Smart single-domain intrabodies with precision switches for biomedical applications
12152066 · 2024-11-26
Assignee
Inventors
Cpc classification
A61K47/65
HUMAN NECESSITIES
C07K2317/569
CHEMISTRY; METALLURGY
C07K2319/60
CHEMISTRY; METALLURGY
C07K16/1003
CHEMISTRY; METALLURGY
C07K2317/80
CHEMISTRY; METALLURGY
C07K2319/70
CHEMISTRY; METALLURGY
International classification
A61K47/65
HUMAN NECESSITIES
Abstract
The present disclosure provides intrabody compositions comprising i) an intrabody and ii) one or more inserts. The disclosure also provides methods for activating and deactivating intracellular and extracellular interactions utilizing the compositions, for instance via chemical and/or light.
Claims
1. An intrabody composition comprising i) an intrabody and ii) one or more inserts, wherein the intrabody composition comprises SEQ ID NO:5.
2. The intrabody composition of claim 1, wherein the intrabody is a monobody or a nanobody.
3. The intrabody composition of claim 2, wherein the insert is a protein or a protein fragment, and wherein the protein or the protein fragment is selected from the group consisting of a LOV2 fragment, a circularly permuted version of cpLOV2, acVHH, an acVHH variant, and UniRapR.
4. The intrabody composition of claim 2, wherein the insert comprises two inserts, wherein the two inserts are contacted via a linker.
5. The intrabody composition of claim 1, wherein the intrabody composition is conjugated to a therapeutic agent.
6. The intrabody composition of claim 5, wherein the therapeutic agent is selected from the group consisting of a CAR-T cell, an NK cell, a macrophage, an antibody, an E3 ligase, a TEV protease, and a transcriptional activator VP64.
7. The intrabody composition of claim 1, wherein the intrabody composition is adapted for activation by light or adapted for deactivation by light.
8. The intrabody composition of claim 1, wherein the intrabody composition is activated by a chemical.
9. The intrabody composition of claim 8, wherein the chemical is caffeine, a caffeine metabolite, or a caffeine analog.
10. The intrabody composition of claim 1, wherein the intrabody composition induces a protein-protein interaction.
11. The intrabody composition of claim 10, wherein the protein-protein interaction comprises association of a first protein to a second protein or disassociation of a first protein to a second protein.
12. The intrabody composition of claim 1, wherein the intrabody composition controls binding of an antigen to an antibody.
13. The intrabody composition of claim 1, wherein the intrabody composition is activated by a chemical, wherein the chemical is caffeine.
14. The intrabody composition of claim 1, wherein the intrabody composition is activated by a chemical, wherein the chemical is a caffeine metabolite.
15. The intrabody composition of claim 1, wherein the intrabody composition is activated by a chemical, wherein the chemical is a caffeine analog.
16. The intrabody composition of claim 5, wherein the therapeutic agent is a CAR-T cell.
17. The intrabody composition of claim 10, wherein the protein-protein interaction comprises CAR expression.
18. The intrabody composition of claim 2, wherein the insert is a protein or a protein fragment, and wherein the protein or the protein fragment is an acVHH dimer.
19. The intrabody composition of claim 2, wherein the insert is a protein or a protein fragment, and wherein the protein or the protein fragment is an acVHH mutant.
20. The intrabody composition of claim 19, wherein the acVHH mutant is acVHH-Y104W.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
(24)
DETAILED DESCRIPTION
(25) In an illustrative aspect, an intrabody composition is provided. The intrabody composition comprises i) an intrabody and ii) one or more inserts process for making a cellulose-based material is provided.
(26) Various intrabody compositions are provided herein. Table 1 describes specific intrabody composition embodiments:
(27) TABLE-US-00001 TABLE 1 Specific Intrabody Composition Embodiments Intrabody Composition Intrabody Insert(s) Stimulation SEQ ID NO. Moonbody Monobody LOV2 Light SEQ ID NO: 1 Sunbody Nanobody LOV2 (two Light SEQ ID NO: 2 copies) Rapabody Nanobody UniRapR Rapamycin and SEQ ID NO: 3 related metabolites, analogs, and variants Caffebody Nanobody acVHH Caffeine and SEQ ID NO: 4 related metabolites, analogs, and variants COSMO Nanobody acVHH variant Caffeine and SEQ ID NO: 5 related metabolites, analogs, and variants biCOSMO-S Nanobody acVHH variants Caffeine and SEQ ID NO: 6 (two copies) related connected by metabolites, short linker analogs, and variants biCOSMO-L Nanobody acVHH variants Caffeine and SEQ ID NO: 7 (two copies) related connected by metabolites, long linker analogs, and variants
(28) In an embodiment, the intrabody is a monobody. In an embodiment, the intrabody is a nanobody. In an embodiment, the intrabody is a monobody that recognizes the SH2 domain of Abl. In an embodiment, the monobody comprises an EF domain.
(29) In an embodiment, the intrabody is a mCherry-specific nanobody. In an embodiment, the mCherry-specific nanobody comprises an S3 loop.
(30) In an embodiment, the insert is a protein or a protein fragment. In an embodiment, the protein comprises a LOV2 fragment. In an embodiment, the protein comprises a circularly permuted version of cpLOV2. In an embodiment, the protein comprises acVHH. In an embodiment, the protein comprises an acVHH variant. In an embodiment, the protein comprises UniRapR.
(31) In an embodiment, the intrabody composition comprises two inserts. In an embodiment, the two inserts comprise a first insert and a second insert. In an embodiment, the first insert and the second insert are the same. In an embodiment, the first insert and the second insert are different. In an embodiment, the first insert and the second insert both comprise a LOV2 fragment. In an embodiment, the first insert and the second insert both comprise cpLOV2. In an embodiment, the first insert and the second insert both comprise a circularly permuted version of cpLOV2. In an embodiment, the first insert and the second insert both comprise acVHH. In an embodiment, the first insert and the second insert both comprise an acVHH variant.
(32) In an embodiment, the insert comprises two inserts. In an embodiment, the two inserts are contacted via a linker. In an embodiment, the two inserts are covalently connected. In an embodiment, the two inserts are covalently connected via a linker. A linker according to the present disclosure can be long or short in length. Appropriate linkers are well know in the art.
(33) In one embodiment, an intrabody composition comprises a LOV2 fragment (residues 404-546) inserted into the EF loop of a monobody that specifically recognizes the Src Homology 2 (SH2) domain of Abelson tyrosine kinase (Abl).
(34) In one embodiment, an intrabody composition comprises two LOV2 fragments (residues 404-546 or 408-543) inserted into a mCherry-specific nanobody (LaM8) S3 loop to make a LOV2 double controlled chimeric LOV2-LaM8(N)-LOV2-LaM8(C).
(35) In one embodiment, an intrabody composition comprises a dimeric concatemer of acVHH (bivalent acVHH) fused with an mCherry-specific nanobody (LaM8) S3 loop.
(36) In one embodiment, an intrabody composition comprises UniRapR fused with a mCherry-specific nanobody (LaM8) S3 loop. In some aspects, the UniRapR component can be replaced by an engineered pair of FBP/FKBP called cpRAPID (see Lee et al., Journal of Molecular Biology, 2020, 432(10):3127-3136, incorporated herein in its entirety).
(37) In one embodiment, an intrabody composition comprises an acVHH insert with enhanced affinity inserted into a nanobody. In one embodiment, an intrabody composition comprises two acVHH inserts with enhanced affinity inserted into a nanobody, wherein the two inserts are connected with a short linker. In one embodiment, an intrabody composition comprises two acVHH inserts with enhanced affinity inserted into a nanobody, wherein the two inserts are connected with a longer linker.
(38) In an embodiment, the intrabody composition is conjugated to a therapeutic agent. In an embodiment, the therapeutic agent is a CAR-T cell. In an embodiment, the therapeutic agent is an NK cell. In an embodiment, the therapeutic agent is a macrophage. In an embodiment, the therapeutic agent is an antibody. In an embodiment, the therapeutic agent is an E3 ligase. In an embodiment, the therapeutic agent is a TEV protease. In an embodiment, the therapeutic agent is transcriptional activator VP64.
(39) In an embodiment, the intrabody composition is adapted for activation by light. In an embodiment, the activation by light is reversible. In an embodiment, the intrabody composition is adapted for deactivation by light. In an embodiment, the deactivation by light is reversible. Advantageously, activation and/or deactivation of the described intrabody compositions by light is rapid in nature.
(40) In an embodiment, the intrabody composition is adapted for activation by a chemical. In an embodiment, the activation is reversible. In an embodiment, the chemical is rapamycin. In an embodiment, the chemical is a rapamycin metabolite. In an embodiment, the chemical is a rapamycin analog. In an embodiment, the chemical is caffeine. In an embodiment, the chemical is a caffeine metabolite. In an embodiment, the chemical is a caffeine analog.
(41) In an embodiment, the intrabody composition is adapted for deactivation by a chemical. In an embodiment, the activation is reversible. In an embodiment, the chemical is rapamycin. In an embodiment, the chemical is a rapamycin metabolite. In an embodiment, the chemical is a rapamycin analog. In an embodiment, the chemical is caffeine. In an embodiment, the chemical is a caffeine metabolite. In an embodiment, the chemical is a caffeine analog. Advantageously, activation and/or deactivation of the described intrabody compositions by a chemical is rapid in nature.
(42) In an embodiment, the intrabody composition is configured to induce a protein-protein interaction. In an embodiment, the protein-protein interaction is reversible.
(43) In an embodiment, the protein-protein interaction comprises association of a first protein to a second protein. In an embodiment, the protein-protein interaction comprises disassociation of a first protein to a second protein. In an embodiment, the protein-protein interaction comprises association of a first protein to a second protein. In an embodiment, the protein-protein interaction comprises protein subcellular translocation. In an embodiment, the protein-protein interaction comprises protein degradation. In an embodiment, the protein-protein interaction comprises gene expression. In an embodiment, the protein-protein interaction comprises nucleic acid base editing. In an embodiment, the protein-protein interaction comprises calcium signaling. In an embodiment, the protein-protein interaction comprises calcium entry. In an embodiment, the protein-protein interaction comprises ion channel gating. In an embodiment, the protein-protein interaction comprises gene transcription. In an embodiment, the protein-protein interaction comprises CAR expression.
(44) In an embodiment, the intrabody composition is configured to control binding of an antigen to an antibody. In an embodiment, the binding of the antigen to the antibody is reversible. In an embodiment, the intrabody composition is configured to induce protein homodimerization. In an embodiment, the protein homodimerization is reversible. In an embodiment, the intrabody composition is configured to induce protein heterodimerization. In an embodiment, the protein heterodimerization is reversible.
(45) In an embodiment, the intrabody composition comprises, consists essentially of, or consists of SEQ ID NO:1. In an embodiment, the intrabody composition comprises, consists essentially of, or consists of SEQ ID NO:2. In an embodiment, the intrabody composition comprises, consists essentially of, or consists of SEQ ID NO:3. In an embodiment, the intrabody composition comprises, consists essentially of, or consists of SEQ ID NO:4. In an embodiment, the intrabody composition comprises, consists essentially of, or consists of SEQ ID NO:5. In an embodiment, the intrabody composition comprises, consists essentially of, or consists of SEQ ID NO:6. In an embodiment, the intrabody composition comprises, consists essentially of, or consists of SEQ ID NO:7.
(46) The various sequences described above are summarized below.
