luminal or the cytoplasmic side of the membrane (Goder and Spiess (2001) FEBS Lett 504:87-93). This may readily be determined by considering the position of the sorting signal in its natural protein.
[0131] Examples of endocytosis signals include those from the transferrin receptor and the asialoglycoprotein receptor.
[0132] Examples of signals which cause TGN-endosome recycling include those form proteins such as the Cl- and CD-MPRs, sortilin, the LDL-receptor related proteins LRP3 and LRP10 and ?-secretase, GGA1-3, LIMP-II, NCP1, mucolipn-1, sialin, GLUT8 and invariant chain.
[0133] Examples of TGN retention signals include those from the following proteins which are localized to the TGN: the prohormone processing enzymes furin, PC7, CPD and PAM; the glycoprotein E of herpes virus 3 and TGN38.
[0134] Examples of ER retention signals include C-terminal signals such as KDEL, KKXX or KXKXX and the RXR(R) motif of potassium channels. Known ER proteins include the adenovirus E19 protein and ERGIC53.
[0135] Examples of lysosomal sorting signals include those found in lysosomal membrane proteins, such as LAMP-1 and LAMP-2, CD63, CD68, endolyn, DC-LAMP, cystinosin, sugar phosphate exchanger 2 and acid phosphatase.
[0136] The intracellular retention signal may be from the adenovirus E19 protein. The intracellular retention signal may be from the protein E3/19K, which is also known as E3gp 19 kDa; E19 or GP19K. The intracellular retention signal may comprise the full cytosolic tail of E3/19K, which is shown as SEQ ID No. 36; or the last 6 amino acids of this tail, which is shown as SEQ ID No. 37. The present inventors have shown that the last 6 amino acids are particularly important for retention (Example 3 and
TABLE-US-00005 SEQIDNo.36: KYKSRRSFIDEKKMP SEQIDNo.37: DEKKMP
Tunability
[0137] The relative expression of one or more protein(s) may be fine tuned using the method of the invention by various methods, such as [0138] a) altering the position of the intracellular retention signal in the protein molecule; and/or [0139] b) selecting a particular intracellular retention signal.
[0140] Option a) is discussed in more detail below.
[0141] With regard to option b), a range of intracellular retention signals is available from the large number of naturally occurring proteins which are sorted to distinct cellular locations inside eukaryotic cells. It is also possible to use synthetic intracellular retention signals which comprise one of more of the motifs found in naturally occurring proteins (see next section) and have a similar sorting signal function.
[0142] A cascade of signal strength is available, depending on the intracellular location to which the sorting signal sends the relevant protein. Broadly speaking, the more intracellular the location directed by the sorting signal, the stronger the signal is in terms of lowering the relative expression of the protein.
[0143] When a sorting signal directs a protein to the lysosomal compartment, the protein is internalised and degraded by the cell, resulting in relatively little escape to the cell surface. The protein is degraded and lost from the system once it enters the lysosome. Therefore lysosomal sorting signals, such as LAMP1, are the strongest in terms of reducing relative expression at the cell surface.
[0144] When a sorting signal directs a protein to be retained in the ER, only a very small proportion of the protein gets to the cell surface. Hence ER retention or recycling signals, such as ER-GIC-53 and KKFF signal are the next most strong, in terms of reducing relative expression at the cell surface.
[0145] When a sorting signal directs a protein to the endosomal, Golgi or TGN compartments, then the protein is likely to recycle to some extent between the TGN, the endosomal compartment, and the plasma membrane. These signals provide a more limited level of reduction of expression as a significant proportion of the protein will still reach the plasma membrane.
[0146] In general the reduction in expression seen with known sorting signals can be summarised as follows:
[0147] Lysosomal sorting signals>ER retention/recycling signals>TGN retention/recycling signals>endocytosis signals.
[0148] The tunability using different sorting signals and/or different positions of sorting signals within the protein is especially useful when one considers the expression of multiple proteins, each with their own relative expression. For example, consider a nucleic acid construct having the following structure:
A-X-B-Y-C [0149] in which
[0150] A, B and C are nucleic acid sequences encoding polypeptides; and
[0151] X and Y are nucleic acid sequences encodes cleavage sites.
[0152] The nucleic acid construct will encode three proteins A, B and C, any or all of which may be transmembrane proteins. For example, B and C may be transmembrane proteins which comprise an intracellular retention signal. If it is desired for A, B and C to be expressed such that the relative levels are A>B>C, then the nucleic acid sequence A may have no intracellular retention signal, the nucleic acid sequence B may have an intracellular retention signal that causes a small proportion of protein B to be retained in the cell (i.e. not to be expressed at the cell surface), and the nucleic acid sequence C may have an intracellular retention signal that causes a large proportion of protein C to be retained in the cell.
