Amino acid sequence presenting fusion polypeptide and its use
09938340 ยท 2018-04-10
Assignee
Inventors
- Herbert Andres (Penzberg, DE)
- David CASAGOLDA VALLRIBERA (Penzberg, DE)
- Hartmut Duefel (Schlehdorf, DE)
- Michael Gerg (Munich, DE)
- Christian Scholz (Penzberg, DE)
- Michael Schraeml (Penzberg, DE)
Cpc classification
C07K2319/35
CHEMISTRY; METALLURGY
C07K2319/24
CHEMISTRY; METALLURGY
G01N33/74
PHYSICS
C07K16/22
CHEMISTRY; METALLURGY
C07K2317/34
CHEMISTRY; METALLURGY
C12Y502/01008
CHEMISTRY; METALLURGY
C07K14/65
CHEMISTRY; METALLURGY
C07K2317/92
CHEMISTRY; METALLURGY
International classification
C07K16/22
CHEMISTRY; METALLURGY
G01N33/74
PHYSICS
C07K14/65
CHEMISTRY; METALLURGY
Abstract
Herein is reported a fusion polypeptide according to formula I
NH.sub.2S.sub.2X.sub.1S.sub.1COOH(formula I)
wherein X.sub.1 comprises either a random amino acid sequence or an amino acid sequence derived from a first polypeptide, S2 and S1 are non-overlapping amino acid sequences derived from a second polypeptide, and denotes a peptide bond,
wherein the second polypeptide is a polypeptide with peptidyl-prolyl cis/trans-isomerase activity (PPIase activity) or is derived from the FKBP-fold domain family, wherein X.sub.1 is inserted in place of the insert-in-flap-domain of the second polypeptide.
Claims
1. A fusion polypeptide comprising a polypeptide according to formula I
NH.sub.2S.sub.2X.sub.1S.sub.1COOH(formula I) wherein X.sub.1 comprises a random amino acid sequence or an amino acid sequence derived from a first polypeptide, S.sub.2 and S.sub.1 are non-overlapping amino acid sequences derived from a second polypeptide, and denotes a peptide bond, wherein the second polypeptide is selected from the group consisting of human FKBP12, Arabidopsis thaliana FKBP13, Thermus thermophilus SlyD, Escherichia coli SlyD and Thermococcus gammatolerans SlyD, and wherein X.sub.1 is inserted in place of the insert-in-flap-domain (IF-domain) of the second polypeptide; and wherein X.sub.1 is the amino acid sequence of the polypeptide.
2. The fusion polypeptide of claim 1, wherein the S.sub.2X.sub.1S.sub.1 polypeptide is a fragment of a naturally occurring polypeptide or a full length naturally occurring polypeptide.
3. The fusion polypeptide according to claim 1, wherein X.sub.1 comprises an amino acid sequence that corresponds to a hidden epitope.
4. A method for producing an antibody specifically binding to a target antigen comprising the following steps: a) administering to an experimental animal a fusion polypeptide according to any one of claims 1, 2 and 3 for at least one time, whereby the amino acid sequence of X.sub.1 comprises the amino acid sequence of the target antigen, b) recovering from the experimental animal three to ten days after the last administration of the polypeptide B-cells that produce the antibody specifically binding to the target antigen, and c) cultivating a cell comprising a nucleic acid encoding the antibody specifically binding to the target antigen and recovering the antibody from the cell or the cultivation medium and thereby producing an antibody specifically binding to a target antigen.
5. A method for producing an antibody specifically binding to a target antigen comprising the following steps: a) recovering from an experimental animal after the administration of a fusion polypeptide according to any one of claims 1, 2 and 3 B-cells that produce the antibody specifically binding to the amino acid sequence of X.sub.1, and b) cultivating a cell comprising a nucleic acid encoding the antibody specifically binding to the amino acid sequence of X.sub.1 and recovering the antibody from the cell or the cultivation medium and thereby producing an antibody specifically binding to a target antigen.
6. A method for selecting an antibody specifically binding to a target antigen comprising the following steps: a) determining the binding affinity of a plurality of antibodies to a target antigen, which is immobilized, whereby the amino acid sequence of X.sub.1 of the fusion polypeptide according to any one of claims 1, 2 and 3 comprises the target antigen amino acid sequence, b) selecting the antibody having an apparent complex stability above a pre-defined threshold level.
7. A method for selecting an antibody that specifically binds to a target antigen wherein the immunization of an animal to generate antibodies is made with the fusion polypeptide according to any one of claims 1, 2 and 3.
8. A method for selecting an antibody that specifically binds to a target antigen wherein the selecting of the antibody that specifically bind to an antigen is made with the fusion polypeptide according to any one of claims 1, 2 and 3.
9. The fusion polypeptide according to claim 2, wherein X.sub.1 comprises an amino acid sequence that corresponds to a hidden epitope.
10. A method for producing an antibody specifically binding to a target antigen comprising the following steps: a) administering to an experimental animal a fusion polypeptide according to claim 9 for at least one time, whereby the amino acid sequence of X.sub.1 comprises the amino acid sequence of the target antigen, b) recovering from the experimental animal three to ten days after the last administration of the polypeptide B-cells that produce the antibody specifically binding to the target antigen, and c) cultivating a cell comprising a nucleic acid encoding the antibody specifically binding to the target antigen and recovering the antibody from the cell or the cultivation medium and thereby producing an antibody specifically binding to a target antigen.
11. A method for producing an antibody specifically binding to a target antigen comprising the following steps: a) recovering from an experimental animal after the administration of a fusion polypeptide according to claim 9 B-cells that produce the antibody specifically binding to the amino acid sequence of X.sub.1, and b) cultivating a cell comprising a nucleic acid encoding the antibody specifically binding to the amino acid sequence of X.sub.1 and recovering the antibody from the cell or the cultivation medium and thereby producing an antibody specifically binding to a target antigen.
12. A method for selecting an antibody specifically binding to a target antigen comprising the following steps: a) determining the binding affinity of a plurality of antibodies to a target antigen, which is immobilized, whereby the amino acid sequence of X.sub.1 of the fusion polypeptide according to claim 9 comprises the target antigen amino acid sequence, b) selecting the antibody having an apparent complex stability above a pre-defined threshold level.
13. A method for selecting an antibody that specifically binds to a target antigen wherein the immunization of an animal to generate antibodies is made with the fusion polypeptide according to claim 9.
14. A method for selecting an antibody that specifically binds to a target antigen wherein the selecting of the antibody that specifically bind to an antigen is made with the fusion polypeptide according to claim 9.
Description
DESCRIPTION OF THE FIGURES
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
(24)
(25)
(26)
(27)
(28)
(29)
(30)
(31)
(32)
(33)
(34)
(35)
(36)
(37)
(38)
(39)
(40)
EXAMPLES
Example 1
(41) Expression and Purification
(42) The polypeptides were produced in E. coli (pQE80L vector/E. coli BL21 CodonPlus-RP cell line) according to known methods.
(43) For the purification of the crude polypeptides an affinity chromatography step was used either under native conditions or under denaturing conditions in the presence of chaotropic agents. For fusion polypeptide comprising the SlyD part purification in the presence of chaotropic agents is especially suited as the total amount of fusion polypeptide could be isolated from the E. coli cells. Additionally the entire fusion polypeptide is obtained in a random coil conformation. The fusion polypeptide still bound to the affinity chromatography material is transferred into native conditions by washing the column with a physiological salt solution. Due to the spontaneous folding of the SlyD and FKBP12 parts of the fusion polypeptide also the inserted amino acid sequence was transferred to its native conformation. The refolded fusion polypeptide was recovered with an imidazole gradient in a physiological buffer from the affinity chromatography column.
Example 2
(44) Chemical Derivatization
(45) The C-terminal lysine residue was activated under acidic conditions (pH 6) with LC-SPDP (Succinimidyl 6-(3-[2-pyridyldithio]-(propionamido) hexanoate)) ((Pierce, Cat.: 68181-17-9).
(46) Arginine and lysine are bases that can take up the proton of lysine's alkyl ammonium group. The free amino can be derivatized with any hydroxyl succinimidyl-activated carbonic acid.
