ANTIBODIES SPECIFIC TO HUMAN NECTIN4

20240376202 ยท 2024-11-14

    Inventors

    Cpc classification

    International classification

    Abstract

    The present invention provides monoclonal antibodies that recognize human Nectin4 with high affinity and specificity and inhibit its binding to T cell immunoreceptor with Ig and ITIM domains (TIGIT). The present invention further provides pharmaceutical compositions comprising the antibodies and methods for their use in cancer immunotherapy and in diagnosis.

    Claims

    1. A method of treating cancer comprising administering to a subject in need thereof, a therapeutically effective amount of a pharmaceutical composition comprising at least one isolated monoclonal antibody which binds to Nectin4, or an antibody fragment thereof comprising at least the antigen binding portion, wherein the isolated antibody or antibody fragment comprises, comprising a CDR set selected from the group consisting of: (i) a set of six CDRs wherein: HC CDR1 is SYYIH (SEQ ID NO: 25); HC CDR2 is WIYPGNVNTKYNERFKG (SEQ ID NO: 26); HC CDR3 is SNPYVMDY (SEQ ID NO: 27); LC CDR1 is KASQSVNNDVA (SEQ ID NO: 28); LC CDR2 is YASNRFT (SEQ ID NO: 29); and LC CDR3 is QQAYRSPYT (SEQ ID NO: 30; (ii) a set of six CDRs wherein: HC CDR1 is AYNIH (SEQ ID NO: 9), HC CDR2 is YIYPNNGGSGYNQKFMN (SEQ ID NO: 10), HC CDR3 is FDYDEAWFIY (SEQ ID NO: 11), LC CDR1 is SASSSVSYMH (SEQ ID NO: 12), LC CDR2 is DTSKLAS (SEQ ID NO: 13), and LC CDR3 is FQGSGSPYT (SEQ ID NO: 14); and (iii) a set of six CDRs wherein: HC CDR1 is TYYIH (SEQ ID NO: 15), HC CDR2 is WIYPGNVNTKNNEKFKV (SEQ ID NO: 16), HC CDR3 is SNPYVMDY (SEQ ID NO: 17), LC CDR1 is KASQSVSNDVA (SEQ ID NO: 18), LC CDR2 is YASNRYT (SEQ ID NO: 19), and LC CDR3 is QQDYSSPYT (SEQ ID NO: 20).

    2. The method of claim 1 wherein the isolated monoclonal antibody or the antibody fragment comprises a heavy chain and a light chain, wherein the heavy chain comprises SEQ ID NO: 39 and the light chain comprises SEQ ID NO: 40.

    3. The method of claim 1 wherein the isolated monoclonal antibody or the antibody fragment comprises a heavy chain and a light chain, wherein the heavy chain comprises SEQ ID NO: 35 and the light chain comprises SEQ ID NO: 36.

    4. The method of claim 1, wherein the isolated monoclonal antibody or the antibody fragment comprises a heavy chain and a light chain, wherein the heavy chain comprises SEQ ID NO: 37 and the light chain comprises SEQ ID NO: 38.

    5. The method of claim 1, wherein the cancer is a solid cancer.

    6. The method of claim 1, wherein the cancer is a hematologic cancer.

    7. The method of claim 1, wherein the cancer is selected from the group consisting of a melanoma, a breast cancer, an ovarian cancer, a pancreatic cancer, a colorectal cancer, a colon cancer, a cervical cancer, a kidney cancer, a lung cancer, a thyroid cancer, a prostate cancer, a brain cancer, a renal cancer, a throat cancer, a laryngeal carcinoma, a bladder cancer, a hepatic cancer, a fibrosarcoma, an endometrial cells cancer, a glioblastoma, sarcoma, a myeloid, a leukemia and a lymphoma.

    8. The method of claim 1, wherein treating results in preventing or reducing metastases formation, growth or spread in a subject.

    9. The method of claim 1, further comprising an additional anti-cancer therapy selected from surgery, chemotherapy, radiotherapy, and immunotherapy.