[0153] As explained below, differential amounts of intracellular retention, leading to different amounts of cell surface expression may be achieved by:
[0154] (a) using different intracellular retention signals for the proteins; and/or
[0155] (b) having the intracellular retention signal located at a different position in the proteins.
Signal Types
[0156] Numerous proteins which include an intracellular retention signal and are directed to an intracellular compartment are known in the art.
[0157] The intracellular retention signal may be a retention signal from a protein which resides in the lysosomal, endosomal or Golgi compartment.
[0158] Intracellular retention signals are well known in the art (see, for example, Bonifacino & Traub; Annu. Rev. Biochem.; 2003; 72; 395-447).
[0159] The intracellular retention signal may be a tyrosine-based sorting signal, a dileucine-based sorting signal, an acidic cluster signal, a lysosomal avoidance signal, an NPFX(1,2)D-Type signal, a KDEL, a KKXX or a KXKXX signal (wherein X is any amino acid).
[0160] Tyrosine-based sorting signals mediate rapid internalization of transmembrane proteins from the plasma membrane and the targeting of proteins to lysosomes (Bonifacino & Traub; as above). Two types of tyrosine-based sorting signals are represented by the NPXY and YXXZ consensus motifs (wherein Z is an amino acid with a bulky hydrophobic side chain).
[0161] NPXY signals have been shown to mediate rapid internalization of type I transmembrane proteins, they occur in families such as members of the LDL receptor, integrin ?, and ?-amyloid precursor protein families.
[0162] Examples of NPXY signals are provided in Table 2.
TABLE-US-00006 TABLE2 NPXYsignals Protein Species Sequence LDLreceptor Human Tm-10-INFDNPVYQKTT-29 LRP1(1) Human Tm-21-VEIGNPTYKMYE-64 LRP1(2) Human Tm-55-TNFTNPVYATLY-33 LRP1 Drosophila Tm-43-GNFANPVYESMY-38 LRP1(1) C.elegans Tm-54-TTFTNPVYELED-91 LRP1(2) C.elegans Tm-140-LRVDNPLYDPDS-4 Megalin(1) Human Tm-70-IIFENPMYSARD-125 Megalin(2) Human Tm-144-TNFENPIYAQME-53 Integrin13-1(1) Human Tm-18-DTGENPIYKSAV-11 Integtin13-1(2) Human Tm-30-TTVVNPKYEGK Integrin13(1) Drosophila Tm-26-WDTENPIYKQAT-11 Integrin13(2) Drosophila Tm-35-STFKNPMYAGK APLP1 Human Tm-33-HGYENPTYRFLE-3 APP Human Tm-32-NGYENPTYKFFE-4 APP-like Drosophila Tm-38-NGYENPTYKYFE-3 Insulinreceptor Human Tm-36-YASSNPEYLSAS-379 EGRreceptor(1) Human Tm-434-GSVQNPVYHNQP-96 EGRreceptor(2) Human Tm-462-TAVGNPEYLNTV-68 EGRreceptor(3) Human Tm-496-ISLDNPDYQQDF-34 Numbers in parentheses indicate motifs that are present in more than one copy within the same protein. The signals in this and other tables should be considered examples. Key residues are indicated in bold type. Numbers of amino acids before (i.e., amino-terminal) and after (i.e., carboxy-terminal) the signals are indicated. Abbreviations: Tm, transmembrane; LDL, low density lipoprotein; LRP1, LDL receptor related protein 1; APP, 13-amyloid precursor protein; APLP1, APP-like protein 1.
[0163] YXXZ-type signals are found in endocytic receptors such as the transferrin receptor and the asialoglycoprotein receptor, intracellular sorting receptors such as the Cl- and CD-MPRs, lysosomal membrane proteins such as LAMP-1 and LAMP-2, and TGN proteins such as TGN38 and furin, as well as in proteins localized to specialized endosomal-lysosomal organelles such as antigen-processing compartments (e.g., HLA-DM) and cytotoxic granules (e.g., GMP-17). The YXXZ-type signals are involved in the rapid internalization of proteins from the plasma membrane. However, their function is not limited to endocytosis, since the same motifs have been implicated in the targeting of transmembrane proteins to lysosomes and lysosome-related organelles.
[0164] Examples of YXXZ-type signals are provided in Table 3.