Example 3
(47) Formalin Treatment
(48) The derivatized fusion polypeptides can be treated with a formalin solution. Thereafter the fixated derivatized fusion polypeptides can be purified by size exclusion chromatography in order to obtain compositions with defined oligomerization status (monomeric, oligomeric, multimeric).
Example 4
(49) BIAcore Characterization of Antibody Producing Clone Culture Supernatants
(50) A BIAcore T100 instrument (GE Healthcare) was used with a BIAcore CM5 sensor mounted into the system. The sensor was preconditioned by a 1 min. injection at 100 l/min of 0.1% SDS, 50 mM NaOH, 10 mM HCl and 100 mM H.sub.3PO.sub.4.
(51) The system buffer was HBS-ET (10 mM HEPES (pH 7.4) supplemented with 150 mM NaCl, 1 mM EDTA, 0.05% (w/v) Tween 20). The sample buffer was the system buffer.
(52) The BIAcore T100 System was driven under the control software V1.1.1. Polyclonal rabbit IgG antibody <IgGFCM>R (Jackson ImmunoResearch Laboratories Inc.) was immobilized at 30 g/ml in 10 mM sodium acetate buffer (pH 4.5) at 6500 RU on the flow cells 1, 2, 3, and 4, respectively, via EDC/NHS chemistry according to the manufacturer's instructions. Finally, the sensor surface was blocked with a 1 M ethanolamine solution. The complete experiment was performed at 25 C.
(53) The clone culture supernatants containing the respective antibodies at 35 nM to 190 nM were captured for 1 min. at a flow rate of 5 l/min on the <IgGFCM>R surface. As analytes in solution the recombinant antigen, the biotinylated disulfide-bridged recombinant antigen, SlyD/FKBP12-antigen, Thermus thermophilus SlyD-antigen, SlyD/FKBP12-control and/or Thermus thermophilus SlyD-wt fusion polypeptides were used. The respective analytes were injected at different concentration steps from 90 nM, 30 nM, 10 nM, 3.3 nM, 1.1 nM and 0 nM. The association phase was monitored for 3.5 min. at a flow rate of 100 l/min. The dissociation was monitored for 15 min. at a flow rate of 100 l/min. The system was regenerated using a 10 mM glycine buffer (pH 1.7). Kinetics were evaluated using the BIAcore Evaluation Software.
Example 5
(54) IHC Sample Preparation
(55) The matrix immobilized LC-SPDP fusion polypeptide was treated with organic solvent, heated and treated with an acidic buffer. Thereafter the matrix associated polypeptides are recovered and reducing conditions. To obtain a material with defined composition a size exclusion chromatography can be performed. The thereby obtained material has a defined oligomeric state (monomer, oligomer, and polymer) and can be used as immunogen for the immunization of experimental animals but it can also be used as test antigen for the selection and screening of antibodies.
Example 6
(56) Immunization
(57) The pre-formulated immunogenic fusion polypeptide is administered to an experimental animal, such as mouse, rat, rabbit, sheep, or hamster, intraperitoneally at different dosages. Prior to collection of the B-cells a boost immunization is performed. B-cell hybridomas can be obtained according to the method of Koehler and Millstein (Kohler, G. and Milstein, C., Nature 256 (1975) 495-497). The obtained hybridomas are deposited as single clones or cells in the wells of a multi well plate. Primary hybridoma cultures that were tested positive with respect to the binding of the antibody by the secreted antibody are further screened with a kinetic screening method.
Example 7
(58) Anti-IGF-1 Antibodies
(59) The cells obtained from four immunized NMRI-mice were analyzed using an ELISA. Nunc Maxisorb F multi well plates were coated with SlyD/FKBP12-IGF-1, SlyD/FKBP12-IGF-1 (74-90), Thermus thermophilus SlyD-IGF-1, SlyD/FKBP12-control or Thermus thermophilus SlyD-wt by applying a solution comprising 0.41 g polypeptide per ml. The isolated antigen IGF-1 was immobilized in the wells of StreptaWell High Bind SA multi well plates by applying a solution comprising 90 ng/ml biotinylated IGF-1 or 500 ng/ml biotinylated IGF-1-peptide loop.
(60) Thereafter free binding sites were blocked by applying a solution comprising 1% RPLA in PBS for one hour at room temperature. The wells were washed three times with a solution comprising 0.9% (w/v) sodium chloride and 0.05% (w/v) Tween. As samples the mouse serum diluted 1:50 with PBS were used. Optional further dilution was performed in 1:4 steps until a final dilution of 1:819,200. The incubation time was one hour at room temperature. The wells were washed three times with a solution comprising 0.9% (w/v) sodium chloride and 0.05% (w/v) Tween. As detection antibody a polyclonal antibody against the constant domain of the target antibodies conjugated to a peroxidase was used (PAK<M-Fc>S-F(ab).sub.2-POD). The detection antibody was applied at a concentration of 80 ng/ml in PBS comprising 1% (w/v) RSA. The incubation time was one hour at room temperature. The wells were washed three times with a solution comprising 0.9% (w/v) sodium chloride and 0.05% (w/v) Tween. Afterwards the wells were incubated with an ABTS solution for 15 minutes at room temperature. The intensity of the developed color was determined photometrically. Exemplary results are presented in the following Table.
(61) TABLE-US-00043 TABLE immobilized SlyD/FKBP12- IGF-1 IGF-1-peptide SlyD/FKBP12- SlyD/FKBP12- mouse IGF-1 loop IGF-1(74-90) control K1575M1 189 194 2911 8379 K1575M2 395 678 1470 2546 K1575M3 465 272 4126 10091 K1575M4 564 2426 6337 K1576M1 2143 2058 8302 9934 K1576M2 2960 8816 K1576M3 2978 7756 K1576M4 6957 11095 K1576M5 11221 16588 : no binding detectable in ELISA
Example 8
(62) Kinetic Screening of Hybridoma Culture Supernatants
(63) For the selection of IHC suited antibodies a target complex half-live at 37 C. of 10 min. is set.
(64) The kinetic screening was performed on a BIAcore A100 under control of the software version V1.1. A BIAcore CM5 chip is loaded to the machine and according to the manufacturers instruction addressed hydrodynamically and thereafter the chip is conditioned. As running buffer a HBS-EP buffer is used (10 mM HEPES (pH 7.4), 150 mM NaCl, 1 mM EDTA, 0.05% (w/v) P20). A polyclonal anti-IgG Fc capture antibody composition of a concentration of 30 g/ml in 10 mM sodium acetate buffer (pH 4.5) is pre-concentrated to spots 1, 2, 4 and 5 in flow cells 1, 2, 3 and 4. The antibody is immobilized at 10,000 RU via NHS/EDC covalently. The sensor is deactivated thereafter by saturation with 1 M ethanolamine solution. Spots 1 and 2 were used for the determination and spots 2 and 4 were used as reference. Prior to application to the sensor chip the hybridoma culture supernatants were diluted 1:5 in HBS-EP buffer. The diluted solution was applied at a flow rate of 30 l/min for 1 min. Immediately thereafter the antigen was injected at a flow rate of 30 l/min for 2 min. Thereafter the signal is recorded for another 5 min. The sensor was regenerated by injecting a 10 mM glycine-HCl solution (pH 1.7) for 2 min. at a flow rate of 30 l/min. The recorded signal shortly before the end of the injection of the antigen is denoted as binding late (BL). The recorded signal shortly before the end of the recording of the dissociation is denoted as stability late (SL). Therewith the apparent complex stability is calculated with the following formula:
(1[BL(RU)SL(RU)/BL(RU)].
(65) The hybridoma cells selected in the kinetic screening were deposited as single cells by FACS (FACSAria (Becton Dickinson), Software V4.1.2). The monoclonal clones are cultivated in 24 well plates or in 100 ml spinner flasks in RPMI-1640 cultivation medium.
Example 9
(66) Immunohistochemical Analysis
(67) The IHC analysis was performed either manually or automated on a Ventana Benchmark XT or Discovery XT 8R machine. The antibodies were tested on suited positive or genitive, formalin fixed or cryo-conserved tissue or cells.