    10. The method of claim 1, further comprising administering to said subject an additional immuno-modulator, an additional antibody-drug conjugate (ADC), activated lymphocyte cell, kinase inhibitor, chemotherapeutic agent or any other anti-cancer agent.

    11. The method of claim 10, wherein the additional immune-modulator is an antibody against an immune checkpoint molecule.

    12. The method of claim 1, wherein the antibody or fragment thereof inhibits the interaction between Nectin4 and Nectin1 on tumor cells.

    13. The method of claim 1, wherein the administering further comprising administering T-cell lymphocytes and/or natural killer (NK) cells.

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0232] FIG. 1A schematic illustration of the receptors involved in TIGIT signaling on immune (NK) and tumor cells. Anti nectin4 Ab is depicted.

    [0233] FIG. 2 Antibody clones hNec4.05 and hNec4.01 show the best blocking capability of TIGIT-Nectin4 interactions. The graph depicts the Mean Fluorescence Intensity (MFI) values of FACS staining of RAJI Burkitt's lymphoma cells transfected with Nectin4. The cells were incubated with 0.2 pg of different clones (as indicated) and then incubated with 3 pg of TIGIT-Ig followed by staining with an anti-human secondary antibody.

    [0234] FIG. 3 Quantification of the binding affinity of antibody clones to Nectin4. The binding of fluorophore-labeled Nectin4-Ig and the antibody clones hNec4.05 and clone hNec4.01 observed with microscale thermophoresis. Measurements were repeated with at least three independent protein preparations and average of results are shown (SEM.).

    [0235] FIGS. 4A and 4B Antibody clones hNec4.05 and hNec4.01 block Nectin4 and increase NK cytotoxicity. [.sup.35S]methionine-labelled (4A) RAJI Burkitt's lymphoma cells transfected with Nectin4 (4B) LNCap prostate carcinoma cells (naturally expressing Nectin4), were incubated with 1 pg/well of either mouse IgG1 as a control antibody, or anti-Nectin4 antibodies hNec4.01 or hNec4.05. After 1h the cells were supplemented with NK cells and incubated for 5 hours. The average specific killing (+s.d.) in various Effector: Target (E: T) ratios of the NK: cancer cells is plotted. * indicates significant effect (p<0.05) of the hNec4.01 and hNec4.05 clones in comparison to the control antibody. Figure shows one representative experiment out of three performed. The same effect was determined with MCF-7, MDA-MB-453, SK-BR-3 andT47D cells-all breast cancer cell lines.

    [0236] FIGS. 5A-5C Antibody clones do not bind murine Nectin4. (A) Western blots of RAJI cells transfected with murine Nectin4 (indicated as mNectin4) and detected with commercial anti-murine Nectin4 mAb (Clone 356704 which doesn't work for flow cytometry). Expression was compared to RAJI cells expressing empty vector (indicated as Empty). Staining for hGAPDH was used as loading control. (B-C) FACS staining of RAJI cells transfected with murine Nectin4 (black line histograms). Cells were stained with 0.2 pg of (B) clone hNec4.01 or (C) clone hNec4.05.

    [0237] FIGS. 6A-6C Blocking of Nectin4-Nectin1 interactions. (A-B) FACS staining of RAJI cells transfected with human-Nectin4. Cells were pre-incubated with 1 pg of (A) clone hNec4.01, or (B) clone hNec4.05 and then incubated with 3 pg of Nectin1-Ig (black line histograms). Staining without blocking appears as gray line. Grey filled histograms are background control staining of secondary antibody only. (C) Mean Fluorescence Intensity (MFI) values of FACS staining of A and B.

    [0238] FIGS. 7A-7C In vivo effect of anti-Nectin4 mAb. (A) SCID-beige mice were subcutaneously implanted with 510.sup.6 Raji cells that were either transfected with empty vector (EV) or over expressed (OE) nectin4, alone (left panel, no NK) or together with 110.sup.6 NK cells (right panel, NK). (B) SCID-beige mice were subcutaneously implanted with 510.sup.6 Raji cells over expressing nectin4 together with either 110.sup.6 NK cells. Mice were treated with 75 ug of either a control Ab or with anti Nectin4 clone hNec4.05 mAb, twice a week by intraperitoneal injection. (C) SCID-beige mice were subcutaneously implanted with 510.sup.6 MDA-MB-453 cells, alone or with 710.sup.5 NK cells. Mice were then treated as in (B). Tumors were harvested and weighed at day 21 (A), 27 (B), or 23 (C) post tumor injection. N=7 for all mice experimental groups. (*) p<0.05.