TABLE-US-00007 TABLE3 YXXZ-typesignals Protein Species Sequence LAMP-1 Human Tm-RKRSHAGYQTI LAMP-2a Human Tm-KHHHAGYEQF LAMP-2a Chicken Tm-KKHHNTGYEQF LAMP-2b Chicken Tm-RRKSRTGYQSV LAMP-2c Chicken Tm-RRKSYAGYQTL LAMP Drosophila Tm-RRRSTSRGYMSF LAMP Earthworm Tm-RKRSRRGYEVM CD63 Human Tm-KSIRSGYEVM GMP-17 Human Tm-HCGGPRPGYETL GMP-17 Mouse Tm-HCRTRRAEYETL CD68 Human Tm-RRRPSAYQAL CD1b Human Tm-RRRSYQNIP CD1c Human Tm-KKHCSYQDIL CD1d Mouse Tm-RRRSAYQDIR CD1 Rat Tm-RKRRRSYQDIM Endolyn Rat Tm-KFCKSKERNYHTL Endolyn Drosophila Tm-KFYKARNERNYHTL TSC403 Human Tm-KIRLRCQSSGYQRI TSC403 Mouse Tm-KIRQRHQSSAYQRI Cystinosin Human Tm-HFCLYRKRPGYDQLN Putative Human Tm-12-SLSRGSGYKEI solute carrier TRP-2 Human Tm-RRLRKGYTPLMET-11 HLA-DM? Human Tm-RRAGHSSYTPLPGS-9 LmpA Dictyostelium Tm-KKLRQQKQQGYQAIINNE Putative Dictyostelium Tm-RSKSNQNQSYNLIQL lysosomal protein LIMP-II Dictyostelium Tm-RKTFYNNNQYNGYNIIN Transferrin Human 16-PLSYTRFSLA-35-Tm receptor Asialoglyco- Human MTKEYQDLQHL-29-Tm protein receptorH1 CI-MPR Human Tm-22-SYKYSKVNKE-132 CD-MPR Human Tm-40-PAAYRGVGDD-16 CTLA-4 Human Tm-10-TGVYVKMPPT-16 Furin Human Tm-17-LISYKGLPPE-29 TGN38 Rat Tm-23-ASDYQRLNLKL gp41 HIV-1 Tm-13-RQGYSPLSFQT-144 Acid Human Tm-RMQAQPPGYRHVADGEDHA phosphatase See legend to Table 1 for explanation of signal format
[0165] Dileucine-based sorting signals ([DE]XXXLL[Ll]) play critical roles in the sorting of many type I, type II, and multispanning transmembrane proteins. Dileucine-based sorting signals are involved in rapid internalization and lysosomal degradation of transmembrane proteins and the targeting of proteins to the late endosomal-lysosomal compartments. Transmembrane proteins that contain constitutively active forms of this signal are mainly localised to the late endosomes and lysosomes.
TABLE-US-00008 TABLE4 [DE]XXXLL[LI] sortingsignals Protein Species Signal CD3-? Human Tm-8-SDKQTLLPN-26 LIMP-II Rat Tm-11-DERAPLIRT Nmb Human Tm-37-QEKDPLLKN-7 QNR-71 Quail Tm-37-TERNPLLKS-5 Pmel17 Human Tm-33-GENSPLLSG-3 Tyrosinase Human Tm-8-EEKQPLLME-12 Tyrosinase Medakafish Tm-16-GERQPLLQS-13 Tyrosinase Chicken Tm-8-PEIQPLLTE-13 TRP-1 Goldfish Tm-7-EGRQPLLGD-15 TRP-1 Human Tm-7-EANQPLLTD-20 TRP-1 Chicken Tm-7-ELHQPLLTD-20 TRP-2 Zebrafish Tm-5-REFEPLLNA-11 VMAT2 Human Tm-6-EEKMAILMD-29 TMAT1 Human Tm-6-EEKLAILSQ-32 VAchT Mouse Tm-10-SERDVLLDE-42 VAMP4 Human 19-SERRNLLED-88-Tm Neonatal Rat Tm-16-DDSDGLLPG-19 FcR CD4 Human Tm-12-SQIKRLLSE-17 CD4 Cat Tm-12-SHIKRLLSE-17 GLUT4 Mouse Tm-17-RRTPSLLEQ-17 GLUT4 Human Tm-17-HRTPSLLEQ-17 IRAP Rat 46-EPRGSRLLVR-53-Tm Ii Human MDDQRDLISNNEQLPMLGR-11-Tm Ii Mouse MDDQRDLISNHEQLPILGN-10-Tm Ii Chicken MAEEQRDLISSDGSSGVLPI-12-Tm Ii-1 Zebrafish MEPDHQNESLIQRVPSAETILGR- 12-Tm Ii-2 Zebrafish MSSEGNETPLISDQSSVNMGPQP-8- Tm Lamp Trypanosome Tm-RPRRRTEEDELLPEEAEGLIDPQN Menkes Human Tm-74-PDKHSLLVGDFREDDDTAL protein NPC1 Human Tm-13-TERERLLNP AQP4 Human Tm-32-VETDDLIL-29 RME-2 C.elegans Tm-104-FENDSLL Vam3p S.cerevisiae 153-NEQSPLLHN-121-Tm ALP S.cerevisiae 7-SEQTRLVP-18-Tm Gap1p S.cerevisiae Tm-23-EVDLDLLK-24 See legend to Table 1 for explanation of signal format. Examples of sorting signals are provided in Table 4.