(47) TABLE-US-00002 SEQIDNO:1(Moonbody): VSSVPTKLEVVDATPTSLKISWDAYYSSWQNVKYYRITYGETGGDSPVQEF TVPGYYSTATISGLKPGSGLATTLERIEKNFVITDPRLPDNPIIFASDSFL QLTEYSREEILGRNCRFLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKS GKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDAAEREGVMLIKKTAE NIDEAAKELGVDYTITVYAYDTFFPGYEPNSPISINYRT SEQIDNO:2(Sunbody): LATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNCRFLQ GPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGD VQYFIGVQLDGTEHVRDAAEREGVMLIKKTAENIDEAAKELKLMAQVQLVE SGGGLVQAGGSLRLSCAVSGRPFSEYNLGWFRQAPGKEREFVARIRSSGTT VYTDSVKGRFSASRDNALERIEKNFVITDPRLPDNPIIFASDSFLQLTEYS REEILGRNCRFLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWN LFHLQPMRDQKGDVQYFIGVQLDGTEHVRDAAEREGVMLIKKTAENIDEAA KNMGYLQLNSLEPEDTAVYYCAMSRVDTDSPAFYDYWGQGTQVTVSTPRS SEQIDNO:3(Caffebody): MAQVQLVESGGGLVQAGGSLRLSCAVSGRPFSEYNLGWFRQAPGKEREFVA RIRSSGTTVYTDSVKGRFSASRDNAEVQLQASGGGLVQAGGSLRLSCTASG RTGTIYSMAWFRQAPGKEREFLATVGWSSGITYYMDSVKGRFTISRDNAKN SAYLQMNSLKPEDTAVYYCTATRAYSVGYDYWGQGTQVTVSHAAAGAPVPY PDPLEPREQKLISEEDLLEAVYSGGGGGGGSGGGGGGGSGGGGGGGSGEVQ LQASGGGLVQAGGSLRLSCTASGRTGTIYSMAWFRQAPGKEREFLATVGWS SGITYYMDSVKGRFTISRDNAKNSAYLQMNSLKPEDTAVYYCTATRAYSVG YDYWGQGTQVTVSKNMGYLQLNSLEPEDTAVYYCAMSRVDTDSPAFYDYWG QGTQVTVSTPRS SEQIDNO:4(Rapabody): QLVESGGGLVQAGGSLRLSCAVSGRPFSEYNLGWFRQAPGKEREFVARIRS SGTTVYTDSVKGRFSASRDNATCVVHYTGMLEDGKKPDSSRDRNKPFKFML GKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHGSGSGSGVKDLLQA WDLYYHVFRRISGPPGPGSGLWHEMWHEGLEEASRLYFGERNVKGMFEVLE PLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGSSGGSGSGIIP PHATLVFDVELLKLEKNMGYLQLNSLEPEDTAVYYCAMSRVDTDSPAFYDY WGQGTQVTVSTPRS SEQIDNO:5(COSMO): EVQLQASGGGLVQAGGSLRLSCTASGRTGTIYSMAWFRQAPGKEREFLATV GWSSGITYYMDSVKGRFTISRDNAKNSAYLQMNSLKPEDTAVYYCTATRAW SVGYDYWGQGTQVTVS SEQIDNO:6(biCOSMO-S): EVQLQASGGGLVQAGGSLRLSCTASGRTGTIYSMAWFRQAPGKEREFLATV GWSSGITYYMDSVKGRFTISRDNAKNSAYLQMNSLKPEDTAVYYCTATRAW SVGYDYWGQGTQVTVSLHRAEQSLHDLGAPEVQLQASGGGLVQAGGSLRLS CTASGRTGTIYSMAWFRQAPGKEREFLATVGWSSGITYYMDSVKGRFTISR DNAKNSAYLQMNSLKPEDTAVYYCTATRAWSVGYDYWGQGTQVTVS SEQIDNO:7(biCOSMO-L): EVQLQASGGGLVQAGGSLRLSCTASGRTGTIYSMAWFRQAPGKEREFLATV GWSSGITYYMDSVKGRFTISRDNAKNSAYLQMNSLKPEDTAVYYCTATRAW SVGYDYWGQGTQVTVSHAAAGAPVPYPDPLEPREQKLISEEDLGGSGGAPE VQLQASGGGLVQAGGSLRLSCTASGRTGTIYSMAWFRQAPGKEREFLATVG WSSGITYYMDSVKGRFTISRDNAKNSAYLQMNSLKPEDTAVYYCTATRAWS VGYDYWGQGTQVTVS
(48) In an illustrative aspect, a method of inducing an interaction between a first protein and a second protein is provided. The method comprises the step of administering an intrabody composition to induce the interaction, wherein the intrabody composition comprises i) an intrabody and ii) one or more inserts.
(49) In an embodiment, the first protein is an antigen. In an embodiment, the second protein is an antibody. In an embodiment, the first protein is an antigen and the second protein is an antibody.
(50) In an embodiment, the interaction is reversible. In an embodiment, the interaction comprises association of the first protein to the second protein. In an embodiment, the interaction comprises disassociation of the first protein to the second protein.
(51) In an embodiment, the interaction comprises protein subcellular translocation. In an embodiment, the interaction comprises protein degradation. In an embodiment, the interaction comprises gene expression. In an embodiment, the interaction comprises nucleic acid base editing. In an embodiment, the interaction comprises calcium signaling. In an embodiment, the interaction comprises calcium entry. In an embodiment, the interaction comprises ion channel gating. In an embodiment, the interaction comprises gene transcription. In an embodiment, the interaction comprises CAR expression. In an embodiment, the interaction comprises protein homodimerization. In an embodiment, the interaction comprises protein heterodimerization.
(52) In an embodiment, the interaction is induced using light. In an embodiment, the interaction is induced using a chemical. In an embodiment, the chemical is rapamycin. In an embodiment, the chemical is a rapamycin metabolite. In an embodiment, the chemical is a rapamycin analog. In an embodiment, the chemical is caffeine. In an embodiment, the chemical is a caffeine metabolite. In an embodiment, the chemical is a caffeine analog.
(53) The previously described embodiments of the intrabody composition are applicable to the method of inducing an interaction between a first protein and a second protein described herein.
(54) In an illustrative aspect, a method of activating an intrabody composition with a chemical is provided. The method comprises the step of contacting the intrabody composition with the chemical, wherein the intrabody composition comprises i) an intrabody and ii) one or more inserts, and wherein the chemical activates the intrabody composition.
(55) In an embodiment, the activation is reversible. In an embodiment, the chemical is rapamycin. In an embodiment, the chemical is a rapamycin metabolite. In an embodiment, the chemical is a rapamycin analog. In an embodiment, the chemical is caffeine. In an embodiment, the chemical is a caffeine metabolite. In an embodiment, the chemical is a caffeine analog.
(56) In an embodiment, the intrabody composition is configured to induce a protein-protein interaction via activation. In an embodiment, the protein-protein interaction comprises association of a first protein to a second protein. In an embodiment, the protein-protein interaction comprises disassociation of a first protein to a second protein. In an embodiment, the protein-protein interaction comprises association of a first protein to a second protein. In an embodiment, the protein-protein interaction comprises protein subcellular translocation. In an embodiment, the protein-protein interaction comprises protein degradation. In an embodiment, the protein-protein interaction comprises gene expression. In an embodiment, the protein-protein interaction comprises nucleic acid base editing. In an embodiment, the protein-protein interaction comprises calcium signaling. In an embodiment, the protein-protein interaction comprises calcium entry. In an embodiment, the protein-protein interaction comprises ion channel gating. In an embodiment, the protein-protein interaction comprises gene transcription. In an embodiment, the protein-protein interaction comprises CAR expression.
(57) In an embodiment, the intrabody composition is configured to control binding of an antigen to an antibody via activation. In an embodiment, the intrabody composition is configured to induce protein homodimerization via activation. In an embodiment, the intrabody composition is configured to induce protein heterodimerization via activation.
(58) The previously described embodiments of the intrabody composition are applicable to the method of activating an intrabody composition with a chemical described herein.
(59) In an illustrative aspect, a method of deactivating an intrabody composition with a chemical is provided. The method comprises the step of contacting the intrabody composition with the chemical, wherein the intrabody composition comprises i) an intrabody and ii) one or more inserts, and wherein the chemical deactivates the intrabody composition.
(60) In an embodiment, the deactivation is reversible. In an embodiment, the chemical is rapamycin. In an embodiment, the chemical is a rapamycin metabolite. In an embodiment, the chemical is a rapamycin analog. In an embodiment, the chemical is caffeine. In an embodiment, the chemical is a caffeine metabolite. In an embodiment, the chemical is a caffeine analog.
(61) In an embodiment, the intrabody composition is configured to induce a protein-protein interaction via deactivation. In an embodiment, the protein-protein interaction comprises association of a first protein to a second protein. In an embodiment, the protein-protein interaction comprises disassociation of a first protein to a second protein. In an embodiment, the protein-protein interaction comprises association of a first protein to a second protein. In an embodiment, the protein-protein interaction comprises protein subcellular translocation. In an embodiment, the protein-protein interaction comprises protein degradation. In an embodiment, the protein-protein interaction comprises gene expression. In an embodiment, the protein-protein interaction comprises nucleic acid base editing. In an embodiment, the protein-protein interaction comprises calcium signaling. In an embodiment, the protein-protein interaction comprises calcium entry. In an embodiment, the protein-protein interaction comprises ion channel gating. In an embodiment, the protein-protein interaction comprises gene transcription. In an embodiment, the protein-protein interaction comprises CAR expression.
(62) In an embodiment, the intrabody composition is configured to control binding of an antigen to an antibody via activation. In an embodiment, the intrabody composition is configured to induce protein homodimerization via activation. In an embodiment, the intrabody composition is configured to induce protein heterodimerization via activation.
(63) The previously described embodiments of the intrabody composition are applicable to the method of deactivating an intrabody composition with a chemical described herein. In addition, the previously described embodiments of the method of activating an intrabody composition with a chemical are also applicable to the method of deactivating an intrabody composition with a chemical described herein.
(64) In an illustrative aspect, a method of activating an intrabody composition with light is provided. The method comprises the step of contacting the intrabody composition with the light, wherein the intrabody composition comprises i) an intrabody and ii) one or more inserts, and wherein the light activates the intrabody composition.
(65) In an embodiment, the activation is reversible. In an embodiment, the intrabody composition is configured to induce a protein-protein interaction via activation.
(66) In an embodiment, the protein-protein interaction comprises association of a first protein to a second protein. In an embodiment, the protein-protein interaction comprises disassociation of a first protein to a second protein. In an embodiment, the protein-protein interaction comprises association of a first protein to a second protein. In an embodiment, the protein-protein interaction comprises protein subcellular translocation. In an embodiment, the protein-protein interaction comprises protein degradation. In an embodiment, the protein-protein interaction comprises gene expression. In an embodiment, the protein-protein interaction comprises nucleic acid base editing. In an embodiment, the protein-protein interaction comprises calcium signaling. In an embodiment, the protein-protein interaction comprises calcium entry. In an embodiment, the protein-protein interaction comprises ion channel gating. In an embodiment, the protein-protein interaction comprises gene transcription. In an embodiment, the protein-protein interaction comprises CAR expression.
(67) In an embodiment, the intrabody composition is configured to control binding of an antigen to an antibody via activation. In an embodiment, the intrabody composition is configured to induce protein homodimerization via activation. In an embodiment, the intrabody composition is configured to induce protein heterodimerization via activation.
(68) The previously described embodiments of the intrabody composition are applicable to the method of activating an intrabody composition with light described herein.
(69) In an illustrative aspect, a method of deactivating an intrabody composition with light is provided. The method comprises the step of contacting the intrabody composition with the light, wherein the intrabody composition comprises i) an intrabody and ii) one or more inserts, and wherein the light deactivates the intrabody composition.
(70) In an embodiment, the deactivation is reversible. In an embodiment, the intrabody composition is configured to induce a protein-protein interaction via deactivation. In an embodiment, the protein-protein interaction comprises association of a first protein to a second protein. In an embodiment, the protein-protein interaction comprises disassociation of a first protein to a second protein. In an embodiment, the protein-protein interaction comprises association of a first protein to a second protein. In an embodiment, the protein-protein interaction comprises protein subcellular translocation. In an embodiment, the protein-protein interaction comprises protein degradation. In an embodiment, the protein-protein interaction comprises gene expression. In an embodiment, the protein-protein interaction comprises nucleic acid base editing. In an embodiment, the protein-protein interaction comprises calcium signaling. In an embodiment, the protein-protein interaction comprises calcium entry. In an embodiment, the protein-protein interaction comprises ion channel gating. In an embodiment, the protein-protein interaction comprises gene transcription. In an embodiment, the protein-protein interaction comprises CAR expression.
(71) In an embodiment, the intrabody composition is configured to control binding of an antigen to an antibody via activation. In an embodiment, the intrabody composition is configured to induce protein homodimerization via activation. In an embodiment, the intrabody composition is configured to induce protein heterodimerization via activation.
(72) The previously described embodiments of the intrabody composition are applicable to the method of deactivating an intrabody composition with light described herein. In addition, the previously described embodiments of the method of activating an intrabody composition with light are also applicable to the method of deactivating an intrabody composition with light described herein.