(68) Alternatively cells are transfected with a nucleic acid encoding the target polypeptide. The transfected cells are lysed and tested for their suitability as positive or negative control by Western Blotting.
Example 10
(69) SlyD/FKB12-Antigen Scaffold Assisted Production of Anti-ERCC1 Antibodies
(70) Immunization
(71) 8-12 weeks old SJL mice, were subjected to intraperitoneal immunization with 100 g of a KHL-coupled ERCC1 derived peptide covering the amino acids 219-245 of human ERCC1 (Excision Repair Cross Complementing). ERCC1 derivatives were produced synthetically by peptide synthesis.
(72) The mice were immunized 3 times (initial and 6 weeks and 10 weeks after the initial boost). The first immunization was performed using complete Freud's adjuvant, the second and third immunization was done using incomplete Freud's adjuvant. The final boost was done i.v. using 100 g of KLH-coupled peptide antigen three days before the hybridoma fusion took place. The production of hybridoma primary cultures was done according to Kohler and Milstein (Kohler, G. and Milstein, C., Nature 256 (1975) 495-497). The hybridomas were isolated into 96-well MTPs by limiting dilution and screened for antigen binding by means of ELISA. ELISA was driven by a Tecan Sunrise running under Firmware: V 3.15 19/03/01; XREAD PLUS Version: V 4.20. Primary hybridoma cell cultures, which showed a positive color formation upon binding versus a biotinylated ERCC1 derived peptide covering the amino acids 219-245 in ELISA, were transferred into the kinetic screening process as described herein.
(73) In order to avoid the selection of IHC unsuitable, just linear peptide binding antibodies, further screening efforts were performed using a scaffold-based approach. The scaffold approach further deselected antibodies, which bound the immunogenic peptide at its termini.
(74) Production of SlyD/FKBP12-ERCC1
(75) A Synthetic gene encoding SlyD/FKBP12-ERCC1 and SlyD/FKBP12-ctrl was purchased from Sloning Biotechnology GmbH (Germany) and was cloned into a pQE80L expression vector. The polypeptides were produced as E. coli codon optimized gene constructs in E. coli BL21 CodonPlus-RP (see
(76) For the purification of the crude fusion polypeptides an affinity chromatography step was used under denaturing conditions in the presence of chaotropic agents. For fusion polypeptide comprising the SlyD part purification in the presence of chaotropic agents is especially used as the total amount of fusion polypeptide could be isolated from the E. coli cells. Additionally the entire fusion polypeptide was obtained in a random coil conformation. The fusion polypeptide still bound to the affinity chromatography material was transferred into native conditions by washing the column with a physiological salt solution. Due to the spontaneous folding of the SlyD and FKBP12 parts of the fusion polypeptide also the inserted amino acid sequence can be transferred to its native conformation. The refolded fusion polypeptide was recovered with an imidazole gradient in a physiological buffer from the affinity chromatography column. An SDS gel and Western blot of the SlyD/FKBP12-ERCC1 fusion polypeptide is shown in
(77) Fluorescence Measurements
(78) The affinity purified fusion polypeptide was dialyzed versus 75 mM HEPES buffer (pH 7.5, 150 mM NaCl, 6.5% (w/v) sucrose, 10 mM cysteine) and filtrated. SlyD/FKBP12-ERCC1 was UV/Vis spectroscopically quantified at 7.4 mg/ml using the calculated extinction coefficient for the 35380.301 Da polypeptide (
(79) Protein fluorescence measurements were used to test the conformational nature of SlyD/FKBP12-ERCC1. FKBP12 C22A as a carrier for polypeptide insertions is especially useful, because the single FKBP12 Trp moiety can be used to diagnose the structural integrity of the FKBP12 moiety (Scholz, C., et al., J. Biol. Chem. 271 (1996) 12703-12707; Russo, A. T., et al., J. Mol. Biol. 330 (2003) 851-866). FKBP12 C22A in its native structure shows a single fluorescence emission peak at 320 nm (Zoldak, G., et al., J. Mol. Biol. 386 (2009) 1138-1152).
(80) 250 l of 2.5 mg/ml SlyD/FKBP12-ERCC1 in HBS-E-buffer (pH 7.4) were analyzed at different temperatures. A Cary Eclipse instrument under the Scan Software Version: 1.1(132) was used at 5 nm band width for excitation and emission. A wavelength scan from 300 nm-600 nm was driven at 600 nm/min. The excitation of the intrinsic tryptophan fluorescence was set to 294 nm. A broad peak at 350 nm was obtained (
(81) Therefore, the single Trp residue in the SlyD/FKBP12-ERCC1 fusion polypeptide is exposed to the solvent already at 25 C., indicating that the chimeric FKBP12 in the SlyD-FKBP12 context is partially or completely unfolded.
(82) Therefore, the scaffold is an ideal platform for mimicking and presenting a structural plurality of non-stable peptide conformations as they typically occur in paraffin-embedded, formalin-fixed tissue during immune histochemical experiments. (Abe, M., et al., Anal. Biochem. 318 (2003) 118-123).
(83) FK506 BIAcore Binding Assay
(84) A BIAcore 3000 instrument under control of the software version V4.1 was mounted with a sensor SAchip according to the manufacturer's instruction. As running buffer a HBS-EP buffer was used (10 mM HEPES, pH 7.4, 150 mM NaCl, 1 mM EDTA, 0.05% (w/v) P20 (10% aqueous solution of the non-ionic surfactant Polysorbate 20 (Tween 20)). 1213 RU of bi-linker-FK506 conjugate (Roche Diagnostics Mannheim, Germany) were captured on flow cell 4.
(85) 300 nM purified SlyD/FKBP12-ERCC1 fusion polypeptide and 300 nM SlyD/FKBP12 control polypeptide were injected into the system at 30 l/min for 3 min. association time and 3 min. dissociation time
(86) The sensor was regenerated by injecting a 10 mM glycine-HCl solution (pH 1.7) for 2 min. at a flow rate of 30 l/min.
(87) The BIAcore binding assay with 300 nM fusion polypeptide SlyD/FKBP12-ERCC1 as analyte in solution vs. the sensor surface presented ligand bi-FK506 (
(88) The inability of the SlyD/FKBP12-ERCC1 fusion polypeptide to bind FK-506 provides another evidence for a SlyD/FKBP12-ERCC1 structure, which deviates from that of the FKBP12 (C22A) conformation. This is accompanied by a loss of binding activity of the chimeric FKBP12 domain.
(89) Analytical HPLC Chromatographic Analyses
(90) Analytical HPLC chromatographic analyses were performed with fusion polypeptides in order to analyze the oligomeric status of the fusion polypeptide
(91) A Chromeleon Dionex HPLC device was used as recommended by the manufacturer at 25 C. with a TSK3000SWXL column equilibrated in HBS-E-buffer (pH 7.4). The buffer flow was 0.7 ml/min. 100 l of a SlyD/FKBP12-ERCC1 comprising solution (7.4 mg/ml) was injected into the system (see
(92)
(93) Kinetic Screening Using
(94) The SlyD/FKBP12-ERCC1 fusion polypeptide was used in SPR binding analyses. It is helpful to use monomeric and monovalent analytes in solution to determine the antibody binding kinetics according to a Langmuir model. Furthermore, it is helpful for SPR measurements to use an analyte with increased, i.e. high, molecular weight to increase the mass sensitivity of the measurements. At the same time the epitope accessibility must be given.