[0166] DXXLL signals constitute a distinct type of dileucine-based sorting signals. These signals are present in several transmembrane receptors and other proteins that cycle between the TGN and endosomes, such as the Cl- and CD-MPRs, sortilin, the LDL-receptor-related proteins LRP3 and LRP10, and ?-secretase.
[0167] Examples of DXXLL sorting signals are provided in Table 5.
TABLE-US-00009 TABLE5 DXXLLsortingsignals Protein Species Sequence CI-MPR Human Tm-151-SFHDDSDEDLLHI CI-MPR Bovine Tm-150-TFHDDSDEDLLHV CI-MPR Rabbit Tm-151-SFHDDSDEDLLNI CI-MPR Chicken Tm-148-SFHDDSDEDLLNV CD-MPR Human Tm-54-EESEERDDHLLPM CD-MPR Chicken Tm-54-DLSEERDDHLLPM Sortilin Human Tm-41-GYHDDSDEDLLE SofLA Human Tm-41-ITGFSDDVPMVIA Head-activatorBP Hydra Tm-41-INRFSDDEPLVVA LRP3 Human Tm-237-MLEASDDEALLVC ST7 Human Tm-330-KNETSDDEALLLC LRP10 Mouse Tm-235-WVVEAEDEPLLA LRP10 Human Tm-237-WVAEAEDEPLLT Bela-secretase Human Tm-9-HPDFADDISLLK Mucolipin-1 Mouse Tm-43-GRDSPEDHSLLVN NonclassicalMHC-I Deermouse Tm-6-VRCHPEDDRLLG FLJ30532 Human Tm-83-HRVSQDDLDLLTS GGA1 Human 350-ASVSLLDDELMSL-275 GGA1 Human 415-ASSGLDDLDLLGK-211 GGA2 Human 408-VQNPSADRNLLDL-192 GGA3 Human 384-NALSWLDEELLCL-326 GGA Drosophila 447-TVDSIDDVPLLSD-116 See legend to Table 1 for exsplanation of signal format. Serine and threonine residues are underlined.
[0168] Another family of sorting motifs is provided by clusters of acidic residues containing sites for phosphorylation by CKll. This type of motif is often found in transmembrane proteins that are localized to the TGN at steady state, including the prohormone-processing enzymes furin, PC6B, PC7, CPD, and PAM, and the glycoprotein E of herpes virus 3.
[0169] Examples of acidic cluster signals are provided in Table 6.
TABLE-US-00010 TABLE6 Acidicclustersortingsignals Protein Species Sequence Furin Mouse Tm-31-QEECPSDSEEDEG-14 PC6B(1).sup.a Mouse Tm-39-RDRDYDEDDEDDI-36 PC6B(2) Mouse Tm-69-LDETEDDELEYDDES-4 PC7 Human Tm-38-KDPDEVETES-47 CPD Human TM-36-HEFQDETDTEEET-6 PAM Human Tm-59-QEKEDDGSESEEEY-12 VMAT2 Human Tm-35-GEDEESESD VMAT1 Human Tm-35-GEDSDEEPDHEE VAMP4 Human 25-LEDDSDEEEDF-81-Tm Glycoprotein HCMV Tm-125-KDSDEEENV B Glycoprotein Herpes Tm-28-FEDSESTDTEEEF-21 E virus3 Nef HIV-I 55-LEAQEEEEV-139 (AAL65476) Kex1p(1) S.cerevisiae Tm-29-ADDLESGLGAEDDLE QDEQLEG-40 Kex1p(2) S.cerevisiae Tm-79-TEIDESFEMTDF Kex2p S.cerevisiae Tm-36-TEPEEVEDFDFDLSD EDH-61 Vps10p S.cerevisiae Tm-112-FEIEEDDVPTL EEEH-37 See legend to Table 1 for explanation of signal format Serine and threonine residues are underlined. .sup.aThe number in parentheses is the motif number.
[0170] The KDEL receptor binds protein in the ER-Golgi intermediate compartment, or in the early Golgi and returns them to the ER. Although the common mammalian signal is KDEL, it has been shown that the KDEL receptor binds the sequence HDEL more tightly (Scheel et al; J. Biol. Chem. 268; 7465 (1993)). The intracellular retention signal may be HDEL.
[0171] KKXX and KXKXX signals are retrieval signals which can be placed on the cytoplasmic side of a type I membrane protein. Sequence requirements of these signals are provided in detail by Teasdale & Jackson (Annu. Rev. Cell Dev. Biol.; 12; 27 (1996)).