    [0239] FIGS. 8A-8C Antibody clones hNec4.05 and hNec4.11 binding to cell surface Nectin-4. (A) Antibody binding to Nectin-4 expressed on the human cell line MDA-MD-453 was evaluated by FACS analysis. Shown are the EC50 values that were calculated following titration of Ab binding (range of 20-0.01 nM), and the maximal binding signal for each clone. Of note, similar results were seen with a chimeric version of the Abs in which the murine lgG1 Fc was replaced with human Fc. (B) Antibody binding to CHO cells transfected with Cynomolgus (Cyno)-Nectin-4 and analyzed as in A. (C) Antibody binding to CHO cells transfected with murine-Nectin-4 and analyzed as in A. ND-not detected.

    [0240] FIGS. 9A-9D Antibody clones hNec4.05 and hNec4.11 block the binding of Nectin-4 to its ligands TIGIT and Nectin-1. Binding of Nectin-4 ligands was assessed by FACS analysis. CHO cells transfected with human-Nectin-4 were incubated with either human TIGIT-Ig (A & C) or with human Nectin-1-Ig (B & D), both at 20 ug/ml, with or without anti-Nectin-4 clone hNec4.05 (A & B) or clone hNec4.11 (C & D), both at 8 ug/ml. Robust binding inhibition by the anti-Nectin-4 Abs is seen in all cases. Remaining signal is likely due to ligand binding to other receptors expressed by CHO cells, such as PVR, which are not affected by the anti-Nectin-4 Abs.

    [0241] FIGS. 10A-10B Human lgG1 chimeric Ab clones hNec4.05 and hNec4.11 enhance NK cell activation in the presence of tumor cells. Human NK cells (effector, E) were incubated with the target cells (T) HT1376 (A) and MDA-MD-453 (B) at E: T ratio of 2:1. Incubation was done in the presence of 12 ug/ml chimeric clones hNec4.05 and hNec4.11 or a control hlgG1. After two hours, NK cells were assayed for their degranulation and activation status by FACS analysis of CD107a expression. Degranulation of NK cells in presence of control hlgG1 was set as 1 and fold induction was calculated accordingly. Shown are averages of 2-3 repeats and their normalized SDs.

    [0242] FIGS. 11A-11D CAR-T driven by hNec4.11 leads to specific T cell activation in the presence of tumor cells that express Nectin-4. (A) Schematic drawing of the CART construct. (B) Jurkat cells were transduced by lenti particles encoding for the construct and GFP. The transduction efficacy was above 99% as judged by FACS analysis of GFP expression. (C) Parental Jurkat cells or Jurkat cells expressing the CART construct (Jurkat pHAGE2.4.11) were incubated with the target cells HT1376 or MDA-MD-453 (MDA-453) for 48 hours after which media was collected and tested for IL-2 concentration as a way to assess Jurkat activation. The secretion of IL-2 was significantly induced by the CART expression (*=0.003, **=0.00014; two tailed student test). Shown is a representative experiment of the two performed. (D) PBMCs from healthy donor were transduced using the CART construct. The CART PBMCs were incubated with HT1376 cells through a range of E: Ts (indicated at the X axis). Killing of the target cells was significant where marked by asterisk (*** p<7*10-5).

    DETAILED DESCRIPTION OF THE INVENTION

    [0243] The present invention provides effective monoclonal antibodies specific to the human Nectin4. The invention also provides production and use of the mAbs as therapeutic agents. In particular, the mAbs of the present invention may be used for restoring and augmenting anti-tumor killing activity of immune cells, and as diagnostic reagents.

    [0244] While prior publication shows the use of an anti Nectin4 mAb for targeting a drug to tumor cells overexpressing Nectin4, the present invention discloses for the first time monoclonal antibodies that directly potentiate the immune system against tumor cells, by inhibiting the binding to Nectin4 to the inhibitory receptor TIGIT of immune cells such as NK cells.