(73) The following numbered embodiments are contemplated and are non-limiting: 1. An intrabody composition comprising i) an intrabody and ii) one or more inserts. 2. The intrabody composition of clause 1, any other suitable clause, or any combination of suitable clauses, wherein the intrabody is a monobody. 3. The intrabody composition of clause 1, any other suitable clause, or any combination of suitable clauses, wherein the intrabody is a nanobody. 4. The intrabody composition of clause 1, any other suitable clause, or any combination of suitable clauses, wherein the intrabody is a monobody that recognizes the SH2 domain of Abl. 5. The intrabody composition of clause 4, any other suitable clause, or any combination of suitable clauses, wherein the monobody comprises an EF domain. 6. The intrabody composition of clause 1, any other suitable clause, or any combination of suitable clauses, wherein the intrabody is a mCherry-specific nanobody. 7. The intrabody composition of clause 6, any other suitable clause, or any combination of suitable clauses, wherein the mCherry-specific nanobody comprises an S3 loop. 8. The intrabody composition of clause 1, any other suitable clause, or any combination of suitable clauses, wherein the insert is a protein or a protein fragment. 9. The intrabody composition of clause 8, any other suitable clause, or any combination of suitable clauses, wherein the protein comprises a LOV2 fragment. 10. The intrabody composition of clause 8, any other suitable clause, or any combination of suitable clauses, wherein the protein comprises a circularly permuted version of cpLOV2. 11. The intrabody composition of clause 8, any other suitable clause, or any combination of suitable clauses, wherein the protein comprises acVHH. 12. The intrabody composition of clause 8, any other suitable clause, or any combination of suitable clauses, wherein the protein comprises an acVHH variant. 13. The intrabody composition of clause 8, any other suitable clause, or any combination of suitable clauses, wherein the protein comprises UniRapR. 14. The intrabody composition of clause 1, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition comprises two inserts. 15. The intrabody composition of clause 14, any other suitable clause, or any combination of suitable clauses, wherein the two inserts comprise a first insert and a second insert. 16. The intrabody composition of clause 15, any other suitable clause, or any combination of suitable clauses, wherein the first insert and the second insert are the same. 17. The intrabody composition of clause 15, any other suitable clause, or any combination of suitable clauses, wherein the first insert and the second insert are different. 18. The intrabody composition of clause 15, any other suitable clause, or any combination of suitable clauses, wherein the first insert and the second insert both comprise a LOV2 fragment. 19. The intrabody composition of clause 15, any other suitable clause, or any combination of suitable clauses, wherein the first insert and the second insert both comprise cpLOV2. 20. The intrabody composition of clause 15, any other suitable clause, or any combination of suitable clauses, wherein the first insert and the second insert both comprise a circularly permuted version of cpLOV2. 21. The intrabody composition of clause 15, any other suitable clause, or any combination of suitable clauses, wherein the first insert and the second insert both comprise acVHH. 22. The intrabody composition of clause 15, any other suitable clause, or any combination of suitable clauses, wherein the first insert and the second insert both comprise an acVHH variant. 23. The intrabody composition of clause 1, any other suitable clause, or any combination of suitable clauses, wherein the insert comprises two inserts. 24. The intrabody composition of clause 23, any other suitable clause, or any combination of suitable clauses, wherein the two inserts are contacted via a linker. 25. The intrabody composition of clause 23, any other suitable clause, or any combination of suitable clauses, wherein the two inserts are covalently connected. 26. The intrabody composition of clause 23, any other suitable clause, or any combination of suitable clauses, wherein the two inserts are covalently connected via a linker. 27. The intrabody composition of clause 1, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition is conjugated to a therapeutic agent. 28. The intrabody composition of clause 27, any other suitable clause, or any combination of suitable clauses, wherein the therapeutic agent is a CAR-T cell. 29. The intrabody composition of clause 27, any other suitable clause, or any combination of suitable clauses, wherein the therapeutic agent is an NK cell. 30. The intrabody composition of clause 27, any other suitable clause, or any combination of suitable clauses, wherein the therapeutic agent is a macrophage. 31. The intrabody composition of clause 27, any other suitable clause, or any combination of suitable clauses, wherein the therapeutic agent is an antibody. 32. The intrabody composition of clause 27, any other suitable clause, or any combination of suitable clauses, wherein the therapeutic agent is an E3 ligase. 33. The intrabody composition of clause 27, any other suitable clause, or any combination of suitable clauses, wherein the therapeutic agent is a TEV protease. 34. The intrabody composition of clause 27, any other suitable clause, or any combination of suitable clauses, wherein the therapeutic agent is transcriptional activator VP64. 35. The intrabody composition of clause 1, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition is adapted for activation by light. 36. The intrabody composition of clause 35, any other suitable clause, or any combination of suitable clauses, wherein the activation by light is reversible. 37. The intrabody composition of clause 1, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition is adapted for deactivation by light. 38. The intrabody composition of clause 37, any other suitable clause, or any combination of suitable clauses, wherein the deactivation by light is reversible. 39. The intrabody composition of clause 1, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition is adapted for activation by a chemical. 40. The intrabody composition of clause 39, any other suitable clause, or any combination of suitable clauses, wherein the activation is reversible. 41. The intrabody composition of clause 39, any other suitable clause, or any combination of suitable clauses, wherein the chemical is rapamycin. 42. The intrabody composition of clause 39, any other suitable clause, or any combination of suitable clauses, wherein the chemical is a rapamycin metabolite. 43. The intrabody composition of clause 39, any other suitable clause, or any combination of suitable clauses, wherein the chemical is a rapamycin analog. 44. The intrabody composition of clause 39, any other suitable clause, or any combination of suitable clauses, wherein the chemical is caffeine. 45. The intrabody composition of clause 39, any other suitable clause, or any combination of suitable clauses, wherein the chemical is a caffeine metabolite. 46. The intrabody composition of clause 39, any other suitable clause, or any combination of suitable clauses, wherein the chemical is a caffeine analog. 47. The intrabody composition of clause 1, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition is adapted for deactivation by a chemical. 48. The intrabody composition of clause 47, any other suitable clause, or any combination of suitable clauses, wherein the deactivation is reversible. 49. The intrabody composition of clause 47, any other suitable clause, or any combination of suitable clauses, wherein the chemical is rapamycin. 50. The intrabody composition of clause 47, any other suitable clause, or any combination of suitable clauses, wherein the chemical is a rapamycin metabolite. 51. The intrabody composition of clause 47, any other suitable clause, or any combination of suitable clauses, wherein the chemical is a rapamycin analog. 52. The intrabody composition of clause 47, any other suitable clause, or any combination of suitable clauses, wherein the chemical is caffeine. 53. The intrabody composition of clause 47, any other suitable clause, or any combination of suitable clauses, wherein the chemical is a caffeine metabolite. 54. The intrabody composition of clause 47, any other suitable clause, or any combination of suitable clauses, wherein the chemical is a caffeine analog. 55. The intrabody composition of clause 1, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition is configured to induce a protein-protein interaction. 56. The intrabody composition of clause 55, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction is reversible. 57. The intrabody composition of clause 55, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises association of a first protein to a second protein. 58. The intrabody composition of clause 55, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises disassociation of a first protein to a second protein. 59. The intrabody composition of clause 55, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises association of a first protein to a second protein. 60. The intrabody composition of clause 55, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises protein subcellular translocation. 61. The intrabody composition of clause 55, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises protein degradation. 62. The intrabody composition of clause 55, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises gene expression. 63. The intrabody composition of clause 55, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises nucleic acid base editing. 64. The intrabody composition of clause 55, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises calcium signaling. 65. The intrabody composition of clause 55, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises calcium entry. 66. The intrabody composition of clause 55, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises ion channel gating. 67. The intrabody composition of clause 55, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises gene transcription. 68. The intrabody composition of clause 55, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises CAR expression. 69. The intrabody composition of clause 1, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition is configured to control binding of an antigen to an antibody. 70. The intrabody composition of clause 69, any other suitable clause, or any combination of suitable clauses, wherein the binding of the antigen to the antibody is reversible. 71. The intrabody composition of clause 1, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition is configured to induce protein homodimerization. 72. The intrabody composition of clause 71, any other suitable clause, or any combination of suitable clauses, wherein the protein homodimerization is reversible. 73. The intrabody composition of clause 1, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition is configured to induce protein heterodimerization. 74. The intrabody composition of clause 73, any other suitable clause, or any combination of suitable clauses, wherein the protein heterodimerization is reversible. 75. The intrabody composition of clause 1, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition comprises SEQ ID NO:1. 76. The intrabody composition of clause 1, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists essentially of SEQ ID NO: 1. 77. The intrabody composition of clause 1, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists of SEQ ID NO: 1. 78. The intrabody composition of clause 1, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition comprises SEQ ID NO:2. 79. The intrabody composition of clause 1, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists essentially of SEQ ID NO:2. 80. The intrabody composition of clause 1, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists of SEQ ID NO:2. 81. The intrabody composition of clause 1, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition comprises SEQ ID NO:3. 82. The intrabody composition of clause 1, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists essentially of SEQ ID NO:3. 83. The intrabody composition of clause 1, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists of SEQ ID NO:3. 84. The intrabody composition of clause 1, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition comprises SEQ ID NO:4. 85. The intrabody composition of clause 1, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists essentially of SEQ ID NO:4. 86. The intrabody composition of clause 1, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists of SEQ ID NO:4. 87. The intrabody composition of clause 1, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition comprises SEQ ID NO:5. 88. The intrabody composition of clause 1, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists essentially of SEQ ID NO:5. 89. The intrabody composition of clause 1, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists of SEQ ID NO:5. 90. The intrabody composition of clause 1, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition comprises SEQ ID NO:6. 91. The intrabody composition of clause 1, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists essentially of SEQ ID NO:6. 92. The intrabody composition of clause 1, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists of SEQ ID NO:6. 93. The intrabody composition of clause 1, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition comprises SEQ ID NO:7. 94. The intrabody composition of clause 1, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists essentially of SEQ ID NO:7. 95. The intrabody composition of clause 1, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists of SEQ ID NO:7. 96. A method of inducing an interaction between a first protein and a second protein, said method comprising the step of administering an intrabody composition to induce the interaction, wherein the intrabody composition comprises i) an intrabody and ii) one or more inserts. 97. The method of clause 96, any other suitable clause, or any combination of suitable clauses, wherein the first protein is an antigen. 98. The method of clause 96, any other suitable clause, or any combination of suitable clauses, wherein the second protein is an antibody. 99. The method of clause 96, any other suitable clause, or any combination of suitable clauses, wherein the first protein is an antigen and the second protein is an antibody. 100. The method of clause 96, any other suitable clause, or any combination of suitable clauses, wherein the interaction is reversible. 101. The method of clause 96, any other suitable clause, or any combination of suitable clauses, wherein the interaction comprises association of the first protein to the second protein. 102. The method of clause 96, any other suitable clause, or any combination of suitable clauses, wherein the interaction comprises disassociation of the first protein to the second protein. 103. The method of clause 96, any other suitable clause, or any combination of suitable clauses, wherein the interaction comprises protein subcellular translocation. 104. The method of clause 96, any other suitable clause, or any combination of suitable clauses, wherein the interaction comprises protein degradation. 105. The method of clause 96, any other suitable clause, or any combination of suitable clauses, wherein the interaction comprises gene expression. 106. The method of clause 96, any other suitable clause, or any combination of suitable clauses, wherein the interaction comprises nucleic acid base editing. 107. The method of clause 96, any other suitable clause, or any combination of suitable clauses, wherein the interaction comprises calcium signaling. 108. The method of clause 96, any other suitable clause, or any combination of suitable clauses, wherein the interaction comprises calcium entry. 109. The method of clause 96, any other suitable clause, or any combination of suitable clauses, wherein the interaction comprises ion channel gating. 110. The method of clause 96, any other suitable clause, or any combination of suitable clauses, wherein the interaction comprises gene transcription. 111. The method of clause 96, any other suitable clause, or any combination of suitable clauses, wherein the interaction comprises CAR expression. 112. The method of clause 96, any other suitable clause, or any combination of suitable clauses, wherein the interaction comprises protein homodimerization. 113. The method of clause 96, any other suitable clause, or any combination of suitable clauses, wherein the interaction comprises protein heterodimerization. 114. The method of clause 96, any other suitable clause, or any combination of suitable clauses, wherein the interaction is induced using light. 115. The method of clause 96, any other suitable clause, or any combination of suitable clauses, wherein the interaction is induced using a chemical. 116. The method of clause 115, any other suitable clause, or any combination of suitable clauses, wherein the chemical is rapamycin. 117. The method of clause 115, any other suitable clause, or any combination of suitable clauses, wherein the chemical is a rapamycin metabolite. 118. The method of clause 115, any other suitable clause, or any combination of suitable clauses, wherein the chemical is a rapamycin analog. 119. The method of clause 115, any other suitable clause, or any combination of suitable clauses, wherein the chemical is caffeine. 120. The method of clause 115, any other suitable clause, or any combination of suitable clauses, wherein the chemical is a caffeine metabolite. 121. The method of clause 115, any other suitable clause, or any combination of suitable clauses, wherein the chemical is a caffeine analog. 122. The method of clause 96, any other suitable clause, or any combination of suitable clauses, wherein the intrabody is a monobody. 123. The method of clause 96, any other suitable clause, or any combination of suitable clauses, wherein the intrabody is a nanobody. 124. The method of clause 96, any other suitable clause, or any combination of suitable clauses, wherein the intrabody is a monobody that recognizes the SH2 domain of Abl. 125. The method of clause 124, any other suitable clause, or any combination of suitable clauses, wherein the monobody comprises an EF domain. 