(95) A scheme of the BIAcore screening assay is depicted in
(96) The kinetic screening was performed on a BIAcore A100 instrument under control of the software version V1.1. A BIAcore CM5 chip was loaded to the machine and according to the manufacturer's instruction addressed hydrodynamically. Thereafter the chip was conditioned. As running buffer a HBS-EP buffer is used (10 mM HEPES, pH 7.4, 150 mM NaCl, 1 mM EDTA, 0.05% (w/v) P20). A polyclonal composition of anti-IgG Fc capture antibodies of a concentration of 30 g/ml in 10 mM sodium acetate buffer (pH 4.5) is pre-concentrated to spots 1, 2, 4 and 5 in flow cells 1, 2, 3 and 4. The antibody was covalently immobilized at 10,000 RU via NHS/EDC chemistry. The sensor was deactivated thereafter with a 1 M ethanolamine solution. Spots 1 and 2 were used for the determination and spots 2 and 4 were used as reference. Prior to application to the sensor chip the hybridoma supernatants were diluted 1:5 in HBS-EP buffer. The diluted solution was applied at a flow rate of 30 l/min for 1 min. Immediately thereafter the formulated antigen, such as the FKBP12 fusion polypeptide was injected at a flow rate of 30 l/min for 2 min. Thereafter the signal is recorded for another 5 min. The sensor was regenerated by injecting a 10 mM glycine-HCl solution (pH 1.7) for 2 min. at a flow rate of 30 l/min. The recorded signal shortly before the end of the injection of the antigen is denoted as binding late (BL). The recorded signal shortly before the end of the recording of the dissociation is denoted as stability late (SL). Both data points are plotted versus each other. Selected antibodies have a Binding Late value that is equal to the Stability Late value. These antibodies populate the area near the trend line indicating BL=SL in the plot.
(97)
(98)
(99)
(100)
(101) Western Blotting
(102)
(103) For western blotting, 5 g OVCAR-3 and 5 g HEK-293 cell lysate were loaded into the gel lanes on 4-12% NuPAGE SDS gels (Invitrogen). Both cell lines were not pretreated e.g. by radiation or Cisplatin.
(104) Western blotting was performed according to standard protocols with NuPAGE buffers and reagents (Invitrogen). The antibody 5.001.35 was used at a concentration of 50 ng/ml. Primary antibody incubation was performed for 30 min. at room temperature (RT). The membrane was developed using the LumiImager together with the LumiLight reagent according to the manufacturer's instructions (Roche Applied Science, Mannheim, Germany). The endogenous basal ERCC1 level was specifically detected as a single 37 kDa band in the Western blot.
(105) IHC Experiments
(106)
(107) Summary
(108) In contrast to the small molecular weight ERCC1 peptide (2 kDa) the scaffold as used herein is a high molecular weight analyte (36 kDa), which amplifies the signals in a SPR-based kinetic screening approach.
(109) A peptide based screening reagent bears the risk of selecting antibodies recognizing the peptide's termini, which is completely avoided by using the scaffold approach as reported herein, in which the peptide is embedded in an N-terminal and C-terminal polypeptide context. Despite offering a plurality of meta-stable peptide insertions the scaffold fusion polypeptide as a whole is stable, soluble and monomeric. 1:1 Langmuir kinetics can be easily measured by means of biosensorics.
(110) Using the fusion polypeptide in this set up, it is well suited to simulate the FFPE IHC situation and therefore is a well suited screening reagent for the development of IHC suited antibodies.
(111) Without being bound by theory the fusion polypeptide comprises a folded SlyD derived part and an unfolded or partially unfolded human FKBP12 derived part, which offers at least its single core Trp residue for solvent contact, like it is shown for SlyD/FKBP12-ERCC1. SlyD folds reversible and shows thermal stability sufficient for technical applications.
(112) The SlyD/FKBP-12 scaffold is a suitable platform for mimicking a plurality of peptidic secondary structure motives like those present in a paraffin-embedded, formalin-fixed tissue in immune histochemical experiments (see Abe, et al. (2003) supra).
(113) The fusion polypeptide is especially suited as immunogen compared to the full length polypeptide from which the inserted (immunogenic) amino acid sequence is derived, e.g. with respect to solubility, reversible folding (naturation/denaturation), and the absence of disulfide bonds to be correctly formed. The fusion polypeptide as reported herein provides the scaffold into which the immunogenic amino acid sequence is inserted. It stabilizes the structure of the inserted immunogenic amino acid sequence (without being bound by theory by reducing the conformational entropy). Without being bound by theory it is assumed that the N-terminal SlyD fusion polypeptide keeps the complete chimeric fusion polypeptide in a soluble and thermodynamically stable but partly unfolded form.
(114) Rebuzzini, G. (PhD work at the University of Milano-Bicocca (Italy) (2009)) reports a study of the hepatitis C virus NS3 helicase domain for application in a chemiluminescent immunoassay. In his work Rebuzzini reports that chimeric FKBP12 used as an immunogen for the presentation of the NS3 helicase domain with the insertion sequences according to Knappe, T. A., et al. (J. Mol. Biol. 368 (2007) 1458-1468) is thermodynamically instable. This correlates to our findings, that the chimeric FKBP12 moiety in the SlyD-FKBP12-antigen fusion polypeptide is partially or completely unfolded. In contrast to Rebuzzini's findings the SlyD/FKBP12-antigen fusion polypeptide has been found herein to be monomeric and stable.
Example 11
(115) Production of IGF-1(74-90) Specific Antibodies
(116) Antigen specific antibodies were obtained by immunization of mice with chimeric Thermus Thermophilus-SlyD-antigen fusion polypeptide. A plurality of epitopes can be targeted on the scaffold's surface, from which the antibodies binding to the target antigen can be identified by differential screening versus the wild-type Thermus Thermophilus-SlyD as a negative control, or versus the native recombinant antigen (IGF-1) as a positive control. In the following an example demonstrates the properties of archaic SlyD derivatives compared to the potentially metastable human FKBP12. Thermus Thermophilus-SlyD allows the presentation of enthalpic, rigid and stable structures and therefore is suitable for the development of monoclonal antibodies versus native protein structures.
(117) Production of Thermus thermophilus SlyD Fusion Polypeptides
(118) Guanidinium hydrochloride (GdmCl) (A-grade) was purchased from NIGU (Waldkraiburg, Germany). Complete EDTA-free protease inhibitor tablets, imidazole and EDTA were from Roche Diagnostics GmbH (Mannheim, Germany), all other chemicals were analytical grade from Merck (Darmstadt, Germany). Ultrafiltration membranes (YM10, YM30) were purchased from Amicon (Danvers, Mass., USA), microdialysis membranes (VS/0.025 m) and ultrafiltration units (Biomax ultrafree filter devices) were from Millipore (Bedford, Mass., USA). Cellulose nitrate and cellulose acetate membranes (1.2 m, 0.45 m and 0.2 m pore size) for the filtration of crude lysates were from Sartorius (Goettingen, Germany).
(119) Cloning of Expression Cassettes
(120) The sequence of the SlyD polypeptide from Thermus thermophilus was retrieved from the SwissProt database (acc. no. Q72H58). The sequence of the SlyD polypeptide from Thermococcus gammatolerans was retrieved from the Prosite database (acc. no. C5A738). Synthetic genes encoding Thermus thermophilus SlyD, Thermus thermophilus SlyD-IGF-1(74-90), and Thermus thermophilus SlyD-IF were purchased from Sloning Biotechnology GmbH (Germany) and were cloned into a pQE80L expression vector. The codon usage was optimized for expression in E. coli host cells. Synthetic genes encoding Thermococcus gammatolerans SlyD, Thermococcus gammatolerans SlyD-IGF-2(53-65), Thermus thermophilus SlyD-antigen and Thermococcus gammatolerans SlyD-antigen were purchased from Geneart (Germany) and were cloned into pET24 expression vectors (Novagen, Madison, Wis., USA). The codon usage was optimized for expression in E. coli host cells.
(121) Additionally, a GS-linker (GGGS, SEQ ID NO: 81) and a His-tag were fused to the carboxy terminal end in order to allow an affinity purification of the fusion polypeptides by an immobilized metal ion exchange chromatography.
(122) In order to generate monoclonal antibodies specifically binding to the IGF-1-fragment 74-90 (amino acid sequence NKPTGYGSSSRRAPQTG, SEQ ID NO: 92) the respective peptide amino acid sequences was fused into the molecular chaperone SlyD derived from Thermus thermophilus by deleting amino acids 68-120 of the original protein. Due to an angle adaption of the IGF-1 insert, the Asp at position 70 and the Leu at position 88 were substituted by a Gly (D70G and L88G). Thus the fusion polypeptide has the amino acid sequence:
(123) TABLE-US-00044 (SEQIDNO:101) MRGSKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGR EEGEAFQAHVPAEKAYGPHGNKPTGYGSSSRRAPQTGGAGKDLDFQVEV VKVREATPEELLHGHAHGGGSRKHHHHHHHH.