    [0245] The antibodies of the present invention overcome the disadvantages of antibodies specific to TIGIT, which are currently tested for treatment of cancer. Anti-TIGIT antibodies may, allegedly, skew the entire immune system towards activation by blocking all immune cells expressing TIGIT receptor and cause, potentially, autoimmune effects, while the anti-Nectin4 antibodies of the present invention target only Nectin4 expressing cells which are known to be overexpressed in tumors.

    [0246] Furthermore, some of the antibodies of the present invention may also lead to an immune independent killing of tumor cells, potentially via their ability to block nectin4 interactions with nectin1.

    [0247] The term antigen as used herein refers to a molecule or a portion of a molecule capable of eliciting antibody formation and being specifically bound by an antibody. An antigen may have one or more than one epitope. The specific binding referred to above is meant to indicate that the antigen will react, in a highly selective manner, with its corresponding antibody and not with the multitude of other antibodies which may be evoked by other antigens. An antigen according to some embodiments of the present invention is a Nectin4 protein.

    [0248] The term Nectin4 or Nectin Cell Adhesion Molecule 4, as used herein refers to a single-pass type I membrane protein of 510 amino acids and a molecular mass of 55454 Da, also known as PVRL4; LNIR; PRR4; and EDSS1. The Nectin4 protein contains two immunoglobulin-like (lg-like) C2-type domains and one Ig-like V-type domain. It is involved in cell adhesion through trans-homophilic and -heterophilic interactions. The soluble form is produced by proteolytic cleavage at the cell surface by the metalloproteinase ADAM17/TACE and the secreted form is found in both breast tumor cell lines and breast tumor patients. An exemplary Nectin4 according to the invention is set forth in SwissPort, UniPort and GenBank symbols or accession numbers: Q96NY8-NECT4_HUMAN; Q96NY8; B4DQW3; Q96K15; Q96NY8-1; Q96NY8-2; ENSP00000356991; NP_112178.2; XP_005245565.1; XP_011508323.1; XP_011508324.1; or XP_011508325.1.

    [0249] The antibodies or a fragment thereof according to the invention binds to an epitope in Nectin4. Specifically, the antibodies bind to an epitope within the ectodomain (extracellular part) of the Nectin4 protein sequence.

    [0250] The term antigenic determinant or epitope as used herein refers to the region of an antigen molecule that specifically reacts with a particular antibody. Peptide sequences derived from an epitope can be used, alone or in conjunction with a carrier moiety, applying methods known in the art, to immunize animals and to produce additional polyclonal or monoclonal antibodies. Isolated peptides derived from an epitope may be used in diagnostic methods to detect antibodies.

    [0251] It should be noted that the affinity can be quantified using known methods such as, Surface Plasmon Resonance (SPR) (described in Scarano S, Mascini M, Turner A P, Minunni M. Surface plasmon resonance imaging for affinity-based biosensors. Biosens Bioelectron. 2010, 25:957-66), and can be calculated using, e.g., a dissociation constant, Kd, such that a lower Kd reflects a higher affinity.

    [0252] Antibodies, or immunoglobulins, comprise two heavy chains linked together by disulfide bonds and two light chains, each light chain being linked to a respective heavy chain by disulfide bonds in a Y shaped configuration. Proteolytic digestion of an antibody yields Fv (Fragment variable) and Fc (Fragment crystalline) domains. The antigen binding domains, Fab, include regions where the polypeptide sequence varies. The term F (ab) 2 represents two Fab arms linked together by disulfide bonds. The central axis of the antibody is termed the Fc fragment. Each heavy chain has at one end a variable domain (V.sub.H) followed by a number of constant domains (C.sub.H). Each light chain has a variable domain (V.sub.L) at one end and a constant domain (C.sub.L) at its other end, the light chain variable domain being aligned with the variable domain of the heavy chain and the light chain constant domain being aligned with the first constant domain of the heavy chain (CH1). The variable domains of each pair of light and heavy chains form the antigen-binding site. The domains on the light and heavy chains have the same general structure and each domain comprises four framework regions, whose sequences are relatively conserved, joined by three hyper-variable domains known as complementarity determining regions (CDRs 1-3). These domains contribute specificity and affinity of the antigen-binding site.