126. The method of clause 96, any other suitable clause, or any combination of suitable clauses, wherein the intrabody is a mCherry-specific nanobody. 127. The method of clause 126, any other suitable clause, or any combination of suitable clauses, wherein the mCherry-specific nanobody comprises an S3 loop. 128. The method of clause 96, any other suitable clause, or any combination of suitable clauses, wherein the insert is a protein or a protein fragment. 129. The method of clause 128, any other suitable clause, or any combination of suitable clauses, wherein the protein comprises a LOV2 fragment. 130. The method of clause 128, any other suitable clause, or any combination of suitable clauses, wherein the protein comprises a circularly permuted version of cpLOV2. 131. The method of clause 128, any other suitable clause, or any combination of suitable clauses, wherein the protein comprises acVHH. 132. The method of clause 128, any other suitable clause, or any combination of suitable clauses, wherein the protein comprises an acVHH variant. 133. The method of clause 128, any other suitable clause, or any combination of suitable clauses, wherein the protein comprises UniRapR. 134. The method of clause 96, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition comprises two inserts. 135. The method of clause 134, any other suitable clause, or any combination of suitable clauses, wherein the two inserts comprise a first insert and a second insert. 136. The method of clause 135, any other suitable clause, or any combination of suitable clauses, wherein the first insert and the second insert are the same. 137. The method of clause 135, any other suitable clause, or any combination of suitable clauses, wherein the first insert and the second insert are different. 138. The method of clause 135, any other suitable clause, or any combination of suitable clauses, wherein the first insert and the second insert both comprise a LOV2 fragment. 139. The method of clause 135, any other suitable clause, or any combination of suitable clauses, wherein the first insert and the second insert both comprise cpLOV2. 140. The method of clause 135, any other suitable clause, or any combination of suitable clauses, wherein the first insert and the second insert both comprise a circularly permuted version of cpLOV2. 141. The method of clause 135, any other suitable clause, or any combination of suitable clauses, wherein the first insert and the second insert both comprise acVHH. 142. The method of clause 135, any other suitable clause, or any combination of suitable clauses, wherein the first insert and the second insert both comprise an acVHH variant. 143. The method of clause 96, any other suitable clause, or any combination of suitable clauses, wherein the insert comprises two inserts. 144. The method of clause 143, any other suitable clause, or any combination of suitable clauses, wherein the two inserts are contacted via a linker. 145. The method of clause 143, any other suitable clause, or any combination of suitable clauses, wherein the two inserts are covalently connected. 146. The method of clause 143, any other suitable clause, or any combination of suitable clauses, wherein the two inserts are covalently connected via a linker. 147. The method of clause 96, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition is conjugated to a therapeutic agent. 148. The method of clause 147, any other suitable clause, or any combination of suitable clauses, wherein the therapeutic agent is a CAR-T cell. 149. The method of clause 147, any other suitable clause, or any combination of suitable clauses, wherein the therapeutic agent is an NK cell. 150. The method of clause 147, any other suitable clause, or any combination of suitable clauses, wherein the therapeutic agent is a macrophage. 151. The method of clause 147, any other suitable clause, or any combination of suitable clauses, wherein the therapeutic agent is an antibody. 152. The method of clause 147, any other suitable clause, or any combination of suitable clauses, wherein the therapeutic agent is an E3 ligase. 153. The method of clause 147, any other suitable clause, or any combination of suitable clauses, wherein the therapeutic agent is a TEV protease. 154. The method of clause 147, any other suitable clause, or any combination of suitable clauses, wherein the therapeutic agent is transcriptional activator VP64. 155. The method of clause 96, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition comprises SEQ ID NO: 1. 156. The method of clause 96, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists essentially of SEQ ID NO:1. 157. The method of clause 96, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists of SEQ ID NO: 1. 158. The method of clause 96, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition comprises SEQ ID NO:2. 159. The method of clause 96, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists essentially of SEQ ID NO:2. 160. The method of clause 96, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists of SEQ ID NO:2. 161. The method of clause 96, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition comprises SEQ ID NO:3. 162. The method of clause 96, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists essentially of SEQ ID NO:3. 163. The method of clause 96, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists of SEQ ID NO:3. 164. The method of clause 96, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition comprises SEQ ID NO:4. 165. The method of clause 96, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists essentially of SEQ ID NO:4. 166. The method of clause 96, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists of SEQ ID NO:4. 167. The method of clause 96, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition comprises SEQ ID NO:5. 168. The method of clause 96, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists essentially of SEQ ID NO:5. 169. The method of clause 96, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists of SEQ ID NO:5. 170. The method of clause 96, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition comprises SEQ ID NO:6. 171. The method of clause 96, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists essentially of SEQ ID NO:6. 172. The method of clause 96, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists of SEQ ID NO:6. 173. The method of clause 96, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition comprises SEQ ID NO:7. 174. The method of clause 96, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists essentially of SEQ ID NO:7. 175. The method of clause 96, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists of SEQ ID NO:7. 176. A method of activating an intrabody composition with a chemical, said method comprising the step of contacting the intrabody composition with the chemical, wherein the intrabody composition comprises i) an intrabody and ii) one or more inserts, and wherein the chemical activates the intrabody composition. 177. The method of clause 176, any other suitable clause, or any combination of suitable clauses, wherein the activation is reversible. 178. The method of clause 176, any other suitable clause, or any combination of suitable clauses, wherein the chemical is rapamycin. 179. The method of clause 176, any other suitable clause, or any combination of suitable clauses, wherein the chemical is a rapamycin metabolite. 180. The method of clause 176, any other suitable clause, or any combination of suitable clauses, wherein the chemical is a rapamycin analog. 181. The method of clause 176, any other suitable clause, or any combination of suitable clauses, wherein the chemical is caffeine. 182. The method of clause 176, any other suitable clause, or any combination of suitable clauses, wherein the chemical is a caffeine metabolite. 183. The method of clause 176, any other suitable clause, or any combination of suitable clauses, wherein the chemical is a caffeine analog. 184. The method of clause 176, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition is configured to induce a protein-protein interaction via activation. 185. The method of clause 184, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises association of a first protein to a second protein. 186. The method of clause 184, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises disassociation of a first protein to a second protein. 187. The method of clause 184, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises association of a first protein to a second protein. 188. The method of clause 184, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises protein subcellular translocation. 189. The method of clause 184, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises protein degradation. 190. The method of clause 184, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises gene expression. 191. The method of clause 184, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises nucleic acid base editing. 192. The method of clause 184, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises calcium signaling. 193. The method of clause 184, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises calcium entry. 194. The method of clause 184, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises ion channel gating. 195. The method of clause 184, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises gene transcription. 196. The method of clause 184, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises CAR expression. 197. The method of clause 176, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition is configured to control binding of an antigen to an antibody via activation. 198. The method of clause 176, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition is configured to induce protein homodimerization via activation. 199. The method of clause 176, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition is configured to induce protein heterodimerization via activation. 200. The method of clause 176, any other suitable clause, or any combination of suitable clauses, wherein the intrabody is a monobody. 201. The method of clause 176, any other suitable clause, or any combination of suitable clauses, wherein the intrabody is a nanobody. 202. The method of clause 176, any other suitable clause, or any combination of suitable clauses, wherein the intrabody is a monobody that recognizes the SH2 domain of Abl. 203. The method of clause 202, any other suitable clause, or any combination of suitable clauses, wherein the monobody comprises an EF domain. 204. The method of clause 176, any other suitable clause, or any combination of suitable clauses, wherein the intrabody is a mCherry-specific nanobody. 205. The method of clause 204, any other suitable clause, or any combination of suitable clauses, wherein the mCherry-specific nanobody comprises an S3 loop. 206. The method of clause 176, any other suitable clause, or any combination of suitable clauses, wherein the insert is a protein or a protein fragment. 207. The method of clause 206, any other suitable clause, or any combination of suitable clauses, wherein the protein comprises a LOV2 fragment. 208. The method of clause 206, any other suitable clause, or any combination of suitable clauses, wherein the protein comprises a circularly permuted version of cpLOV2. 209. The method of clause 206, any other suitable clause, or any combination of suitable clauses, wherein the protein comprises acVHH. 210. The method of clause 206, any other suitable clause, or any combination of suitable clauses, wherein the protein comprises an acVHH variant. 211. The method of clause 206, any other suitable clause, or any combination of suitable clauses, wherein the protein comprises UniRapR. 212. The method of clause 176, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition comprises two inserts. 213. The method of clause 212, any other suitable clause, or any combination of suitable clauses, wherein the two inserts comprise a first insert and a second insert. 214. The method of clause 213, any other suitable clause, or any combination of suitable clauses, wherein the first insert and the second insert are the same. 215. The method of clause 213, any other suitable clause, or any combination of suitable clauses, wherein the first insert and the second insert are different. 216. The method of clause 213, any other suitable clause, or any combination of suitable clauses, wherein the first insert and the second insert both comprise a LOV2 fragment. 217. The method of clause 213, any other suitable clause, or any combination of suitable clauses, wherein the first insert and the second insert both comprise cpLOV2. 218. The method of clause 213, any other suitable clause, or any combination of suitable clauses, wherein the first insert and the second insert both comprise a circularly permuted version of cpLOV2. 219. The method of clause 213, any other suitable clause, or any combination of suitable clauses, wherein the first insert and the second insert both comprise acVHH. 220. The method of clause 213, any other suitable clause, or any combination of suitable clauses, wherein the first insert and the second insert both comprise an acVHH variant. 221. The method of clause 176, any other suitable clause, or any combination of suitable clauses, wherein the insert comprises two inserts. 222. The method of clause 221, any other suitable clause, or any combination of suitable clauses, wherein the two inserts are contacted via a linker. 223. The method of clause 221, any other suitable clause, or any combination of suitable clauses, wherein the two inserts are covalently connected. 224. The method of clause 221, any other suitable clause, or any combination of suitable clauses, wherein the two inserts are covalently connected via a linker. 225. The method of clause 176, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition is conjugated to a therapeutic agent. 226. The method of clause 225, any other suitable clause, or any combination of suitable clauses, wherein the therapeutic agent is a CAR-T cell. 227. The method of clause 225, any other suitable clause, or any combination of suitable clauses, wherein the therapeutic agent is an NK cell. 228. The method of clause 225, any other suitable clause, or any combination of suitable clauses, wherein the therapeutic agent is a macrophage. 229. The method of clause 225, any other suitable clause, or any combination of suitable clauses, wherein the therapeutic agent is an antibody. 230. The method of clause 225, any other suitable clause, or any combination of suitable clauses, wherein the therapeutic agent is an E3 ligase. 231. The method of clause 225, any other suitable clause, or any combination of suitable clauses, wherein the therapeutic agent is a TEV protease. 232. The method of clause 225, any other suitable clause, or any combination of suitable clauses, wherein the therapeutic agent is transcriptional activator VP64. 233. The method of clause 176, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition comprises SEQ ID NO: 1. 234. The method of clause 176, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists essentially of SEQ ID NO:1. 235. The method of clause 176, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists of SEQ ID NO:1. 236. The method of clause 176, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition comprises SEQ ID NO:2. 237. The method of clause 176, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists essentially of SEQ ID NO:2. 238. The method of clause 176, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists of SEQ ID NO:2. 239. The method of clause 176, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition comprises SEQ ID NO:3. 240. The method of clause 176, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists essentially of SEQ ID NO:3. 241. The method of clause 176, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists of SEQ ID NO:3. 242. The method of clause 176, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition comprises SEQ ID NO:4. 243. The method of clause 176, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists essentially of SEQ ID NO:4. 244. The method of clause 176, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists of SEQ ID NO:4. 245. The method of clause 176, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition comprises SEQ ID NO:5. 246. The method of clause 176, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists essentially of SEQ ID NO:5. 247. The method of clause 176, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists of SEQ ID NO:5. 248. The method of clause 176, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition comprises SEQ ID NO:6. 249. The method of clause 176, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists essentially of SEQ ID NO:6. 250. The method of clause 176, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists of SEQ ID NO:6. 251. The method of clause 176, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition comprises SEQ ID NO:7. 252. The method of clause 176, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists essentially of SEQ ID NO:7. 253. The method of clause 176, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists of SEQ ID NO:7. 254. A method of deactivating an intrabody composition with a chemical, said method comprising the step of contacting the intrabody composition with the chemical, wherein the intrabody composition comprises i) an intrabody and ii) one or more inserts, and wherein the chemical deactivates the intrabody composition. 255. The method of clause 254, any other suitable clause, or any combination of suitable clauses, wherein the deactivation is reversible. 256. The method of clause 254, any other suitable clause, or any combination of suitable clauses, wherein the chemical is rapamycin. 257. The method of clause 254, any other suitable clause, or any combination of suitable clauses, wherein the chemical is a rapamycin metabolite. 258. The method of clause 254, any other suitable clause, or any combination of suitable clauses, wherein the chemical is a rapamycin analog. 259. The method of clause 254, any other suitable clause, or any combination of suitable clauses, wherein the chemical is caffeine. 260. The method of clause 254, any other suitable clause, or any combination of suitable clauses, wherein the chemical is a caffeine metabolite. 