[0172] The intracellular retention signal may be selected from the group of: NPXY, YXXZ, [DE]XXXL[Ll], DXXLL, DP[FW], FXDXF, NPF, LZXZ[DE], LLDLL, PWDLW, KDEL, HDEL, KKXX or KXKXX; wherein X is any amino acid and Z is an amino acid with a bulky hydrophobic side chain.
[0173] The intracellular retention signal may be any sequence shown in Tables 2 to 6.
[0174] The intracellular retention signal may comprise the Tyrosinase-related protein (TYRP)-1 intracellular retention signal. The intracellular retention signal may comprise the TYRP-1 intracellular domain. The intracellular retention signal may comprise the sequence NQPLLTD (SEQ ID No. 35).
[0175] TYRP1 is a well-characterized melansomal protein which is retained in the melanosome (a specialized lysosome) at >99% efficiency. TYRP1 is a 537 amino acid transmembrane protein with a lumenal domain (1-477aa), a transmembrane domain (478-501), and a cytoplasmic domain (502-537). A di-leucine signal residing on the cytoplasmic domain causes retention of the protein. This di-leucine signal has the sequence shown as SEQ ID No. 35 (NQPLLTD).
[0176] The intracellular retention signal may be in the endodomain of the transmembrane protein. In other words, the intracellular retention signal may be in the domain of the transmembrane protein which would be on the intracellular side of the cell membrane if the protein was correctly expressed at the cell surface.
[0177] The endodomain of the transmembrane protein may comprise at least 100, at least 150, at least 200, at least 300 or at least 500 amino acids.
[0178] The endodomain comprising the intracellular retention signal may be located at the carboxy terminus of the transmembrane protein. In particular, where the transmembrane protein comprises a signal sequence at the amino terminus of the peptide the endodomain comprising the intracellular retention signal may be located at the carboxy terminus.
[0179] The intracellular retention signal may be proximal to the transmembrane domain, for instance being immediately connected to it. The intracellular retention signal may be distal to the transmembrane domainfor instance at the carboxy-terminus of the endodomain. The positioning of the retention signal modulates its activity allowing tuning of the relative expression of two proteins. For instance in the case of the TYRP1 di-leucine motif, proximal placement results in low-level surface expression, while distal placement results in intermediate surface expression, as shown in the Examples.
Polypeptide of Interest
[0180] Any or all of A or B; or A, B or C of the nucleic acid sequences in the constructs defined herein may encode a transmembrane protein comprising an intracellular retention signal.
[0181] The other nucleic acid sequence may encode any polypeptide of interest (POI). For example, the other POI may be an intracellular protein such as a nucleic protein, a cytoplasmic protein or a protein localised to a membrane-bound compartment; a secretory protein or a transmembrane protein.
[0182] Any or all of A or B; or A, B or C of the nucleic acid sequences in the constructs defined herein may encode a chimeric antigen receptor (CAR). The nucleic acid constructs described in the Examples encode two chimeric antigen receptors.
[0183] The nucleic acid constructs described in the Examples encode the following polyproteins which comprise the various components in the order they are listed:
1. Polyprotein comprising anti-CD19 CAR and anti-CD33 CAR with proximal tyrp-1 retention on the anti-CD19 CAR