(124) As a control, the native wild-type SlyD from Thermus thermophilus was used:
(125) TABLE-US-00045 (SEQIDNO:104) MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEG EAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGN PMPLTVVAVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATPEELLHGHA HGGGSRKHHHHHH.
(126) For Screening and specificity testing a Thermus thermophilus SlyD-IF fusion polypeptide was produced. Thermus thermophilus SlyD-IF fusion polypeptide lacks the IF domain, which was replaced by the amino acid sequence motif AGSGSS, and comprises a C-terminal amino acid sequence tag of SEQ ID NO: 16:
(127) TABLE-US-00046 (SEQIDNO:120) MRGSKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGR EEGEAFQAHVPAEKAYGPHGAGSGSSGAGKDLDFQVEVVKVREATPEELL HGHAHGGGSRKHHHHHHHH.
(128) As a control the native SlyD from Thermococcus gammatolerans comprising a C-terminal amino acid sequence tag of SEQ ID NO: 16 was used:
(129) TABLE-US-00047 (SEQIDNO:121) MKVERGDFVLFNYVGRYENGEVFDTSYESVAREQGIFVEEREYSPIGVT VGAGEIIPGIEEALLGMELGEKKEVVVPPEKGYGMPREDLIVPVPIEQF TSAGLEPVEGMYVMTDAGIAKILKVEEKTVRLDFNHPLAGKTAIFEIEV VEIKKAGEAGGGSRKHHHHHH.
(130) As a control for cross reactivity the structurally homologous hairpin sequence from human IGF-2(53-65) was inserted into Thermococcus gammatolerans SlyD, which was fused with a GS-linker and a hexahistidine-tag at the C-terminus:
(131) TABLE-US-00048 (SEQIDNO:122) MKVERGDFVLFNYVGRYENGEVFDTSYESVAREQGIFVEEREYSPIGVT VGAGEIIPGIEEALLGMELGEKKEVVVPPEKGYGMP-G-SRVSRRSR G-G-AGKTAIFEIEVVEIKKAGEAGGGSRKHHHHHH.
Expression, Purification and Refolding of Fusion Polypeptides
(132) All SlyD polypeptides can be purified and refolded by using almost identical protocols. E. coli BL21 (DE3) cells harboring the particular expression plasmid were grown at 37 C. in LB medium containing the respective antibiotic for selective growth (Kanamycin 30 g/ml, or Ampicillin (100 g/ml)) to an OD600 of 1.5, and cytosolic overexpression was induced by adding 1 mM isopropyl--D-thiogalactoside (IPTG). Three hours after induction, cells were harvested by centrifugation (20 min at 5,000 g), frozen and stored at 20 C. For cell lysis, the frozen pellet was resuspended in chilled 50 mM sodium phosphate buffer (pH 8.0) supplemented with 7 M GdmCl and 5 mM imidazole. Thereafter the suspension was stirred for 2-10 hours on ice to complete cell lysis. After centrifugation (25,000 g, 1 h) and filtration (cellulose nitrate membrane, 8.0 m, 1.2 m, 0.2 m), the lysate was applied onto a Ni-NTA column equilibrated with the lysis buffer. In the subsequent washing step the imidazole concentration was raised to 10 mM (in 50 mM sodium phosphate buffer (pH 8.0) comprising 7 M GdmCl, 5.0 mM TCEP) and 5 mM TCEP was added in order to keep the thiol moieties in a reduced form and to prevent premature disulfide bridging. At least 15 to 20 volumes of the reducing washing buffer were applied. Thereafter, the GdmCl solution was replaced by 50 mM sodium phosphate buffer (pH 8.0) comprising 100 mM NaCl, 10 mM imidazole, and 5 mM TCEP to induce conformational refolding of the matrix-bound SlyD fusion polypeptide. In order to avoid reactivation of co-purifying proteases, a protease inhibitor cocktail (Complete EDTA-free, Roche) was added to the refolding buffer. A total of 15 to 20 column volumes of refolding buffer were applied in an overnight procedure. Thereafter, both TCEP and the Complete EDTA-free inhibitor cocktail were removed by washing with 10 column volumes 50 mM sodium phosphate buffer (pH 8.0) comprising 100 mM NaCl and 10 mM imidazole. In the last washing step, the imidazole concentration was raised to 30 mM (10 column volumes) in order to remove tenacious contaminants. The native polypeptide was eluted by applying 250 mM imidazole in the same buffer. Protein-containing fractions were assessed for purity by Tricine-SDS-PAGE (Schaegger, H. and von Jagow, G., Anal. Biochem. 166 (1987) 368-379) and pooled. Subsequently, the protein was subjected to size-exclusion-chromatography (Superdex HiLoad, Amersham Pharmacia) using potassium phosphate as the buffer system (50 mM potassium phosphate buffer (pH 7.0), 100 mM KCl, 0.5 mM EDTA). Finally, the protein-containing fractions were pooled and concentrated in an Amicon cell (YM10) to a concentration of 5 mg/ml.
(133) UV Spectroscopic Measurements
(134) Protein concentration measurements were performed with an UVIKON XL double-beam spectrophotometer. The molar extinction coefficients (280) for the SlyD variants were calculated according to Pace (Pace, C. N., et al., Protein Sci. 4 (1995) 2411-2423).
(135) CD Spectroscopic Measurements
(136) To examine whether the chimeric fusion proteins according to the invention adopt a folded conformation CD spectra in the near-UV region were measured. CD spectra were recorded and evaluated using A JASCO J-720 instrument and JASCO software according to the manufacturer's recommendations. A quartz cuvette with 0.2 cm pathlength was used. The instrument was set to 1 C. resolution, 1 nm band width, 5 mdeg sensitivity and accumulation mode 1. The sample buffer was 50 mM potassium phosphate pH 7.5, 100 mM NaCl, 1 mM EDTA. The protein analyte concentration for each analysis was 36 M Thermus thermophilus SlyD wild-type, 23 M Thermus thermophilus SlyD-IF, 16 M Thermus thermophilus SlyD-antigen, 19 M Thermococcus gammatolerans SlyD wild-type, and 16 M Thermococcus gammatolerans SlyD-antigen. CD signals between 250 nm and 330 nm with 0.5 nm resolution and 20 nm scan per minute were recorded at 20 C. In a subsequent experimental embodiment the CD signals were determined in temperature gradients (20 C.-100 C.) and (100 C.-20 C.) for Thermococcus gammatolerans SlyD derivatives, respectively (20 C.-85 C.) and (85 C.-20 C.) for Thermus thermophilus SlyD derivatives at 277 nm constant wavelength. The temperature gradient was driven at 1 C. per minute.
(137)
(138)
(139) Under the given physical conditions no complete unfolding of Thermococcus gammatolerans SlyD-antigen could be achieved even at 100 C. (see
(140) Immunization of Mice with Thermus thermophilus SlyD-IGF-1(74-90) and Development of Monoclonal Antibodies Versus IGF-1
(141) 8-12 weeks old Balb/c and NMRI mice were subjected to repeated intraperitoneal immunizations with 100 g of Thermus Thermophilus SlyD-IGF-1(74-90). The mice were immunized three times, at the time points of 6 weeks and 10 weeks after the initial immunization. The first immunization can be performed using complete Freud's adjuvant, the second and third immunizations were done using incomplete Freud's adjuvant. The mice serum titers versus native recombinant IGF-1 and Thermus Thermophilus SlyD-IGF-1(74-90) were tested after 12 weeks by ELISA methods as described in the following. After 12 weeks serum titers were analyzed using ELISA. The ELISA was driven by a Tecan Sunrise running under Firmware: V 3.15 19/03/01; XREAD PLUS Version: V 4.20. Nunc Maxisorb F multi well plates were coated with Thermus Thermophilus SlyD-IGF-1(74-90) by applying a solution comprising 0.5 g polypeptide per ml. The isolated antigen IGF-1 was immobilized in the wells of StreptaWell High Bind SA multi well plates by applying a solution comprising 90 ng/ml biotinylated IGF-1. Thereafter free binding sites were blocked by applying a solution comprising 1% RPLA in PBS for one hour at room temperature. The wells were washed three times with a solution comprising 0.9% (w/v) sodium chloride and 0.05% (w/v) Tween. As samples the mouse serum diluted 1:50 with PBS was used. Optional further dilution was performed in 1:4 steps until a final dilution of 1:819,200. The incubation time was one hour at room temperature. The wells were washed three times with a solution comprising 0.9% (w/v) sodium chloride and 0.05% (w/v) Tween. As detection antibody a polyclonal antibody against the constant domain of the target antibodies conjugated to a peroxidase was used (PAK<M-Fc>S-F(ab).sub.2-POD). The detection antibody was applied at a concentration of 80 ng/ml in PBS comprising 1% (w/v) RSA. The incubation time was one hour at room temperature. The wells were washed three times with a solution comprising 0.9% (w/v) sodium chloride and 0.05% (w/v) Tween. Afterwards the wells were incubated with an ABTS solution for 15 minutes at room temperature. The intensity of the developed color was determined photometrically.