261. The method of clause 254, any other suitable clause, or any combination of suitable clauses, wherein the chemical is a caffeine analog. 262. The method of clause 254, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition is configured to induce a protein-protein interaction via deactivation. 263. The method of clause 262, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises association of a first protein to a second protein. 264. The method of clause 262, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises disassociation of a first protein to a second protein. 265. The method of clause 262, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises association of a first protein to a second protein. 266. The method of clause 262, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises protein subcellular translocation. 267. The method of clause 262, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises protein degradation. 268. The method of clause 262, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises gene expression. 269. The method of clause 262, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises nucleic acid base editing. 270. The method of clause 262, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises calcium signaling. 271. The method of clause 262, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises calcium entry. 272. The method of clause 262, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises ion channel gating. 273. The method of clause 262, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises gene transcription. 274. The method of clause 262, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises CAR expression. 275. The method of clause 254, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition is configured to control binding of an antigen to an antibody via activation. 276. The method of clause 254, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition is configured to induce protein homodimerization via activation. 277. The method of clause 254, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition is configured to induce protein heterodimerization via activation. 278. The method of clause 254, any other suitable clause, or any combination of suitable clauses, wherein the intrabody is a monobody. 279. The method of clause 254, any other suitable clause, or any combination of suitable clauses, wherein the intrabody is a nanobody. 280. The method of clause 254, any other suitable clause, or any combination of suitable clauses, wherein the intrabody is a monobody that recognizes the SH2 domain of Abl. 281. The method of clause 280, any other suitable clause, or any combination of suitable clauses, wherein the monobody comprises an EF domain. 282. The method of clause 254, any other suitable clause, or any combination of suitable clauses, wherein the intrabody is a mCherry-specific nanobody. 283. The method of clause 282, any other suitable clause, or any combination of suitable clauses, wherein the mCherry-specific nanobody comprises an S3 loop. 284. The method of clause 254, any other suitable clause, or any combination of suitable clauses, wherein the insert is a protein or a protein fragment. 285. The method of clause 284, any other suitable clause, or any combination of suitable clauses, wherein the protein comprises a LOV2 fragment. 286. The method of clause 284, any other suitable clause, or any combination of suitable clauses, wherein the protein comprises a circularly permuted version of cpLOV2. 287. The method of clause 284, any other suitable clause, or any combination of suitable clauses, wherein the protein comprises acVHH. 288. The method of clause 284, any other suitable clause, or any combination of suitable clauses, wherein the protein comprises an acVHH variant. 289. The method of clause 284, any other suitable clause, or any combination of suitable clauses, wherein the protein comprises UniRapR. 290. The method of clause 254, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition comprises two inserts. 291. The method of clause 290, any other suitable clause, or any combination of suitable clauses, wherein the two inserts comprise a first insert and a second insert. 292. The method of clause 291, any other suitable clause, or any combination of suitable clauses, wherein the first insert and the second insert are the same. 293. The method of clause 291, any other suitable clause, or any combination of suitable clauses, wherein the first insert and the second insert are different. 294. The method of clause 291, any other suitable clause, or any combination of suitable clauses, wherein the first insert and the second insert both comprise a LOV2 fragment. 295. The method of clause 291, any other suitable clause, or any combination of suitable clauses, wherein the first insert and the second insert both comprise cpLOV2. 296. The method of clause 291, any other suitable clause, or any combination of suitable clauses, wherein the first insert and the second insert both comprise a circularly permuted version of cpLOV2. 297. The method of clause 291, any other suitable clause, or any combination of suitable clauses, wherein the first insert and the second insert both comprise acVHH. 298. The method of clause 291, any other suitable clause, or any combination of suitable clauses, wherein the first insert and the second insert both comprise an acVHH variant. 299. The method of clause 254, any other suitable clause, or any combination of suitable clauses, wherein the insert comprises two inserts. 300. The method of clause 299, any other suitable clause, or any combination of suitable clauses, wherein the two inserts are contacted via a linker. 301. The method of clause 299, any other suitable clause, or any combination of suitable clauses, wherein the two inserts are covalently connected. 302. The method of clause 299, any other suitable clause, or any combination of suitable clauses, wherein the two inserts are covalently connected via a linker. 303. The method of clause 254, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition is conjugated to a therapeutic agent. 304. The method of clause 303, any other suitable clause, or any combination of suitable clauses, wherein the therapeutic agent is a CAR-T cell. 305. The method of clause 303, any other suitable clause, or any combination of suitable clauses, wherein the therapeutic agent is an NK cell. 306. The method of clause 303, any other suitable clause, or any combination of suitable clauses, wherein the therapeutic agent is a macrophage. 307. The method of clause 303, any other suitable clause, or any combination of suitable clauses, wherein the therapeutic agent is an antibody. 308. The method of clause 303, any other suitable clause, or any combination of suitable clauses, wherein the therapeutic agent is an E3 ligase. 309. The method of clause 303, any other suitable clause, or any combination of suitable clauses, wherein the therapeutic agent is a TEV protease. 310. The method of clause 303, any other suitable clause, or any combination of suitable clauses, wherein the therapeutic agent is transcriptional activator VP64. 311. The method of clause 254, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition comprises SEQ ID NO:1. 312. The method of clause 254, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists essentially of SEQ ID NO:1. 313. The method of clause 254, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists of SEQ ID NO:1. 314. The method of clause 254, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition comprises SEQ ID NO:2. 315. The method of clause 254, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists essentially of SEQ ID NO:2. 316. The method of clause 254, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists of SEQ ID NO:2. 317. The method of clause 254, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition comprises SEQ ID NO:3. 318. The method of clause 254, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists essentially of SEQ ID NO:3. 319. The method of clause 254, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists of SEQ ID NO:3. 320. The method of clause 254, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition comprises SEQ ID NO:4. 321. The method of clause 254, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists essentially of SEQ ID NO:4. 322. The method of clause 254, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists of SEQ ID NO:4. 323. The method of clause 254, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition comprises SEQ ID NO:5. 324. The method of clause 254, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists essentially of SEQ ID NO:5. 325. The method of clause 254, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists of SEQ ID NO:5. 326. The method of clause 254, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition comprises SEQ ID NO:6. 327. The method of clause 254, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists essentially of SEQ ID NO:6. 328. The method of clause 254, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists of SEQ ID NO:6. 329. The method of clause 254, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition comprises SEQ ID NO:7. 330. The method of clause 254, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists essentially of SEQ ID NO:7. 331. The method of clause 254, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists of SEQ ID NO:7. 332. A method of activating an intrabody composition with light, said method comprising the step of contacting the intrabody composition with the light, wherein the intrabody composition comprises i) an intrabody and ii) one or more inserts, and wherein the light activates the intrabody composition. 333. The method of clause 332, any other suitable clause, or any combination of suitable clauses, wherein the activation is reversible. 334. The method of clause 332, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition is configured to induce a protein-protein interaction via activation. 335. The method of clause 334, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises association of a first protein to a second protein. 336. The method of clause 334, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises disassociation of a first protein to a second protein. 337. The method of clause 334, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises association of a first protein to a second protein. 338. The method of clause 334, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises protein subcellular translocation. 339. The method of clause 334, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises protein degradation. 340. The method of clause 334, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises gene expression. 341. The method of clause 334, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises nucleic acid base editing. 342. The method of clause 334, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises calcium signaling. 343. The method of clause 334, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises calcium entry. 344. The method of clause 334, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises ion channel gating. 345. The method of clause 334, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises gene transcription. 346. The method of clause 334, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises CAR expression. 347. The method of clause 332, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition is configured to control binding of an antigen to an antibody via activation. 348. The method of clause 332, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition is configured to induce protein homodimerization via activation. 349. The method of clause 332, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition is configured to induce protein heterodimerization via activation. 350. The method of clause 332, any other suitable clause, or any combination of suitable clauses, wherein the intrabody is a monobody. 351. The method of clause 332, any other suitable clause, or any combination of suitable clauses, wherein the intrabody is a nanobody. 352. The method of clause 332, any other suitable clause, or any combination of suitable clauses, wherein the intrabody is a monobody that recognizes the SH2 domain of Abl. 353. The method of clause 352, any other suitable clause, or any combination of suitable clauses, wherein the monobody comprises an EF domain. 354. The method of clause 332, any other suitable clause, or any combination of suitable clauses, wherein the intrabody is a mCherry-specific nanobody. 355. The method of clause 354, any other suitable clause, or any combination of suitable clauses, wherein the mCherry-specific nanobody comprises an S3 loop. 356. The method of clause 332, any other suitable clause, or any combination of suitable clauses, wherein the insert is a protein or a protein fragment. 357. The method of clause 356, any other suitable clause, or any combination of suitable clauses, wherein the protein comprises a LOV2 fragment. 358. The method of clause 356, any other suitable clause, or any combination of suitable clauses, wherein the protein comprises a circularly permuted version of cpLOV2. 359. The method of clause 356, any other suitable clause, or any combination of suitable clauses, wherein the protein comprises acVHH. 360. The method of clause 356, any other suitable clause, or any combination of suitable clauses, wherein the protein comprises an acVHH variant. 361. The method of clause 356, any other suitable clause, or any combination of suitable clauses, wherein the protein comprises UniRapR. 362. The method of clause 332, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition comprises two inserts. 363. The method of clause 362, any other suitable clause, or any combination of suitable clauses, wherein the two inserts comprise a first insert and a second insert. 364. The method of clause 363, any other suitable clause, or any combination of suitable clauses, wherein the first insert and the second insert are the same. 365. The method of clause 363, any other suitable clause, or any combination of suitable clauses, wherein the first insert and the second insert are different. 366. The method of clause 363, any other suitable clause, or any combination of suitable clauses, wherein the first insert and the second insert both comprise a LOV2 fragment. 367. The method of clause 363, any other suitable clause, or any combination of suitable clauses, wherein the first insert and the second insert both comprise cpLOV2. 368. The method of clause 363, any other suitable clause, or any combination of suitable clauses, wherein the first insert and the second insert both comprise a circularly permuted version of cpLOV2. 369. The method of clause 363, any other suitable clause, or any combination of suitable clauses, wherein the first insert and the second insert both comprise acVHH. 370. The method of clause 363, any other suitable clause, or any combination of suitable clauses, wherein the first insert and the second insert both comprise an acVHH variant. 371. The method of clause 332, any other suitable clause, or any combination of suitable clauses, wherein the insert comprises two inserts. 372. The method of clause 371, any other suitable clause, or any combination of suitable clauses, wherein the two inserts are contacted via a linker. 373. The method of clause 371, any other suitable clause, or any combination of suitable clauses, wherein the two inserts are covalently connected. 374. The method of clause 371, any other suitable clause, or any combination of suitable clauses, wherein the two inserts are covalently connected via a linker. 375. The method of clause 332, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition is conjugated to a therapeutic agent. 376. The method of clause 375, any other suitable clause, or any combination of suitable clauses, wherein the therapeutic agent is a CAR-T cell. 377. The method of clause 375, any other suitable clause, or any combination of suitable clauses, wherein the therapeutic agent is an NK cell. 378. The method of clause 375, any other suitable clause, or any combination of suitable clauses, wherein the therapeutic agent is a macrophage. 379. The method of clause 375, any other suitable clause, or any combination of suitable clauses, wherein the therapeutic agent is an antibody. 380. The method of clause 375, any other suitable clause, or any combination of suitable clauses, wherein the therapeutic agent is an E3 ligase. 381. The method of clause 375, any other suitable clause, or any combination of suitable clauses, wherein the therapeutic agent is a TEV protease. 382. The method of clause 375, any other suitable clause, or any combination of suitable clauses, wherein the therapeutic agent is transcriptional activator VP64. 383. The method of clause 332, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition comprises SEQ ID NO: 1. 384. The method of clause 332, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists essentially of SEQ ID NO:1. 385. The method of clause 332, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists of SEQ ID NO: 1. 386. The method of clause 332, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition comprises SEQ ID NO:2. 387. The method of clause 332, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists essentially of SEQ ID NO:2. 388. The method of clause 332, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists of SEQ ID NO:2. 389. The method of clause 332, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition comprises SEQ ID NO:3. 390. The method of clause 332, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists essentially of SEQ ID NO:3. 391. The method of clause 332, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists of SEQ ID NO:3. 392. The method of clause 332, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition comprises SEQ ID NO:4. 393. The method of clause 332, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists essentially of SEQ ID NO:4. 394. The method of clause 332, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists of SEQ ID NO:4. 395. The method of clause 332, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition comprises SEQ ID NO:5. 396. The method of clause 332, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists essentially of SEQ ID NO:5. 