TABLE-US-00011 SignalpeptidederivedfromHumanCD8a: (SEQIDNo.38) MSLPVTALLLPLALLLHAARP scFvaCD19: (SEQIDNo.39) DIQMTQTTSSLSASLGDRVTISCRASQDISKYLNVVYQQKPDGTVKLLIYHTSRLHSGVPSRF SGSGSGTDYSLTISNLEQEDIATYFCQQGNTLPYTFGGGTKLEITKAGGGGSGGGGSGGG GSGGGGSEVKLQESGPGLVAPSQSLSVTCTVSGVSLPDYGVSWIRQPPRKGLEWLGVIW GSETTYYNSALKSRLTIIKDNSKSQVFLKMNSLQTDDTAIYYCAKHYYYGGSYAMDYWGQG TSVTVS Linker: SD HumanCD8aSTK: (SEQIDNo.40) PITTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDI HumanCD28TM: (SEQIDNo.41) FWVLVVVGGVLACYSLLVTVAFIIFWV HumanTypr-1intracellulardomain(retentionsignal): (SEQIDNo.42) RARRSMDEANQPLLTDQYQCYAEEYEKLQNPNQSVV HumanCD3zetaintracellulardomain: (SEQIDNo.43) RRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEG LYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR 2Apeptide: (SEQIDNo.24) RAEGRGSLLTCGDVEENPGP SignalpeptidederivedfrommouseIgkappa: (SEQIDNo.44) MAVPTQVLGLLLLWLTDA scFvaCD33: (SEQIDNo.45) RCDIQMTQSPSSLSASVGDRVTITCRASEDIYFNLVWYQQKPGKAPKWYDTNRLADGVPS RFSGSGSGTQYTLTISSLQPEDFATYYCQHYKNYPLTFGQGTKLEIKRSGGGGSGGGGSG GGGSGGGGSRSEVQLVESGGGLVQPGGSLRLSCAASGFTLSNYGMHWIRQAPGKGLEW VSSISLNGGSTYYRDSVKGRFTISRDNAKSTLYLQMNSLRAEDTAVYYCAAQDAYTGGYFD YWGQGTLVTVSSM Linker: DPA HingeandFcderivedfromhumanIgG1withmutationstoprevent FcRgassociation(HCH2CH3pvaa): (SEQIDNo.46) EPKSPDKTHTCPPCPAPPVAGPSVFLFPPKPKDTLMIARTPEVTCVVVDVSHEDPEVKFNW YVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK AKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLD SDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK Linker: (SEQIDNo.47) KDPK HumanCD148TM: (SEQIDNo.48) AVFGCIFGALVIVTVGGFIFW HumanCD148intracellulardomain: (SEQIDNo.49) RKKRKDAKNNEVSFSQIKPKKSKLIRVENFEAYFKKQQADSNCGFAEEYEDLKLVGISQPKY AAELAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYHSKKDFIATQGPLPNTL KDFWRMVWEKNVYAIIMLTKCVEQGRTKCEEYWPSKQAQDYGDITVAMTSEIVLPEVVTIRD FTVKNIQTSESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQSPPESPILVHCSAGV GRTGTFIAIDRLIYQIENENTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCVLDIVRSQKDSK VDLIYQNTTAMTIYENLAPVTTFGKTNGYIA
[0184] 2. Polyprotein comprising anti-CD19 CAR and anti-CD33 CAR with distal tyrp-1 retention on the anti-CD19 CAR
TABLE-US-00012 SignalpeptidederivedfromHumanCD8a: (SEQIDNo.38) MSLPVTALLLPLALLLHAARP scFvaCD19: (SEQIDNo.39) DIQMTQTTSSLSASLGDRVTISCRASQDISKYLNWYQQKPDGTVKLLIYHTSRLHSGVPSRF SGSGSGTDYSLTISNLEQEDIATYFCQQGNTLPYTFGGGTKLEITKAGGGGSGGGGSGGG GSGGGGSEVKLQESGPGLVAPSQSLSVTCTVSGVSLPDYGVSWIRQPPRKGLEWLGVIW GSETTYYNSALKSRLTIIKDNSKSQVFLKMNSLQTDDTAIYYCAKHYYYGGSYAMDYWGQG TSVTVS Linker: SD HumanCD8aSTK: (SEQIDNo.40) PITTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDI HumanCD28TM: (SEQIDNo.41) FWVLVVVGGVLACYSLLVTVAFIIFWV HumanCD3zetaintracellulardomain: (SEQIDNo.43) RRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEG LYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR HumanTypr-1intracellulardomain(retentionsignal): (SEQIDNo.42) RARRSMDEANQPLLTDQYQCYAEEYEKLQNPNQSVV 2Apeptide: (SEQIDNo.24) RAEGRGSLLTCGDVEENPGP SignalpeptidederivedfrommouseIgkappa: (SEQIDNo.44) MAVPTQVLGLLLLWLTDA scFvaCD33: (SEQIDNo.45) RCDIQMTQSPSSLSASVGDRVTITCRASEDIYFNLVWYQQKPGKAPKWYDTNRLADGVPS RFSGSGSGTQYTLTISSLQPEDFATYYCQHYKNYPLTFGQGTKLEIKRSGGGGSGGGGSG GGGSGGGGSRSEVQLVESGGGLVQPGGSLRLSCAASGFTLSNYGMHWIRQAPGKGLEW VSSISLNGGSTYYRDSVKGRFTISRDNAKSTLYLQMNSLRAEDTAVYYCAAQDAYTGGYFD YWGQGTLVTVSSM Linker: DPA HingeandFcderivedfromhumanIgG1withmutationstoprevent FcRgassociation(HCH2CH3pvaa): (SEQIDNo.46) EPKSPDKTHTCPPCPAPPVAGPSVFLFPPKPKDTLMIARTPEVTCVVVDVSHEDPEVKFNW YVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK AKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLD SDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK Linker: (SEQIDNo.47) KDPK HumanCD148TM: (SEQIDNo.48) AVFGCIFGALVIVTVGGFIFW HumanCD148intracellulardomain: (SEQIDNo.49) RKKRKDAKNNEVSFSQIKPKKSKLIRVENFEAYFKKQQADSNCGFAEEYEDLKLVGISQPKY AAELAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYHSKKDFIATQGPLPNTL KDFWRMVWEKNVYAIIMLTKCVEQGRTKCEEYWPSKQAQDYGDITVAMTSEIVLPEVVTIRD FTVKNIQTSESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQSPPESPILVHCSAGV GRTGTFIAIDRLIYQIENENTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCVLDIVRSQKDSK VDLIYQNTTAMTIYENLAPVTTFGKTNGYIA