(142) Three days before preparation of spleen cells and fusion with a myeloma cell line, the final booster immunization was performed by i.v. injection of 100 g of Thermus Thermophilus SlyD-IGF-1(74-90) fusion polypeptide. The production of hybridoma primary cultures can be done according to the procedure of Koehler and Milstein (Koehler, G. and Milstein, C., Nature. 256 (1975) 495-497).
(143) ELISA Screening
(144) Primary culture supernatants were tested by ELISA for reactivity against the immunogen Thermus Thermophilus SlyD-IGF-1(74-90), biotinylated native IGF-1 and wild-type Thermus Thermophilus SlyD respective a blank plate. Elisa was driven with a Tecan SUNRISE, Firmware: V 3.15 19/03/01; XREAD PLUS Version: V 4.20. Nunc Maxisorb F multi well ELISA plates were coated with 5 g/ml SlyD-fusion polypeptides. StreptaWell High Bind SA multi well plates were coated with 125 ng/ml recombinant biotinylated IGF-1 antigen. Thereafter free binding sites were blocked by 1% RPLA in PBS for one hour at room temperature. The wells were washed three times with a solution comprising 0.9% (w/v) sodium chloride and 0.05% (w/v) Tween. Undiluted hybridoma supernatants in RPMI 1640 medium were used as samples. The incubation time was one hour at room temperature. The wells were washed three times with a solution comprising 0.9% (w/v) sodium chloride and 0.05% (w/v) Tween. As detection antibody a polyclonal antibody against the constant domain of the target antibodies conjugated to a peroxidase was used (PAK<M-Fc>S-F(ab).sub.2-POD). The detection antibody was applied at a concentration of 80 ng/ml in PBS comprising 1% (w/v) RSA. The incubation time was one hour at room temperature. The wells were washed three times with a solution comprising 0.9% (w/v) sodium chloride and 0.05% (w/v) Tween. Afterwards the wells were incubated with an ABTS solution for 15 minutes at room temperature. The intensity of the developed color was determined photometrically at t 405 nm. The reference wavelength was 492 nm. Primary hybridoma supernatants, showing fast and strong color formation in ELISA upon binding to recombinant IGF-1, Thermus Thermophilus SlyD-IGF-1(74-90) and less binding to Thermus Thermophilus SlyD were transferred into the kinetic screening process as described in the following.
(145) SPR-Based Kinetic Screening
(146) Thermus Thermophilus SlyD-IGF-1(74-90), native recombinant IGF-1, native recombinant IGF-2, wild-type Thermus Thermophilus SlyD, and Thermus Thermophilus-SlyD-IGF-1(74-90) were used in an SPR-based kinetic screening analysis. For SPR analyses it is generally accepted to use monomeric and monovalent analytes in solution to determine the antibody binding kinetics according to a Langmuir model. Furthermore, it is rather advantageous for SPR measurements to use an analyte with higher molecular weight to increase the sensitivity of the measurements, since SPR is a mass sensitive analysis.
(147) The kinetic screening was performed on a BIAcore A100 instrument under control of the software version V1.1. A BIAcore CM5 chip was mounted into the instrument and was hydrodynamically addressed conditioned according to the manufacturer's instructions. As a running buffer an HBS-EP buffer was used (10 mM HEPES (pH 7.4), 150 mM NaCl, 1 mM EDTA, 0.05% (w/v) P20). A polyclonal rabbit anti-mouse IgG Fc capture antibody is immobilized at 30 g/ml in 10 mM sodium acetate buffer (pH 4.5) to spots 1, 2, 4 and 5 in flow cells 1, 2, 3 and 4 at 10,000 RU (
(148) Furthermore, the dissociation rate constant kd (1/s) was calculated according to a Langmuir model and the antibody/antigen complex half-life can be calculated in minutes according to the formula ln(2)/(60*kd).
(149) Antibodies were obtained by immunization with the antigen Thermus Thermophilus SlyD-IGF-1(74-90), and screening with Thermus Thermophilus SlyD-IGF-1(74-90), Thermus Thermophilus SlyD wild-type, native IGF-1 and native IGF-2. The scaffold-based screening approach allows to specifically develop antibodies binding to the predefined IGF-1 hairpin epitope.
(150) The primary culture supernatants were further developed by limited dilution into clone culture supernatants by methods known. The clone culture supernatants were tested in a functional assay for affinity and specificity.
(151) BIAcore Characterization of Antibody Producing Clone Culture Supernatants
(152) A BIAcore T200 instrument (GE Healthcare) was used with a BIAcore CM5 sensor mounted into the system. The sensor was preconditioned by a 1 min. injection at 100 l/min of 0.1% SDS, 50 mM NaOH, 10 mM HCl and 100 mM H.sub.3PO.sub.4.
(153) The system buffer was PBS-DT (10 mM Na.sub.2HPO.sub.4, 0.1 mM KH.sub.2PO.sub.4, 2.7 mM KCl, 137 mM NaCl, 0.05% Tween 20, 5% DMSO). The sample buffer was the system buffer.
(154) The BIAcore T200 System was driven under the control software V1.1.1. Polyclonal rabbit IgG antibody <IgGFCM>R (Jackson ImmunoResearch Laboratories Inc.) was immobilized at 30 g/ml in 10 mM sodium acetate buffer (pH 4.5) at 6500 RU on the flow cells 1, 2, 3, and 4, respectively, via EDC/NHS chemistry according to the manufacturer's instructions. Finally, the sensor surface was blocked with a 1 M ethanolamine solution. The complete experiment was performed at 25 C.
(155) The clone culture supernatants containing the respective antibodies at approx. 40 nM were captured for 2 min. at a flow rate of 5 l/min on the <IgGFCM>R surface. As analytes in solution the recombinant native IGF-1, recombinant native IGF-2, Thermus thermophilus SlyD-IGF-1(74-90), recombinant wild-type Thermus thermophilus SlyD, recombinant Thermus thermophilus SlyD-IF, recombinant wild-type Thermococcus gammatolerans SlyD, recombinant Thermococcus gammatolerans SlyD-IGF-2 (53-65) fusion polypeptides were used. Thermus thermophilus SlyD-IF is solely the FKBP domain of Thermus thermophilus SlyD lacking the IF domain. Thermococcus gammatolerans SlyD-IGF-2(53-65) was used to counterscreen and investigate the specificity for the IGF-1 hairpin in contrast to the IGF-2 hairpin insertion. The respective analytes were injected at different concentration steps from 90 nM, 30 nM, 10 nM, 3.3 nM, 1.1 nM and 0 nM. The association phase was monitored for 3 min. at a flow rate of 100 l/min. The dissociation was monitored for 10 min. at a flow rate of 100 l/min. The system was regenerated using a 10 mM glycine buffer (pH 1.7). Kinetics were evaluated using the BIAcore Evaluation Software.