397. The method of clause 332, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists of SEQ ID NO:5. 398. The method of clause 332, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition comprises SEQ ID NO:6. 399. The method of clause 332, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists essentially of SEQ ID NO:6. 400. The method of clause 332, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists of SEQ ID NO:6. 401. The method of clause 332, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition comprises SEQ ID NO:7. 402. The method of clause 332, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists essentially of SEQ ID NO:7. 403. The method of clause 332, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists of SEQ ID NO:7. 404. A method of deactivating an intrabody composition with light, said method comprising the step of contacting the intrabody composition with the light, wherein the intrabody composition comprises i) an intrabody and ii) one or more inserts, and wherein the light deactivates the intrabody composition. 405. The method of clause 404, any other suitable clause, or any combination of suitable clauses, wherein the deactivation is reversible. 406. The method of clause 404, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition is configured to induce a protein-protein interaction via deactivation. 407. The method of clause 406, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises association of a first protein to a second protein. 408. The method of clause 406, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises disassociation of a first protein to a second protein. 409. The method of clause 406, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises association of a first protein to a second protein. 410. The method of clause 406, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises protein subcellular translocation. 411. The method of clause 406, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises protein degradation. 412. The method of clause 406, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises gene expression. 413. The method of clause 406, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises nucleic acid base editing. 414. The method of clause 406, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises calcium signaling. 415. The method of clause 406, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises calcium entry. 416. The method of clause 406, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises ion channel gating. 417. The method of clause 406, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises gene transcription. 418. The method of clause 406, any other suitable clause, or any combination of suitable clauses, wherein the protein-protein interaction comprises CAR expression. 419. The method of clause 404, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition is configured to control binding of an antigen to an antibody via activation. 420. The method of clause 404, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition is configured to induce protein homodimerization via activation. 421. The method of clause 404, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition is configured to induce protein heterodimerization via activation. 422. The method of clause 404, any other suitable clause, or any combination of suitable clauses, wherein the intrabody is a monobody. 423. The method of clause 404, any other suitable clause, or any combination of suitable clauses, wherein the intrabody is a nanobody. 424. The method of clause 404, any other suitable clause, or any combination of suitable clauses, wherein the intrabody is a monobody that recognizes the SH2 domain of Abl. 425. The method of clause 424, any other suitable clause, or any combination of suitable clauses, wherein the monobody comprises an EF domain. 426. The method of clause 404, any other suitable clause, or any combination of suitable clauses, wherein the intrabody is a mCherry-specific nanobody. 427. The method of clause 426, any other suitable clause, or any combination of suitable clauses, wherein the mCherry-specific nanobody comprises an S3 loop. 428. The method of clause 404, any other suitable clause, or any combination of suitable clauses, wherein the insert is a protein or a protein fragment. 429. The method of clause 428, any other suitable clause, or any combination of suitable clauses, wherein the protein comprises a LOV2 fragment. 430. The method of clause 428, any other suitable clause, or any combination of suitable clauses, wherein the protein comprises a circularly permuted version of cpLOV2. 431. The method of clause 428, any other suitable clause, or any combination of suitable clauses, wherein the protein comprises acVHH. 432. The method of clause 428, any other suitable clause, or any combination of suitable clauses, wherein the protein comprises an acVHH variant. 433. The method of clause 428, any other suitable clause, or any combination of suitable clauses, wherein the protein comprises UniRapR. 434. The method of clause 404, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition comprises two inserts. 435. The method of clause 434, any other suitable clause, or any combination of suitable clauses, wherein the two inserts comprise a first insert and a second insert. 436. The method of clause 435, any other suitable clause, or any combination of suitable clauses, wherein the first insert and the second insert are the same. 437. The method of clause 435, any other suitable clause, or any combination of suitable clauses, wherein the first insert and the second insert are different. 438. The method of clause 435, any other suitable clause, or any combination of suitable clauses, wherein the first insert and the second insert both comprise a LOV2 fragment. 439. The method of clause 435, any other suitable clause, or any combination of suitable clauses, wherein the first insert and the second insert both comprise cpLOV2. 440. The method of clause 435, any other suitable clause, or any combination of suitable clauses, wherein the first insert and the second insert both comprise a circularly permuted version of cpLOV2. 441. The method of clause 435, any other suitable clause, or any combination of suitable clauses, wherein the first insert and the second insert both comprise acVHH. 442. The method of clause 435, any other suitable clause, or any combination of suitable clauses, wherein the first insert and the second insert both comprise an acVHH variant. 443. The method of clause 404, any other suitable clause, or any combination of suitable clauses, wherein the insert comprises two inserts. 444. The method of clause 443, any other suitable clause, or any combination of suitable clauses, wherein the two inserts are contacted via a linker. 445. The method of clause 443, any other suitable clause, or any combination of suitable clauses, wherein the two inserts are covalently connected. 446. The method of clause 443, any other suitable clause, or any combination of suitable clauses, wherein the two inserts are covalently connected via a linker. 447. The method of clause 404, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition is conjugated to a therapeutic agent. 448. The method of clause 447, any other suitable clause, or any combination of suitable clauses, wherein the therapeutic agent is a CAR-T cell. 449. The method of clause 447, any other suitable clause, or any combination of suitable clauses, wherein the therapeutic agent is an NK cell. 450. The method of clause 447, any other suitable clause, or any combination of suitable clauses, wherein the therapeutic agent is a macrophage. 451. The method of clause 447, any other suitable clause, or any combination of suitable clauses, wherein the therapeutic agent is an antibody. 452. The method of clause 447, any other suitable clause, or any combination of suitable clauses, wherein the therapeutic agent is an E3 ligase. 453. The method of clause 447, any other suitable clause, or any combination of suitable clauses, wherein the therapeutic agent is a TEV protease. 454. The method of clause 447, any other suitable clause, or any combination of suitable clauses, wherein the therapeutic agent is transcriptional activator VP64. 455. The method of clause 404, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition comprises SEQ ID NO:1. 456. The method of clause 404, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists essentially of SEQ ID NO:1. 457. The method of clause 404, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists of SEQ ID NO:1. 458. The method of clause 404, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition comprises SEQ ID NO:2. 459. The method of clause 404, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists essentially of SEQ ID NO:2. 460. The method of clause 404, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists of SEQ ID NO:2. 461. The method of clause 404, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition comprises SEQ ID NO:3. 462. The method of clause 404, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists essentially of SEQ ID NO:3. 463. The method of clause 404, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists of SEQ ID NO:3. 464. The method of clause 404, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition comprises SEQ ID NO:4. 465. The method of clause 404, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists essentially of SEQ ID NO:4. 466. The method of clause 404, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists of SEQ ID NO:4. 467. The method of clause 404, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition comprises SEQ ID NO:5. 468. The method of clause 404, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists essentially of SEQ ID NO:5. 469. The method of clause 404, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists of SEQ ID NO:5. 470. The method of clause 404, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition comprises SEQ ID NO:6. 471. The method of clause 404, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists essentially of SEQ ID NO:6. 472. The method of clause 404, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists of SEQ ID NO:6. 473. The method of clause 404, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition comprises SEQ ID NO:7. 474. The method of clause 404, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists essentially of SEQ ID NO:7. 475. The method of clause 404, any other suitable clause, or any combination of suitable clauses, wherein the intrabody composition consists of SEQ ID NO:7.
Example 1
(74) Preparation of Caffeine-Operated Intrabody Compositions
(75) Molecular Cloning and Plasmid Construction:
(76) Plasmid construction was performed using the general restriction enzyme digestion and ligation method in Examples 1-4. KOD Hot Start DNA polymerase was purchased from EMD Millipore (Burlington, MA, USA) and used for PCR amplifications. Oligonucleotides were synthesized by Sigma Aldrich (St. Louis, MO, USA). The T4 DNA ligase kit and NEBuilder HiFi DNA Assembly Master Mix were purchased from New England BioLabs (Ipswich, MA, USA). QuikChange Multi Site-Directed Mutagenesis Kit was obtained from Agilent Technologies (Santa Clara, CA, USA). Recombinant SARS-COV-2 Spike RBD was purchased from R&D Systems (Minneapolis, MN, USA).
(77) YFP-acVHH-PB was generated by inserting the synthesized cDNA encoding acVHH (GENEWIT, South Plainfield, NJ, USA) upstream of the STIM1-PB domain into the pEYFP-C1 vector. To produce oligomeric proteins fused to PB, acVHH or YFP was replaced by mCherry, GST, DsRed and the FRB/FKBP system, respectively. YFP-acVHH-PB variants were made by using the QuikChange Site-Directed Mutagenesis Kit. YFP-biCOSMO-SPB and YFP-biCOSMO-L-PB were constructed by inserting amplified acVHH-Y104W with the corresponding linker into YFP-COSMO-PB. mCherry-acVHH (WT/Y104W)-STIM1ct constructs were prepared by amplifying the STIMIct fragment (233-685) and acVHH (WT/Y104W) via standard PCR and then inserted into a modified pmCherry-C1 vector. Lyn11-mCh-FGFRct-COSMO was constructed by amplifying cDNAs encoding Lyn11, FGFRct and acVHH-Y104W and then inserting them individually into a pTriEx vector. Bacterial expression vectors encoding MBP-COSMO-H11-D4 and MBP-COSMO-VHH72 were made by amplifying acVHH-Y104W and synthetic cDNAs encoding H11-D4 or VHH72 and inserting them into the pMCSG-9 vector, respectively. MLKL.sub.NT-mCh-biCOSMO-S was constructed by inserting amplified biCOSMO-S into the pLentiBlast vector. biCOSMO-L-SpvB was constructed by sequentially inserting amplified SpvB N- (residues 375-462), biCOSMO-L and SpvB C-domain (residues 463-591) into the pEGFP-C1 vector.
(78) Chemical Reagents and Caffeinated Beverages:
(79) Caffeine, paraxanthine, theobromine, rapamycin, Isopropyl-b-D-thiogalactopyranoside (IPTG), DMSO, and theophylline were purchased from Sigma. DMSO stock solution was made refresh prior to use. Annexin V (Pacific Blue conjugate) was purchased from Fisher Scientific. Caffeinated beverages, including Coca-Cola, Starbucks coffee and Red Bull were purchased from a local grocery store.
(80) Cell Culture and Transfection:
(81) The HeLa cell line was purchased from ATCC. Cells were cultured at 37 C. with 5% CO.sub.2 in Dulbecco's Modified Eagle medium (DMEM; Sigma-Aldrich; St. Louis, MO, USA) supplemented with 10% FBS and 1% penicillin/streptomycin cocktail. For fluorescence imaging experiments, cells were seeded in 35-mm glass-bottom dishes (Cellvis, Mountain View, CA, USA). On day 2, transfection was performed when cells reaching about 50-70% confluency using the Lipofectamine 3000 (Life Technologies; Carlsbad, CA, USA) reagent by following the manufacturer's instructions. 6 h post-transfection, cells were replenished with normal DMEM. On day 3-4, transfected cells were mounted on a Nikon confocal microscope stage for imaging.
(82) Highthroughput Screening (HTS) of acVHH Variants:
(83) Randomized mutagenesis in key sties involved in caffeine binding were performed and the formation of dimeric interface by using acVHH as the template (a total of 27 sites20=540 constructs;
(84) Purification of Recombinant Proteins from E. coli:
(85) Escherichia coli strain BL21(DE3) cells (EMD Millipore) were transformed with plasmids encoding MBP-COSMO-VHH72 and MBP-COSMO-H11-D4, and grown at 37 C. in LB medium. Protein expression was induced by the addition of 0.5 mM IPTG when OD600 around 0.6-0.8, and incubated at 16 C. for another 16 h. Harvested cells were resuspended in a resuspension buffer containing 20 mM Tris-HCl pH 7.4, 137 mM NaCl, and then sonicated. The cellular debris was removed by centrifugation. The MBP-fusion protein was enriched by passing the clarified supernatants through amylose resin and further purified via size exclusion chromatography (GE Healthcare).
(86) Live-Cell Imaging and Image Analysis:
(87) Fluorescence imaging was performed on a Nikon Eclipse Ti-E microscope equipped with an A1R-A1 confocal module with LU-N4 laser sources (argon-ion: 405 and 488 nm; diode: 561 nm) and a live-cell culture cage (maintaining the temperate at 37 C. with 5% CO.sub.2). 60 oil or 40 oil lens was used for confocal imaging. The half maximal effective concentration (EC.sub.50) values of acVHH and COSMO variants were determined by incubating Hela cells with DMEM media containing various concentrations of caffeine, its metabolites, or caffeinated beverages for 2 min. To calculate the changes in cytosolic YFP signals (in the form of F/F.sub.0), the Intensity Line Profile function in the Nikon Elements software was employed. The titration curves were fitted using a dose-response curve function ([Agonist] vs. responseVariable slope (four parameters)) using the Prism8 software. 16 cells were selected for each titration curve. All experiments were independently repeated three times.
(88) For measurement of Ca2+ influx in HeLa cells co-expressing the green calcium indicator GCaMP6s and mCherry-acVHH/COSMO-STIMIct, 488-nm and 561-nm laser sources were used to excite GFP and mCherry, respectively, at an interval of 8 sec. The collected images were analyzed by the NIS-Elements AR microscope imaging software (Nikon, NIS-element AR version 4.0). 40-60 cells were selected to define regions of interest (ROI) for analyzing the GCaMP6s fluorescence intensity. All experiments were repeated three times. To monitor NFAT-GFP nuclear translocation, a HeLa cell line stably expressing NFAT1.sub.1-460-GFP was used. mCherry-acVHH/COSMO-STIMIct were transfected into this cell line, which was imaged 24 h after transfection. A total of 60 min time-lapse imaging was recorded at an interval of 15 sec and the nuclear GFP signal ratio changes (in the format of F/F.sub.0) were used to report the efficiency of NFAT activation. At least 40 cells were analyzed for each condition in three independent experiments.
(89) To monitor the necroptosis of HeLa cells transfected with MLKL.sub.NT-mCherry-diCOSMO-S, 405 nm and 561 nm laser sources were used to excite Pacific blue-conjugated Annexin V and mCherry, respectively. Hela cells were preincubated with the Annexin V staining reagent for 5 min before imaging, and 100 M caffeine was added to the medium to reach a final concentration of 1 M during the imaging process. Time-lapse imaging was carried out at an interval of 1 min for up to 100 min and the blue signal ratio change of Annexin V (F/F.sub.0) was used to quantitatively report the necroptotic progression.
(90) Enzyme-Linked Immunosorbent Assay (ELISA) to Probe the Nanobody-RBD Interaction:
(91) Wells of microtiter plates were coated overnight at 30 C. with 30 ng streptavidin. Biotinylated SARS-COV-RBD was added and incubated at 4 C. for 4 hours. The coated plates were then blocked with 5% BSA in PBS. Serially diluted nanobodies (20, 10, 5, 2.5, 1.25, 0.63, 0.31, 0.06, 0.006 g/mL) were added to the individual wells. Binding was detected by incubating the plates sequentially with a mouse anti-MBP monoclonal antibody (E8032S, New England Biolabs) and a horseradish peroxidase (HRP)-linked anti-mouse IgG (1/2000, NXA931, GE Healthcare). After washing, 30 L of tetramethylbenzidine substrate (BD OptETA) was added to each well and the reaction was stopped by addition of 20 L of 1 M H.sub.2SO4. The absorbance (O.D.) at 450 nm was measured with an iMark Microplate Absorbance Reader (Bio-Rad).