[0185] 3. Polyprotein comprising anti-CD19 CAR and anti-CD33 CAR with E3/19K retention on the anti-CD33 CAR
TABLE-US-00013 SignalpeptidederivedfromHumanCD8a: (SEQIDNo.38) MSLPVTALLLPLALLLHAARP scFvaCD19: (SEQIDNo.39) DIQMTQTTSSLSASLGDRVTISCRASQDISKYLNWYQQKPDGTVKLLIYHTSRLHSGVPSRF SGSGSGTDYSLTISNLEQEDIATYFCQQGNTLPYTFGGGTKLEITKAGGGGSGGGGSGGG GSGGGGSEVKLQESGPGLVAPSQSLSVTCTVSGVSLPDYGVSWIRQPPRKGLEWLGVIW GSETTYYNSALKSRLTIIKDNSKSQVFLKMNSLQTDDTAIYYCAKHYYYGGSYAMDYWGQG TSVTVS Linker: SD HumanCD8aSTK: (SEQIDNo.40) PITTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDI HumanCD28TM: (SEQIDNo.41) FWVLVVVGGVLACYSLLVTVAFIIFWV HumanCD3zetaintracellulardomain: (SEQIDNo.43) RRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEG LYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR 2Apeptide: (SEQIDNo.24) RAEGRGSLLTCGDVEENPGP SignalpeptidederivedfrommouseIgkappa: (SEQIDNo.44) MAVPTQVLGLLLLWLTDA scFvaCD33: (SEQIDNo.45) RCDIQMTQSPSSLSASVGDRVTITCRASEDIYFNLVWYQQKPGKAPKWYDTNRLADGVPS RFSGSGSGTQYTLTISSLQPEDFATYYCQHYKNYPLTFGQGTKLEIKRSGGGGSGGGGSG GGGSGGGGSRSEVQLVESGGGLVQPGGSLRLSCAASGFTLSNYGMHWIRQAPGKGLEW VSSISLNGGSTYYRDSVKGRFTISRDNAKSTLYLQMNSLRAEDTAVYYCAAQDAYTGGYFD YWGQGTLVTVSSM Linker: DPA HingeandFcderivedfromhumanIgG1withmutationstoprevent FcRgassociation(HCH2CH3pvaa): (SEQIDNo.46) EPKSPDKTHTCPPCPAPPVAGPSVFLFPPKPKDTLMIARTPEVTCVVVDVSHEDPEVKFNW YVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK AKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLD SDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK Linker: (SEQIDNo.47) KDPK HumanCD148TM: (SEQIDNo.48) AVFGCIFGALVIVTVGGFIFW HumanCD148intracellulardomain: (SEQIDNo.49) RKKRKDAKNNEVSFSQIKPKKSKLIRVENFEAYFKKQQADSNCGFAEEYEDLKLVGISQPKY AAELAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYHSKKDFIATQGPLPNTL KDFWRMVWEKNVYAIIMLTKCVEQGRTKCEEYWPSKQAQDYGDITVAMTSEIVLPEVVTIRD FTVKNIQTSESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQSPPESPILVHCSAGV GRTGTFIAIDRLIYQIENENTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCVLDIVRSQKDSK VDLIYQNTTAMTIYENLAPVTTFGKTNGYIA AdenoviralE3/19Kcytosolictail: (SEQIDNo.36) KYKSRRSFIDEKKMP
[0186] In the above Polyprotein 3, the E3/19K cytosolic tail may be replaced with a truncated version having the sequence: DEKKMP
[0187] As shown in the Examples, it was found that, for the tyrp-1 retention signal, low levels of expression could be achieved by placing the retention signal between Human CD28TM and Human CD3zeta intracellular domain in the sequence given above, whereas medium levels of expression could be achieved by placing the retention signal between Human CD3zeta intracellular domain and 2A peptide.
[0188] The E3/19K retention signal caused reduction in expression of the anti-CD33 CAR when placed at the C-terminus of the anti-CD33 CAR.
Vector
[0189] The present invention also provides a vector comprising a nucleic acid construct according to the first aspect of the invention.
[0190] Such a vector may be used to introduce the nucleic acid construct into a host cell so that it expresses the first and second polypeptide.
[0191] The vector may, for example, be a plasmid or a viral vector, such as a retroviral vector or a lentiviral vector, or a transposon based vector or synthetic mRNA.
[0192] The vector may be capable of transfecting or transducing a mammalian cell, for example a T cell.