(156) The following terms are used herein: mAb: monoclonal antibody; RU: Relative response unit of monoclonal antibody captured on the sensor; Antigen: antigen in solution; kDa: molecular weight of the antigens injected as analytes in solution; ka: association rate constant; kd: dissociation rate constant; t diss: antibody-antigen complex half-life calculated according to the formula t diss=ln(2)/60*kd; KD: dissociation constant; R.sub.MAX: Binding signal at the end of the association phase of the 90 nM analyte injection; MR: Molar Ratio; Chi.sup.2: failure of the measurement; n.d.: not detectable.
(157)
(158) M-2.28.44 is a monoclonal antibody obtained by conventional immunization of mice with recombinant human IGF-1. Despite the fact that the antibody shows a 30 pM affinity versus IGF-1, a 500 pM cross reactivity can be detected versus IGF-2. Using Thermus thermophilus SlyD-IGF-1(74-90) and Thermococcus gammatolerans SlyD-IGF-2 (53-65) as analyte it can be seen that the cross-reacting IGF-2 epitope is not the IGF hairpin region.
Example 12
(159) Generation of Anti-PLGF Antibodies
(160) Mice were immunized with an immunogen containing the sequence of PLGF(60-76). Subsequently hybridomas were produced and ELISA and Kinetic Screening were performed (for detailed general procedure see Examples 10 and 11).
(161) In the Kinetic Screening process, SlyD/FKBP12-PLGF and a biotinylated peptide PLGF(60-76)-bi, which was singly grafted on streptavidin were used to identify primary culture supernatants with binding activity versus PLGF(60-76). Both analytes produced 1:1 Langmuir kinetics, but the scaffold showed a better dissociation fit with a lower chi2 value, than the SA-probe grafted bi-peptide. Without being bound by theory, a scaffold-based screening approach takes advantage of the monomeric state and the improved epitope accessibility of the scaffold, when compared to the carefully prepared SA-probe.
(162) Antibodies, developed by this approach, like clone 53.4.1 were able to specifically detect PLGF in Western blotting.
Example 13
(163) Anti-IGF-1 Antibodies Produced with SlyD-FKBP12-IGF-1(74-90)
(164) SlyD/FKBP12-IGF-1(74-90) (see
(165) After 10 weeks the serum titers were analyzed using ELISA. Nunc Maxisorb F multi well plates were coated with SlyD/FKBP12-IGF-1(74-90) by applying a solution comprising 0.41 g polypeptide per ml. The isolated antigen IGF-1 was immobilized in the wells of StreptaWell High Bind SA multi well plates by applying a solution comprising 90 ng/ml biotinylated IGF-1. Thereafter free binding sites were blocked by applying a solution comprising 1% RPLA in PBS for one hour at room temperature. The wells were washed three times with a solution comprising 0.9% (w/v) sodium chloride and 0.05% (w/v) Tween. As samples the mouse serum diluted 1:50 with PBS were used. Optional further dilution was performed in 1:4 steps until a final dilution of 1:819,200. The incubation time was one hour at room temperature. The wells were washed three times with a solution comprising 0.9% (w/v) sodium chloride and 0.05% (w/v) Tween. As detection antibody a polyclonal antibody against the constant domain of the target antibodies conjugated to a peroxidase was used (PAK<M-Fc>S-F(ab)2-POD). The detection antibody was applied at a concentration of 80 ng/ml in PBS comprising 1% (w/v) RSA. The incubation time was one hour at room temperature. The wells were washed three times with a solution comprising 0.9% (w/v) sodium chloride and 0.05% (w/v) Tween. Afterwards the wells were incubated with an ABTS solution for 15 minutes at room temperature. The intensity of the developed color was determined photometrically.
Example 14
(166) Antibodies Produced with FKBP12/13 Fusion Polypeptide
(167) The fusion polypeptide as reported herein and used in this examples comprises a part derived from human FKBP12 and a part derived from Arabidopsis thaliana FKBP13. A fusion polypeptide consisting of at least one amino acid sequence from human FKBP12 and at least one amino acid sequences from Arabidopsis thaliana FKBP13 can thermodynamically stabilize human FKBP12 as a scaffold and circumvents the N-terminal fusion of FKBP12 with E. coli SlyD. In nature, FKBP13 contains a disulfide bond. This FKBP13 sequence was grafted into FKBP12 in order to stabilize the chimeric polypeptide for further sequence grafting approaches.
(168) The chimeric FKBP12/13 fusion polypeptide comprising a C-terminal amino acid sequence tag of SEQ ID NO: 16 has the sequence:
(169) TABLE-US-00049 (SEQIDNO:123) MRSGVQVETISPGDGRTFPKRGQTAVVHYTGMLEDGKKFDSSRDRNKPFK FMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGDRGAGCGSGSSCLI PPASVLVFDVELLKLEGGGSRKHHHHHHHH.
(170) The FKBP12/13 fusion polypeptide was expressed in E. coli as described as a soluble and monomeric protein. CD spectroscopic measurements were performed like described in example 12. The CD spectra showed that the FKBP12/13 fusion polypeptide is folded at 20 C.
Example 15
(171) Generation of SlyD-FKBP12/13-CSF1R Fusion Polypeptide
(172) The polypeptide was expressed in E. coli like as described above and purified as described above. After Ni-NTA affinity purification a size exclusion chromatography was performed. 50 mg of protein were loaded in a HiLoad 26/60 Superdex 75 g (GE Healthcare). The elution fractions were loaded into a native gel and resolved according to known methods.
(173) The affinity purified fusion polypeptide was dialyzed versus 50 mM KH.sub.2PO.sub.4 buffer, pH 7.0, comprising 100 mM KCl and 0.5 mM EDTA and filtrated trough a 0.22 m filter. SlyD/FKBP12/13-CSF1R was UV/Vis spectroscopically quantified at 1.19 mg/ml using the calculated extinction coefficient e=20525 L.Math.mol-1.Math.cm-1 for the 39744.9 Da polypeptide.
(174) Protein fluorescence measurements were used to test the conformational nature of SlyD/FKBP12/13-CSF1R. FKBP12 C22A as a carrier for polypeptide insertions can be used as a reference, because the single FKBP12 Trp moiety can be used to diagnose the structural integrity of the FKBP12 moiety (Scholz, C., et al., J. Biol. Chem. 271 (1996) 12703-12707; Russo, A. T., et al., J. Mol. Biol. 330 (2003) 851-866). FKBP12 C22A in its native structure shows a single fluorescence emission peak at 320 nm (Zoldak, G., et al., J. Mol. Biol. 386 (2009) 1138-1152).
(175) 250 l of 1.19 mg/ml SlyD-FKBP12/13-CSF1R in KH.sub.2PO.sub.4 buffer pH 7.0 were analyzed at different temperatures. KH.sub.2PO.sub.4 buffer pH 7.0 was used as a reference. A Cary Eclipse instrument under the Scan Software Version 1.1(132) was used at 5 nm band width for excitation and emission. A wavelength scan from 300 nm-425 nm was driven at 120 nm/min. The excitation wavelength of the intrinsic tryptophane fluorescence was set to 280 nm.
Example 16
(176) Scaffold-Based Counter-Screening Approach for the Selection of Antigen Binding Antibodies
(177) Six week old NMRI mice were subjected 3-times to intraperitoneal immunization with 100 g recombinant chimeric fusion polypeptide comprising the element Thermococcus gammadurans SlyD-antigen (TgSlyD-antigen). After 10 weeks the mice were boosted two times with 25 g TgSlyD-antigen. Hybridoma cells were produced according to known methods. The primary hybridomas were isolated by limiting dilution and screened for antigen binding by ELISA.