    [0253] CDR identification or determination from a given heavy or light chain variable sequence, is typically made using one of few methods known in the art. For example, such determination is made according to the Kabat (Wu T. T and Kabat E. A., J Exp Med, 1970; 132:211-50) and IMGT (Lefranc M-P, et al., Dev Comp Immunol, 2003, 27:55-77).

    [0254] When the term CDR having a sequence, or a similar term is used, it includes options wherein the CDR comprises the specified sequences and also options wherein the CDR consists of the specified sequence.

    [0255] The antigen specificity of an antibody is based on the hyper variable region (HVR), namely the unique CDR sequences of both light and heavy chains that together form the antigen-binding site.

    [0256] The isotype of the heavy chain (gamma, alpha, delta, epsilon or mu) determines immunoglobulin class (IgG, IgA, IgD, IgE or IgM, respectively). The light chain is either of two isotypes (kappa, k or lambda, A). Both isotopes are found in all antibody classes.

    [0257] The term antibody is used in the broadest sense and includes monoclonal antibodies (including full length or intact monoclonal antibodies), polyclonal antibodies, multivalent antibodies, and antibody fragments long enough to exhibit the desired biological activity, namely binding to human Nectin4.

    [0258] Antibody or antibodies according to the invention include intact antibodies, such as polyclonal antibodies or monoclonal antibodies (mAbs), as well as proteolytic fragments thereof, such as the Fab or F (ab) 2 fragments. Single chain antibodies also fall within the scope of the present invention.

    Antibody Fragments

    [0259] Antibody fragments comprise only a portion of an intact antibody, generally including an antigen binding site of the intact antibody and thus retaining the ability to bind antigen. Examples of antibody fragments encompassed by the present definition include: (i) the Fab fragment, having VL, CL, VH and CH1 domains; (ii) the Fab fragment, which is a Fab fragment having one or more cysteine residues at the C-terminus of the CH1 domain; (iii) the Fd fragment having VH and CH1 domains; (iv) the Fd fragment having VH and CH1 domains and one or more cysteine residues at the C-terminus of the CH1 domain; (v) the Fv fragment having the VL and VH domains of a single arm of an antibody; (vi) the dAb fragment (Ward et al., Nature 1989, 341, 544-546) which consists of a VH domain; (vii) isolated CDR regions; (viii) F (ab) 2 fragments, a bivalent fragment including two Fab fragments linked by a disulphide bridge at the hinge region; (ix) single chain antibody molecules (e.g. single chain Fv; scFv) (Bird et al., Science 1988, 242, 423-426; and Huston et al., Proc. Natl. Acad. Sci. (USA) 1988, 85,5879-5883); (x) diabodies with two antigen binding sites, comprising a heavy chain variable domain (VH) connected to a light chain variable domain (VL) in the same polypeptide chain (see, e.g., EP 404,097; WO 93/11161; and Hollinger et al., Proc. Natl. Acad. Sci. USA, 1993, 90, 6444-6448); (xi) linear antibodies comprising a pair of tandem Fd segments (VH-CH1-VH-CH1) which, together with complementary light chain polypeptides, form a pair of antigen binding regions (Zapata et al. Protein Eng., 1995, 8, 1057-1062; and U.S. Pat. No. 5,641,870).

    [0260] Various techniques have been developed for the production of antibody fragments. Traditionally, these fragments were derived via proteolytic digestion of intact antibodies (see, e.g., Morimoto et al., Journal of Biochemical and Biophysical Methods 24:107-117 (1992) and Brennan et al., Science, 229:81 (1985)). However, these fragments can now be produced directly by recombinant host cells. For example, the antibody fragments can be isolated from antibody phage libraries. Alternatively, Fab-SH fragments can be directly recovered from E. coli and chemically coupled to form F (ab) 2 fragments (Carter et al., Bio/Technology 10:163-167 (1992)). According to another approach, F (ab) 2 fragments can be isolated directly from recombinant host cell culture. Other techniques for the production of antibody fragments will be apparent to the skilled practitioner. In other embodiments, the antibody of choice is a single chain Fv fragment (scFv).