Example 2
(92) Characterization and Optimization of Caffeine-Operated Intrabody Compositions (Caffeine-Operated Synthetic Module (COSMO))
(93) To facilitate the high throughput screening of acVHH variants with varying affinities to caffeine, a protein translocation assay was developed by fusing acVHH with a phosphoinositide (PIP)-binding (PB) domain derived from the stromal interaction molecule 1 (STIM1; aa 666-685; see
(94) The cytosol-to-PM translocation of the modified PB domain can be initiated by light-inducible oligomerization. It is contemplated that the acVHH-PB hybrid protein stays in the cytosol in its monomeric form. Upon addition of caffeine, it is expected to observe its translocation toward PM due to dimerization of PB to increase its avidity toward PM-resident PIPs (see
(95) The PM-translocation assay enabled us to screen acVHH mutants at real time in living cells to identify potent caffeine binders. Combined with site-directed mutagenesis, key residues were identified that would enhance the affinity of acVHH to caffeine. Mutagenesis was performed on residues located in close proximity to the caffeine binding pocket and at the VHH/VHH dimer interface area (see
(96) To probe the oligomeric state of WT acVHH and COSMO under physiological conditions in cellulo rather than using artificial recombinant proteins in vitro, a mini-tagging approach was utilized by replacing the microtubule binder in MoTag with the modified STIM1-PB tag (see
(97) The PM-translocation assay provides quantitatively probing the strengths of caffeine binding to the engineered acVHH variants in living cells. Caffeine was titrated into HeLa cells expressing YFP-acVHH-PB variants (as shown in
(98) TABLE-US-00003 TABLE 2 Summary of caffeine sensitivity (EC.sub.50 values) for representative acVHH variants and biCOSMO variants tested in the study. n = 16 cells from three independent assays Variants EC.sub.50 WT 567.5 1.6 nM Y104W (COSMO) 95.1 1.2 nM Y104F 3990.2 4.7 nM Y34W >20 M Y34F No binding Y108W >2 M Y108F No binding Y61W >1 M Y61F No binding F39W No binding F39Y No binding W111F No binding W111Y No binding M63L No binding biCOSMO-S 16.9 2.0 nM biCOSMO-L Intramolecular binding 2x WT acVHH-S 530.9 1.6 nM
(99) Moreover, the EC.sub.50 value of COSMO was largely unaffected by its expression level when expressed in mammalian cells (
(100) In support of this view, the Y-to-F substitution, which led to a complete loss of H-bonds in the aromatic cap, resulted in great loss in EC.sub.50 (3990.2 nM vs 567.5 nM; see
(101) Considering that caffeine can be metabolized in the liver of mammals into paraxanthine (84%), theobromine (12%), and theophylline (4%).sup.21 and that WT acVHH shows weak or no appreciable binding to these metabolites, it was evaluated if COSMO could respond to these chemicals and thus expand its effective substrate scope. The results demonstrated that COSMO exhibited 41217-fold enhancement in EC.sub.50 toward the three major caffeine metabolites when compared to WT acVHH (see
(102) Thereafter, commercially available caffeinated beverages were evaluated, including coffee, Red Bull and Coca-Cola (see
(103) Collectively, through rationalized mutagenesis and screening, COSMO is shown to be as a potent genetically-encoded synthetic module that can be used to control protein homodimerization using caffeine, caffeine metabolites, and a range of consumer caffeinated beverages.
Example 3
(104) Application of COSMO as Chemically-Inducible Dimerizer
(105) The instant example evaluates the feasibility of using COSMO as a chemically-inducible dimerizer. For instance, a synthetic device can be designed that can use low dose caffeine to switch on the ORAI calcium channel and control the downstream calcium-responsive transcription factor, the nuclear factor of activated-T cells (NFAT). As forced dimerization of the N-terminus of the cytoplasmic domain of stromal interaction molecule 1 (STIM1ct) has been shown to switch on autoinhibitory STIM1 to engage and activate ORAI calcium channels, it is hypothesized that caffeine-inducible dimerization of STIMIct could likewise achieve the same function (see
(106) An acVHH-STIMIct hybrid construct was formed but did not show pronounced caffeine-induced calcium influx in HeLa cells incubated with 1 M caffeine (see
(107) Sustained Ca.sup.2+ influx can further activate a Ca.sup.2+-dependent phosphatase, calcineurin, and subsequently dephosphorylate the calcium-responsive NFAT to cause its nuclear translocation. Thus, the degree of NFAT nuclear localization was compared before and after caffeine treatment. In agreement with the calcium influx data, caffeine caused efficient shuttling of cytosolic NFAT into the nuclei in all cells expressing COSMO-STIMIct within 30 min (t.sub.1/2=17.1 min; see
(108) Additional intrabody compositions were constructed. For instance, PM-resident tyrosine receptor kinases (RTKs) were engineered aiming to use caffeine to replace growth factors to recapitulate RTK-mediated intracellular signaling. The COSMO module was fused with cytoplasmic region of fibroblast growth factor receptor 1 (FGFRct) and tethered the hybrid protein toward PM via N-terminal tagging with the Lyn11 motif (see
(109) Thereafter, it was contemplated that COSMO can be modularly tagged to nanobodies that lack the bulky Fc fragment of a typical antibody, and enable the assembly of non-covalent bivalent nanobodies to enhance their antigen recognition. COSMO was fused with two different nanobodies (VHH72 and H11-D4) that could specifically recognize the receptor binding domain (RBD) of the spike protein derived from severe acute respiratory distress (SARS) coronavirus 2 (SARS-COV-2). These nanobodies have the potential to mitigate SARS-CoV-2 infection and alleviate COVID-19 symptoms by blocking the interaction of viral spike protein with the angiotensin-converting enzyme 2 (ACE2) expressed on the surface of human lung epithelial cells. Use of a covalently linked bivalent nanobody or fusion with the Fc homodimerization fragment could enhance the nanobody-target interaction and virus neutralization capability. Thus, it was evaluated whether chemical-inducible dimerization of these nanobodies could exhibit similar boosting effects (see
(110) After screening several anti-Spike nanobodies fused with COSMO, it was shown that COSMO-H11-D4 and COSMO-VHH72 showed stronger binding to SARS-COV-2 RBD in the presence of 10 M caffeine based on ELISA results (see
Example 4
(111) COSMO Concatemer (biCOSMO) as Modular Switch to Control Protein Activities
(112) COSMO exhibits a low EC.sub.50 to caffeine (95.1 nM) and greatly expands its substrates. In the instant example, COSMO was assembled in a concatemeric form with linkers of different lengths (see
(113) The resultant intrabody composition (biCOSMO-S) subsantially reduced basal activity, as shown by the lack of discernible PM translocation of biCOSMO-PB (see
(114) Construction of a similar concatemer using WT acVHH with the same linker (2acVHH-S-PB) showed slight improvement in the performance compared to acVHH-PB (530.9 nM vs 567.5 nM; see Table 2), which demonstrates the unique COSMO module to enhance the binding affinity. Surprisingly, use of a longer linker with a mixed flexible and rigid structure to connect two COSMO molecules (biCOSMO-L-PB), demonstrated that caffeine-induced PM translocation was no longer observed (see
(115) To further validate that biCOSMO-S could be harnessed to induce intermolecular dimerization, a chemically-inducible cell suicide device was developed by fusing biCOSMO-S with the N-terminal domain of MLKL (MLKL.sub.NT). Once activated via phosphorylation upon inflammatory stimulation, the N-terminal region of MLKL can to oligomerize and translocate toward the PM to perforate membrane and cause necroptosis, a new form of non-apoptotic cell death. It is contemplated that caffeine-inducible dimerization of MLKL.sub.NT-biCOSMO-S could similarly trigger necroptosis but obviate the need of detrimental necroptotic stimuli (
(116) Finally, biCOSMO-L was evaluated as a modular allosteric switch to control enzymatic activity. The ADP-ribosyltransferase (ATR) domain derived from Salmonella SpvB, a bacterial enzyme that catalyzes ADP ribosylation of actin to prevent actin polymerization was engineered (
(117) Compared to other commonly used CID systems (Table 3), desirable features of the COSMO platform include: (i) the least chemical complexity and smallest size of the ligand (194 Da;
(118) TABLE-US-00004 TABLE 3 EC50 Time Scale Reference System (nM) (dimerization) Ligand Price Safety of Ligands (PMID) COSMO/ 95.1 <1 min $40.9/100 g Daily Caffeine beverage <400 mg/day, adult biCOSMO-S/ 16.9 <1 min $40.9/100 g Daily Caffeine beverage <400 mg/day, adult FRB-FKBP/ 10-20 <2 min $407/5 mg Rapamycin is 15796538 Rapamycin immunosuppressive 31586989 agent GAI-GID1/ 310 <1 min $256/5 mg Generally harmless 22446836 GA3-AM PYL-ABI/ >104 >30 min $26.8/50 mg Orally available 21406691 ABA HaloTag- >103 >10 min Not Unknown 23601644 SNAPTag/ commercially HaXS available FKBP- 120 <2 min Not No cytotoxicity 25065762 eDHFR/ commercially toward SLF-TMP available COS-7 cells (up to a concentration of 50 mM)
(119) Moreover, by inserting a short rigid linker between two copies of COSMO, the half maximal effective concentration to the low nM range are further enhanced (comparable to the widely-used FKBP/FRB system), thereby providing an alternative option for chemogenetic applications. Most importantly, biCOSMO-L can be modularly inserted into a host protein to enable allosteric control of protein activities and achieve tailored function.
Example 5
(120) Preparation of Light- and Chemical Operated Intrabody Compositions
(121) Molecular Cloning and Plasmid Construction:
(122) The restriction enzyme digestion-ligation and NEBuilder HiFi DNA Assembly methods were used to create plasmids in Examples 5-8. The KOD Start DNA polymerase (EMD Millipore, MA, USA) was used for PCR amplification. All the subcloned sequences were verified using diagnostic restriction digestion and Sanger's sequencing analysis. All the other cloning regents were purchased from New England Biolabs (Ipswich, MA, USA).
(123) cDNA sequences encoding monobodies and nanobodies used in Examples 5-8 were codon-optimized and synthesized as gBlock by Integrated DNA Technologies (IDT Inc, IA, USA). The monobody-encoding cDNAs (SH2Abl, MBP and SUMO) were individually inserted into a customized pcDNA-mCherry vector between the EcoRI and XbaI restriction sites to generate mCh-tagged monobodies. To create a nuclear envelope (NE)-targeting SH2abl, cDNA of lamin A was inserted into a customized mEmerald-C1 vector, followed by SH2abl insertion (NheI-EcoRI). AsLOV2 fragments were PCR amplified and inserted into monobodies by using the NEBuilder HiFi DNA Assembly method. For photoswitchable degradation, moonbody (S5.1) cDNA was amplified via PCR and then inserted into the pSH-EFIRES-P-AtAFB2-mCherry vector (Addgene, #129716) between EcoRI and NotI sites to replace mCherry.
(124) To make GFP fused nanobody, cDNA encoding the anti-mCherry nanobody LaM8 was cloned into the pTriEx-GFP vector between HindIII and XhoI sites to yield pTriEx-GFP-LaM8. AsLOV2 fragments were PCR amplified and inserted via NEBuilder HiFi DNA Assembly. The construct exhibiting the highest light-induced changes was designated as sunbody (S0+S3). The tandem sunbody expression vector (2sunbody) was made by inserting one additional copy of sunbody into the pTriEx-GFP-sunbody plasmid. The UniRapR or a dimeric concatemer of acVHH (2acVHH connected by a 58-mer GS rich linker) was inserted into the S3 site by using the same method to create rapabody or caffebody. To make mitochondria-targeting mCh, the cDNA sequences encoding human AKAP11-30 (flanked by NheI and BamHI) was inserted into mCherry-N1 to yield AKAP1-mCh. For ER anchored mCh, human SacI fragment (residues 521-587) was cloned into the pEGFP-C3 backbone by utilizing the EcoRI-KpnI restriction sites, followed by GFP replacement by mCh (between NheI and XhoI sites). The plasma membrane targeting mCh construct was made as AgeI-mCh-EcoRV-CAAX-XbaI in the same backbone.
(125) To create a SolarFLARE system for light-inducible transcriptional activation, the TEV protease component (from Ca-FLARE (protease), Addgene #92214) was assembled into pTriEx-GFP-sunbody to yield GFP-sunbody-TEV. The mCh and LOV2-TCS (TEV cleavage site)-tetR-VP16 fragments (from Ca-FLARE (TF), Addgene, #92213) modules were fused into a pcDNA3.1(+) backbone to make PM-anchored mCh-LOV2-TCS-tetR-VP16. The TagBFP or MLKL expression cassette used in the SolarFLARE system was made by putting TagBFP cDNA or human MLKL-NT (1-182) (EcoRI/XbaI) under the control of a tight TRE promoter.
(126) For photoactivatable cytosine base editor (paCBE), mCh and Cas9n (Cas9-D10A nickase) fragments were inserted into a pcDNA3.1(+) vector via HiFi assembly to make mCh-Cas9n (Part I). FNLSHiFi was replaced by GFP-sunbody in the pLenti-FNLSHiFi-P2A-Puro vector (Addgene, #136902) to make the APOBEC1-GFP-sunbody-UGI fusion construct (Part II). The luciferase-based GO system with sgRNA in the same vector was obtained from Addgene (pLenti-mU6-Luc2GO-PGK-Neo, Addgene #136905).
(127) For the rapabody-regulated transcriptional activation system, rapabody-VP64 was made by gene fragments assembly. The TagBFP reporter was modified from pGL3-Basic-8-gRNA-eGFP (Addgene, #60718), in which the TagBFP gene was put under the tight control of a minimal CMV promoter. The sgRNA targeting the upstream promoter of TagBFP reporter was obtained from Addgene (#60719).