(178) 50 ng/ml of TgSlyD-antigen fusion polypeptide, 50 ng/ml of TgSlyDIF and 1 g/ml isolated antigen were each coated in 30384 well (Nunc) plates overnight at 4 C. Coating buffer was freshly prepared with 1 carbonate-bicarbonate tablet (Sigma, C3041-100CAP99) resolved in 100 ml doubly distilled H.sub.2O (ddH.sub.2O). 100 l Washing buffer (150 mM NaCl, 10 ml Tween 20 (Sigma), 40 ml Bromidox L (Roche) in 1 l dH.sub.2O). The wells were washed three times with 100 l washing buffer (150 mM NaCl, 10 ml Tween20 (Sigma), 40 ml Bromidox L (Roche) in 1 l dH.sub.2O) using a BioTek washer. The wells were blocked with 30 l blocking buffer (10 g BSA, 10PBS pellets (Gibco) in 1 L ddH.sub.2O) for one hour at RT, followed by 3 times washing with 100 l washing buffer. 30 l of 1:1000 diluted hybridoma supernatants were transferred into the wells using a Liquidator and were incubated for one hour at RT. As a positive control an antigen-positive serum was used. The wells were washed three times with 100 l washing buffer. Peroxidase conjugated F(ab).sub.2 fragment Goat anti-Mouse IgG antibody (Dianova) was diluted 1:30000 in blocking buffer and 30 l were transferred into each well. Incubation for one hour at RT was followed by three times washing with 100 l washing buffer. 30 l ready to use ABTS substrate was incubated for 30 min at RT in each well. The absorption signals were monitored as reference signals at 405 nm/492 nm using a PowerWave XS Reader (BioTek). 15 hybridoma cultures, which showed positive ELISA signals versus the TgSlyD-antigen comprising fusion polypeptide and the isolated antigen and no signal versus the TgSlyDIF comprising fusion polypeptide were selected and further cultivated.
(179) The primary hybridoma supernatants were isolated and screened for antigen binding by a second ELISA counter-screening, performed in the same way as described above. In the second screening additional screening reagents were used to precise the specificity of the antibody containing culture supernatants.
(180) 50 ng/ml of TgSlyD-antigen fusion polypeptide, 50 ng/ml TgSlyDIF, 500 ng of ttSlyD-antigen fusion polypeptide and 1 g/ml isolated antigen were coated in 384 well (Nunc) plates for one hour at room temperature (RT). The ELISA was performed as described above. Due to their different species origin T.th.SlyD and T.g.SlyD show little sequence homology. Only 36% of the amino acids are identical and according to a blossom 62 calculation there is only 48% sequence similarity. TgSlyDIF is lacking the insertion anyway. Therefore, the polypeptides are very well suited to be used in an ELISA counter-screening.
(181) Therefore, by immunization with the scaffold surrogate polypeptide a specific epitope in the native antigen domain could be pre-targeted.
Example 17
(182) Epitope Mapping
(183) SlyD-FKBP fusion polypeptides can also carry complex amino acid insertion motifs, like for example secondary structures containing disulfide bonds. Since the fusion polypeptides are free of cysteines, on-column refolding under appropriate conditions facilitates the correct formation of disulfides within the insertion, additionally assisted by the chaperone functionality of SlyD itself. The SlyD-FKBP fusion polypeptides were expressed in E. coli and on-column refolded as described above. SlyD-FKBP12ctrl was dialyzed in 75 mM HEPES buffer (pH 7.5) comprising 150 mM NaCl, 6.5% (w/v) Saccharose, 10 mM cysteine at a concentration of 9.5 mg/ml. A 1 mg/ml portion of the SlyD-FKBP12-CD81 fusion polypeptide was dialyzed in 50 mM potassium phosphate buffer pH 7.0, comprising 100 mM NaCl, 1 mM EDTA in order to avoid disulfide shuffling in the CD81 insertion, which contains 4 cysteines forming two disulfide bonds with structure functional relevance. The fusion polypeptides SlyD-FKBP12-CD81 and SlyD-FKBP12ctrl were used for the purpose of epitope mapping.
(184) Human CD81 is a receptor for the hepatitis C virus envelope E2 glycoprotein. CD81 is a transmembrane protein belonging to the tetraspanin family. CD81 is a 90 amino acid in length homodimeric protein, which displays a so called mushroom-like structure (PDB 1IV5). Residues known to be involved in virus binding can be mapped onto the so called 35 amino acid in length head subdomain, providing a basis for the design of antiviral drugs and vaccines. Since the head subdomain sequence of the virus binding site is just 35 amino acids in length it is difficult to map antibody epitopes on the 10 kDa CD81 protein using conventional cross-blocking experiments. It is difficult to discriminate antibodies, which specifically bind directly on the relevant mushroom-like head domain, from antibodies binding nearby or elsewhere in the CD81LEL structure. All antibodies would show independently of their binding site an HCV E2 envelope protein competing effect, but without specifically binding to the target structure, i.e. the head domain. The grafting of the relevant head domain structure into FKBP and a consecutive epitope mapping is therefore a useful method for various reasons. First, some biochemical issues with the CD81LEL protein are circumvented, because the protein itself tends to oligomerize. Second, it is rather suitable to identify antibody epitopes from a vast number of antibodies all binding to the full length CD81 protein.
(185) In
(186) A BIAcore 2000 instrument (GE Healthcare) was used at 25 C. with a BIAcore CM5 sensor mounted into the system. The sensor was preconditioned by a 1 min. injection at 100 l/min of 0.1% SDS, 50 mM NaOH, 10 mM HCl and 100 mM H.sub.3PO.sub.4. As a running buffer an HBS-EP buffer was used (10 mM HEPES (pH 7.4), 150 mM NaCl, 1 mM EDTA, 0.05% (w/v) P20). The sample buffer was the system buffer. Each protein ligand was immobilized by EDC/NHS chemistry at 30 g/ml in 10 mM sodium acetate buffer (pH 4.0) into the flow cells 2, 3 and 4. Flow cell 1 was used as reference. The sensor was deactivated with a 1 M ethanolamine pH 8.0 solution. The following masses in response units (RU) were immobilized on the sensor: flow cell 2: 1800 RU SlyD-FKBP12ctrl (32.8 kDa), flow cell 3: SlyD-FKBP12-CD81 (35.8 kDa), flow cell 4: 900 RU CD81LEL (10 kDa). 31 antibody analytes were injected at 30 l/min at 50 nM each for 3 min. association and 3 min. dissociation phase. 30 antibodies were derived from an immunization campaign with the 10 kDa CD81LEL protein. The sensor surface was regenerated using 100 mM HCl at 20 l/min for 3 consecutive 30 sec. injections at 20 l/min. The sensorgrams were monitored as reference signals 2-1 (flow cell 2 minus flow cell 1), 3-1 and 4-1 and were evaluated by using the BIAcore Evaluation software 4.1. At the end of the analyte injection a report point was set to quantify the maximum analyte binding signal. The highest analyte binding signal was set 100% to normalize the data.
(187) In the following table the normalized antibody binding responses are shown. From 30 tested <CD81-LEL>M-antibodies only 6 (bold) show a precise epitope on the CD81 head domain. The negative control polypeptide SlyD-FKBP12ctrl was not bound. The positive control polypeptide CD81-LEL, which was the immunogen at the same time, was recognized by all antibodies. Slyd-FKBP12-CD81 was only bound, when the antibody epitope precisely locates in the mushroom domain.
(188) TABLE-US-00050 TABLE Ligands Slyd-FKBP12-ctrl Slyd-FKBP12-CD81 CD81-LEL Analytes normalized ref. binding signal (%) HBS-ET 0 0 0 K01 0 0 63 K02_1 0 0 62 K02_2 0 0 61 K03 0 47 93 K04 0 0 80 K05 0 26 100 K06 0 32 74 K07 0 0 62 K08 0 0 56 K10 0 0 46 K21 0 0 77 K22 0 29 80 K23 0 0 37 K24 0 17 86 K25 0 0 38 K27 0 29 81 K28 0 0 41 K30 0 0 52 K31 0 0 66 K32 0 0 53 K34 0 0 66 K35 0 0 44 K36 0 0 54 K37 0 0 52 K38 0 0 65 K39 0 0 66 K40 0 0 51 K41 0 0 67 K42 0 0 60 K43 0 0 58
Confirmation of the Epitope Mapping Results by X-Ray Crystallographic Analysis
(189) Fab fragments of the antibodies K05 and K04 were co-crystallized with the CD81-LEL protein and were analyzed by x-ray diffraction analysis (Seth Harris, Palo Alto). The resolution obtained was 2.15 . Whereas antibody K05 binds in the mushroom domain, antibody K04 binds to an epitope off site of the mushroom sequence.