    [0261] Single chain antibodies can be single chain composite polypeptides having antigen binding capabilities and comprising amino acid sequences homologous or analogous to the variable regions of an immunoglobulin light and heavy chain i.e. linked V.sub.H-V.sub.L or single chain Fv (scFv). Techniques for the production of single-chain antibodies (U.S. Pat. No. 4,946,778) can be adapted to produce single-chain antibodies to Nectin4.

    [0262] The term monoclonal antibody (mAb) as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts. Monoclonal antibodies are highly specific, being directed against a single antigen. Furthermore, in contrast to polyclonal antibody preparations that typically include different antibodies directed against different determinants (epitopes), each monoclonal antibody is directed against a single determinant on the antigen. The modifier monoclonal is not to be construed as requiring production of the antibody by any particular method. mAbs may be obtained by methods known to those skilled in the art. For example, the monoclonal antibodies to be used in accordance with the present invention may be made by the hybridoma method first described by Kohler et al., Nature 1975, 256, 495, or may be made by recombinant DNA methods (see, e.g., U.S. Pat. No. 4,816,567). Monoclonal antibodies may also be isolated from phage antibody libraries using the techniques described, for example, in Clackson et al., Nature 1991, 352, 624-628 or Marks et al., J. Mol. Biol., 1991, 222:581-597.

    [0263] The design and development of recombinant monovalent antigen-binding molecules derived from monoclonal antibodies through rapid identification and cloning of the functional variable heavy (VH) and variable light (VL) genes and the design and cloning of a synthetic DNA sequence optimized for expression in recombinant bacteria are described in Fields et at. 2013, 8 (6): 1125-48.

    [0264] The mAbs of the present invention may be of any immunoglobulin class including IgG, IgM, IgE, IgA, and IgD. A hybridoma producing a mAb may be cultivated in-vitro or in-vivo. High titers of mAbs can be obtained by in-vivo production where cells from the individual hybridomas are injected intra-peritoneally into pristine-primed Balb/c mice to produce ascites fluid containing high concentrations of the desired mAbs. mAbs may be purified from such ascites fluids, or from culture supernatants, using methods well known to those of skill in the art.

    [0265] Anti-idiotype antibodies specifically immunoreactive with the hypervariable regions of an antibody of the invention are also comprehended.

    [0266] The invention provides a monoclonal antibody or an antibody fragment comprising an antigen binding domain (ABD) which comprises three CDRs of a light chain and three CDRs of a heavy chain, wherein said ABD has at least 90% sequence identity or similarity with an ABD of a monoclonal mouse antibody comprising: (i) a heavy variable chain comprising the amino acid sequence SEQ ID NO: 39 and a light variable chain comprising the amino acid sequence SEQ ID NO: 40 (herein identified as hNec4.11); (i) a heavy variable chain comprising the amino acid sequence SEQ ID NO: 35 and a light variable chain comprising the amino acid sequence SEQ ID NO: 36 (herein identified as hNec4.01); or (ii) a heavy variable chain comprising the amino acid sequence SEQ ID NO: 37 and a light variable chain comprising the amino acid sequence SEQ ID NO: 38 (herein identified as hNec4.05). Such antibody may have an ABD domain having at least 93%, at least 94%, at least 95%, at least 96, at least 97, at least 98, at least 99% sequence identity or similarity or 100% sequence identity with corresponding ABD of antibodies hNec4.11, hNec4.01 or hNec4.05.

    [0267] Sequence identity is the amount of amino acids or nucleotides which match exactly between two different sequences. Sequence similarity permits conservative substitution of amino acids to be determined as identical amino acids.