Cell
[0193] The present invention furthers provides a cell comprising a nucleic acid construct or vector of the present invention which expresses the first and second polypeptide encoded by the nucleic acid sequence.
[0194] The cell may be any eukaryotic cell capable of expressing a transmembrane protein at the cell surface, such as an immunological cell.
Protein
[0195] The present invention also provides a transmembrane protein comprising an extracellular domain, a transmembrane domain and an endodomain wherein the endodomain comprises an exogenous intracellular retention signal as defined herein.
[0196] Exogenous means that the intracellular retention signal is not part of the wild type sequence of the transmembrane protein. Wild type sequence refers to the amino acid sequence of the protein which commonly occurs in nature.
[0197] The present inventors have demonstrated that the inclusion of an exogenous intracellular retention signal in the endodomain of a transmembrane protein causes the transmembrane protein to be directed to an intracellular compartment. As such the amount of the transmembrane protein expressed at the cell surface is reduced compared to an equivalent transmembrane protein which does not include an intracellular retention signal in the transmembrane domain.
Method
[0198] In a further aspect the present invention relates to a method for modulating the relative cell surface expression of a transmembrane protein expressed from a single nucleic acid construct as a polyprotein with a second protein; by including an intracellular retention signal in the nucleic acid sequence which encodes the transmembrane protein.
[0199] The invention will now be further described by way of Examples, which are meant to serve to assist one of ordinary skill in the art in carrying out the invention and are not intended in any way to limit the scope of the invention.
EXAMPLES
Example 1
Dissection of TYRP1 Lysozomal Retention Signals
[0200] The ability of the Tyrosinase-related protein 1 (TYRP1) retention signal to cause retention of a polypeptide when in the context of a more complex endodomain was determined using a number of constructs (
[0201] All constructs are co-expressed with IRES.CD34. Staining of transduced SupT1 cells is shown with intracellular and surface staining in
[0202] It was found that replacement of the endodomain resulted in very bright surface expression, introduction of eGFP after the retention signal to almost no surface expression and introduction before the retention signal to intermediate surface expression (
Example 2
Modulation of the Relative Expression of a Transmembrane Protein Co-Expressed from a Single Expression Cassette with a Separate Protein
[0203] An expression cassette encoding two CAR transmembrane proteins was modified such that one of the CAR proteins had the lysozomal retention signal from TYRP1 introduced either proximal or distal to the membrane. Expression of each of these two new variants at the cell surface was compared with that of the original unmodified CAR protein.
[0204] PBMCs were isolated from blood and stimulated using PHA and IL-2. Two days later the cells were transduced on retronectin coated plates with retro virus containing the CD19:CD33 CAR construct. On day 5 the expression level of the two CARs translated by the construct was evaluated via flow cytometry and the cells were depleted of CD56+ cells (predominantly NK cells). On day 6 the PBMCs were placed in a co-culture with target cells at a 1:2 effector to target cell ratio. On day 8 the supernatant was collected and analysed for IFN-gamma secretion via ELISA.
[0205] The pattern observed with Tyrp1-eGFP fusions was observed with some reduction of expression of modified transmembrane protein with the distal retention signal and marked reduction in the case of proximal retention signal. As expected, expression of the second transmembrane protein from the cassette was not altered (
Example 3
Modulation of Expression using a Retention Signal from the Adenoviral E3/19K Protein
[0206] The human adenovirus E3/19K protein is a type I transmembrane glycoprotein of the Endoplasmic Reticulum/Golgi that abrogates cell surface transport of major histocompatibility complex class I (MHC-I) and MHC-I-related chain A and B (MICA/B) molecules. The retention motif was identified to be depended on the cytosolic tail of the adenovirus E3/19K protein. More specifically, the last 6aa DEKKMP was found to be the most important for retention. The optimal positioning was found to be at the c-terminus of the protein.
[0207] An expression cassette encoding two CAR transmembrane proteins, as described in Example 2, was modified such that one of the CAR proteins had the retention motif from adenovirus E3/19K protein. In this experiment, the retention motif on the second CAR in the expression cassette (the anti-CD33 inhibitory CAR).
[0208] Constructs were generated comprising either the entire cytosolic tail of adenovirus E3/19K protein or only the last 6aa from E3/19K (DEKKMP), which were found to be critical for its Golgi/ER retention ability (
[0209] All publications mentioned in the above specification are herein incorporated by reference. Various modifications and variations of the described methods and system of the invention will be apparent to those skilled in the art without departing from the scope and spirit of the invention. Although the invention has been described in connection with specific preferred embodiments, it should be understood that the invention as claimed should not be unduly limited to such specific embodiments. Indeed, various modifications of the described modes for carrying out the invention which are obvious to those skilled in molecular biology, cell biology or related fields are intended to be within the scope of the following claims.