(128) To make a caffeine-controlled calcium entry and NFAT dependent luciferase reporter system, cDNAs encoding all the components were synthesized and then re-assembled to make mCh-STIMIct (residues 233-685)-IRES-caffebody-SITM1ct by using a customized pmCherry-N1 vector as the backbone.
(129) Cell Culture and Transfection
(130) HeLa and HEK293T (human embryonic kidney) cell lines were obtained from ATCC and cultured under 37 C. at a 5% CO2 atmosphere, and maintained in the Dulbecco's modified Eagle's media (DCell MEM, Sigma-Aldrich, St Louis, MO, USA), supplemented with 10% fetal bovine serum (FBS). DNA transfection was performed by using the Lipofectamine 3000 transfection reagent (Thermo Fisher Scientific, MA, USA) according to the manufacturer's instructions. For live cell fluorescence imaging experiments, cells were seeded in four-chamber 35-mm glass bottom dishes (D35C4-20-1.5-N, Cellvis, Mountain View, CA, USA) one day before transfection, and imaged 24-48 h after transfection in an imaging cage equipped with 5% CO2 with temperature set at 37 C.
(131) Live Cell Photostimulation, Time-Lapse Imaging and Imaging Data Analysis
(132) Time-lapse confocal imaging was performed on a Nikon A1R confocal module mounted onto an inverted Nikon Eclipse Ti-E body. The light sources came from a multi-line argon laser module containing 405, 488, 561 and 640 nm lasers. A live-cell imaging caged platform was used to maintain the temperature at 37 C. with 5% CO2 to keep cells healthy during the imaging process. A 10, 20 air objective lens and 40 or 60 oil immersion objective lens were used for image acquisition.
(133) To monitor light-induced F-body:antigen association or dissociation, HeLa cells seeded on glass-bottom dishes were co-transfected with the indicated plasmids shown in the figures. Confocal images were acquired 24-48 hours after transfection. The cells were imaged every 4 sec for 2 nmin unless otherwise noted. The 488-nm laser source to excite GFP was also used for photostimulation (with 1-5% output). To quantify fluorescent signals at selected areas, we used the region-of-interest (ROI) toolbox in Nikon NIS-Elements software to define the nuclear envelope (NE) or nucleoplasm (NP) regions. The Time Measurement tool was used to determine the mCherry intensities for moonbody variants and GFP intensities for sunbody variants. The fluorescence intensity ratio (FNE/FNP) was used as readout, with the changes in the ratio plotted as F/F0 or F/F0. For spatially-restricted photostimulation, the FRAP module in the Nikon imaging system was used, with the 488-nm laser power output set at 0.2%-5%.
(134) For ligand-controllable nanobodies rapabody and caffebody, similar imaging and data analysis procedures were used. Transfected HeLa cells were incubated with normal growth media or media supplemented with different concentrations of ligands or diluted beverages as indicated in the figures. Coffees and teas were purchased from Starbucks, while other drinks were purchased from a grocery store.
(135) Structural Modeling and Selection of Insertion Sites
(136) Modeled structures of LaM8 and the anti-SH2 monobody were generated by using the I-TASSER server for protein structure and function prediction38. The molecular motion models, the inter-residue contact maps, and the cross-correlation between residue fluctuations of LaM8 and Anti-SH2 monobody were generated by using the DynOmics elastic network models server20. For the molecular motion animations, the following parameters were used: vibrations frequency: 0.05 hz; magnitude: 50; vector scaling: 0.5; vector radius: 14; motion with RMSD of 1 . The insertion sites for precise switches were selected based on the mobility/flexibility calculation and/or inter-residue connectivity of the loop regions in selected protein scaffolds using the DynOmics server.
(137) It is contemplated that structural elements undergoing large fluctuations away from their mean positions (high mobility) will provide adequate structural flexibility to accommodate conformational changes and may be allosterically coupled to functional residues.
(138) Calcium Imaging and NFAT Nuclear Translocation Assay
(139) The plasmid mCh-STIMIct-IRES-caffebody-STIMIct was co-transfected with green color Ca2+ indicator GCaMP6m into HeLa cells. Images were acquired every 5 sec for both mCh and GFP channels. Ca2+ influx was induced by supplementing 5 M caffeine to the culture media. Similar caffeine treatment was applied to HeLa cells co-transfected with mCh-STIM1ct-IRES-caffebody-STIMIct and NFAT-GFP.
(140) Moonbody Regulated Protein Degradation
(141) The plasmid encoding the moonbody fused with the F-box protein atAFB2 was co-transfected with SH2-mEmerald into HeLa cells. Cells were treated with or without a customized blue light source (470 nm, 40 W/mm2) after 16 h transfection. Light stimulation was applied for 10%(1 min ON, 9 min OFF), 30%(3 min ON, 7 min OFF), or 50%(5 min ON, 5 min OFF). After an additional 16 hours, cells were imaged and SH2-mEmerald mean intensity were measured. Moonbody without atAFB2 was used as control.
(142) SolarFLARE System for Gene Expression
(143) The construct encoding GFP-sunbody fused with TEV protease (GFP-sunbody alone as a control) was co-transfected with PM-mCh-LOV2-TCS-tetR-VP16 and the pTRE-TagBFP reporter in HEK293T cells. Eight hours post-transfection, cells were exposed to pulsed blue light stimulation for 16 h (470 nm, 40 W/mm2) with a light cycle of 1 min ON and 9 min OFF. Cells kept in the dark was used as a control. Confocal images were acquired after 48 hours transfection with a 10 or 20 air object for mCh, GFP and BFP channels. Eight fields of view were recorded for each condition. GFP expression area was masked and the mean TagBFP intensity was calculated in this mask, with areas outside GFP-positive areas used as background. The background-corrected mean TagBFP intensities were calculated and plotted. For light-inducible necroptosis, the pTRE-TagBFP vector was replaced by the pTRE-MLKL-NT plasmid, with the remaining procedures and conditions identical to the SolarFLARE-BFP reporter experiment described above. To monitor cell death at real-time, live cells were stained with the SYTOX blue dye (Thermo Fisher Scientific, S11348, 1:5000 dilution, Cf=1 M).
(144) Luciferase Reporter Assay
(145) To examine the efficiency of photoactivatable cytosine base editor (paCBE), the mCh-Cas9n, APOBEC-sunbody-UGI, and pLenti-mU6-Luc2GO-PGK-Neo (as base editing reporter) were co-transfected into HEK293T cells. Cells were treated with blue light (470 nm, 40 W/mm2, 1 min ON-9 min OFF cycles for 16 h) or kept in the dark 8 hours after transfection. Sunbody alone to replace APOBEC-sunbody-UGI was used as control. 72 h post-transfection, bioluminescence measurements were performed by using a Bright-Glo Luciferase Assay System from Promega (catalog #: E2610) by directly adding reagents to the culture medium at a 1:1 ratio. Five minutes later, the luminescence signals were quantified by using a Cytation 5 Cell Imaging Multi-Mode Reader (BioTek, Winooski, VT, USA).
(146) To monitor caffebody-STIM1ct/mCh-STIMIct induced NFAT dependent luciferase expression, HEK293T cells were transfected the indicated plasmids and processed 16 h post-transfection. Caffeine and phorbol myristate acetate (PMA) were added to the DMEM medium to a final concentration of 5 M and 15 nM, respectively. After a 20 min incubation, the solution was removed and the cells were washed twice and then cultured in normal DMEM. The luminescence was monitored after an additional 8 h culture.
(147) Rapabody-Induced BFP Expression
(148) HEK293T cells seeded on glass-bottom dishes were co-transfected with rapabody-VP64 (LaM8-VP64 as control), mCh-dCas9, sgRNA (targeting the upstream mini-promoter of TagBFP reporter) and the TagBFP-reporter. Rapamycin was added to the culture medium to a final concentration of 5 M and cultured for an additional 24 h. Confocal images were acquired and the mean TagBFP intensity of cells was measured as described for the SolarFLARE system.
Example 6
(149) Design of Moonbody Intrabody Compositions
(150) The instant example provides a light-controllable monobody by inserting the LOV2 photoswitch into a fibronectin type III domain (FN3) scaffold that specifically recognizes the Src Homology 2 (SH2) domain of Abelson tyrosine kinase (Abl). Six insertion sites at exposed loop regions with high predicted mobility (
(151) Insertion of LOV2 at Site 4 (DE loop) abolished the moonbody-target interaction regardless of the presence of light (
(152) Insertion at flexible loop regions opposing the CDR-like areas, such as S1, S3, and S5, caused varying degrees of light-induced dissociation of moonbody from NE, with the S5 construct showing the highest dynamic change and hence used for further optimization (see
(153) To further enhance the dynamic range of light-induced changes, the linker regions flanking the insertion site and the C-terminal Ja helix within LOV2 were optimized (see
(154) The transferability of this approach was validated by using two additional monobodies that recognize the small ubiquitin-like modifier protein (SUMO) and the maltose-binding protein (MBP). Both engineered moonbodies showed light-induced dissociation from their corresponding target proteins (see
(155) Moonbody generation provided control of antibody-antigen recognition with high spatial and temporal precision. The feasibility of spatial control was confirmed by alternatively focusing the photostimulation upon two individual cells under the same imaging field (
(156) The moonbody-target interaction was reversible, as reflected by repeated NE-to-NP translocation of moonbody in response to at least 10 dark-light cycles of photostimulation (
(157) It was then evaluated if moonbody could be utilized to conditionally fine-tune the expression levels of its binding target. The SH2-specific moonbody was fused with the auxin signalling F-box 2 protein (AFB2), a component in the Skp1-Cul-F-Box (SCF) E3 ubiquitin ligase complex that can recruit auxin-inducible degrons for proteasomal degradation. Monobody can directly recognize its target, thus obviating the need for auxin and the fusion of the degron tag to a target protein. This suggests that the light-triggered moonbody-target dissociation can prevent SH2 from being destroyed by the proteasomal degradation machinery (
Example 7
(158) Design of Sunbody Intrabody Compositions
(159) The instant example screens photo-switchable nanobodies using a similar engineering approach and the NE translocation assay (see
(160) Two complementary approaches were utilized to enhance the light-dependent dynamic changes. First, because the N-terminus of nanobody is close proximity to the CDRs (5-20 ; S0 site;
(161) Thereafter, it was evaluated if the simultaneous insertion of LOV2 at S0 and S3 could exert a synergistic effect on nanobody. Indeed, the resultant construct (S0+S3) displayed over 80% changes in the NE/NP ratio (
(162) Thereafter, the use of sunbody for remote control of gene expression was explored. Sunbody was combined with the FLARE platform to create a SolarFLARE system for light-inducible transcriptional activation (
(163) The photo-inducible gene transcription was first validated by using blue fluorescent protein (TagBFP) as a reporter (see
(164) Next, the TagBFP reporter was replaced by an N-terminal fragment of mixed lineage kinase domain like pseudokinase (MLKL-NT; residues 1-182) that is capable of eliciting necroptotic cell death (necrosis), in order to develop an optogenetic suicide device. Upon light stimulation, a substantial increase of cell death was observed, as reflected by appearance of SYTOX blue staining of the nuclei of dead cells after PM permeabilization by MLKL-NT (see
(165) Thereafter, sunbody was combined with the CRISPR/Cas9-mediated C-to-T base editing technique to design a photoactivatable cytosine base editor (paCBE). The functional units of CBE were split into two parts (
(166) When the transfected cells were shielded from blue light, notable bioluminescent signals were not observed. Upon photostimulation, a substantial increase of bioluminescence was detected, presumably owing to the expression of luciferase after C>T conversion at the start codon (
Example 8
(167) Design of Light- and Caffeine-Operated Intrabody Compositions
(168) The instant example evaluates whether the installation of genetically-encoded chemical switches would likewise enable chemogenetic control of nanobodies. The LOV2 domain in the S3 loop of sunbody was substituted with two ligand-controllable precision switches, UniRapR and a dimeric concatemer of acVHH (2acVHH;
(169) When expressed in HeLa cells by using mitochondria-anchored mCherry (Mito-mCh) as the antigen, contrasting behaviors between rapabody and caffebody were observed (
(170) The amount of caffeine intake from daily beverages ranges from 50-350 mg in a typical cup of coffee or a can of soda drink, which corresponds to the optimal activation window of caffebody. Thus, the possible use of beverages to modulate the caffebody-antigen interaction in live cells by using the same mitochondria-translocation assay was evaluated. Following the addition of diluted coffee, tea, soda and energy drinks into the cell culture medium, varying degrees of cytosol-to-mitochondria translocation of the caffebody were observed (
(171) Finally, employing rapabody for drug-inducible control of the assembly of a functional CRISPRa system based on dCas9 and VP64 was evaluated (
(172) In parallel, the use of caffebody to gate Ca2+ channels and control Ca2+-dependent gene transcription mediated by the downstream nuclear factor of activated T-cells (NFAT) was evaluated. Briefly, the Ca2+ release-activated Ca2+(CRAC) channel was utilized as an engineering target, which is comprised of two essential components, the stromal interaction molecule 1 (STIM1) as the channel activator and the ORAI1 protein as the pore-forming subunit to mediate Ca2+ influx across the plasma membrane (PM). Because forced apposition of the N-terminal coiled coil region 1 (CC1) of the cytoplasmic domain of STIM1 (STIM1ct) effectively overcomes intramolecular trapping of STIM1 to engage and activate the ORAI channels, it was contemplated that caffeine-induced heterodimerization between caffebody-STIM1ct and mCh-STIM1ct could activate endogenous ORAI Ca2+ channels (