    [0268] The invention also provides conservative amino acid variants of the antibody molecules according to the invention. Variants according to the invention also may be made that conserve the overall molecular structure of the encoded proteins. Given the properties of the individual amino acids comprising the disclosed protein products, some rational substitutions will be recognized by the skilled worker. Amino acid substitutions, i.e., conservative substitutions, may be made, for instance, on the basis of similarity in polarity, charge, solubility, hydrophobicity, hydrophilicity, and/or the amphipathic nature of the residues involved. The term antibody analog as used herein refers to an antibody derived from another antibody by one or more conservative amino acid substitutions.

    [0269] The term antibody variant as used herein refers to any molecule comprising the antibody of the present invention. For example, fusion proteins in which the antibody or an antigen-binding-fragment thereof is linked to another chemical entity is considered an antibody variant.

    [0270] Analogs and variants of the antibody sequences are also within the scope of the present application. These include, but are not limited to, conservative and non-conservative substitution, insertion and deletion of amino acids within the sequence. Such modification and the resultant antibody analog or variant are within the scope of the present invention as long as they confer, or even improve the binding of the antibody to the human Nectin4.

    [0271] Conservative substitutions of amino acids as known to those skilled in the art are within the scope of the present invention. Conservative amino acid substitutions include replacement of one amino acid with another having the same type of functional group or side chain, e.g., aliphatic, aromatic, positively charged, negatively charged. These substitutions may enhance oral bioavailability, penetration, and targeting to specific cell populations, immunogenicity, and the like. One of skill will recognize that individual substitutions, deletions or additions to a peptide, polypeptide, or protein sequence which alters, adds or deletes a single amino acid or a small percentage of amino acids in the encoded sequence is a conservatively modified variant where the alteration results in the substitution of an amino acid with a chemically similar amino acid. Conservative substitution tables providing functionally similar amino acids are well known in the art. For example, according to one table known in the art, the following six groups each contain amino acids that are conservative substitutions for one another: [0272] 1) Alanine (A), Serine(S), Threonine (T); [0273] 2) Aspartic acid (D), Glutamic acid (E); [0274] 3) Asparagine (N), Glutamine (Q); [0275] 4) Arginine (R), Lysine (K); [0276] 5) Isoleucine (I), Leucine (L), Methionine (M), Valine (V); and [0277] 6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W).

    [0278] It should be emphasized that the variant chain sequences are determined by sequencing methods using specific primers. Different sequencing methods employed on the same sequence may result in slightly different sequences due to technical issues and different primers, particularly in the sequence terminals. Therefore, different variants of the anti-Nectin4 variable chain sequences are specified along the application.

    [0279] The terms molecule having the antigen-binding portion of an antibody and antigen-binding-fragments as used herein are intended to include not only intact immunoglobulin molecules of any isotype and generated by any animal cell line or microorganism, but also the antigen-binding reactive fraction thereof, including, but not limited to, the Fab fragment, the Fab fragment, the F (ab) 2 fragment, the variable portion of the heavy and/or light chains thereof, Fab mini-antibodies (see e.g., WO 93/15210, U.S. patent application Ser. No. 08/256,790, WO 96/13583, U.S. patent application Ser. No. 08/817,788, WO 96/37621, U.S. patent application Ser. No. 08/999,554), and single-chain antibodies incorporating such reactive fraction, as well as any other type of molecule in which such antibody reactive fraction has been physically inserted. Such molecules may be provided by any known technique, including, but not limited to, enzymatic cleavage, peptide synthesis or recombinant techniques.

    [0280] The monoclonal antibodies herein specifically include chimeric antibodies in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species, or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity (U.S. Pat. No. 4,816,567; and Morrison et al., Proc. Natl. Acad. Sci. USA 81:6851-6855 (1984)). In addition, complementarity determining region (CDR) grafting may be performed to alter certain properties of the antibody molecule including affinity or specificity. A non-limiting example of CDR grafting is disclosed in U.S. Pat. No. 5,225,539.

    [0281] Chimeric antibodies are molecules of which different portions are derived from different animal species, such as those having a variable region derived from a murine mAb and a human immunoglobulin constant region. Antibodies that have variable region framework residues substantially from human antibody (termed an acceptor antibody) and CDRs substantially from a mouse antibody (termed a donor antibody) are also referred to as humanized antibodies. Chimeric antibodies are primarily used to reduce immunogenicity in application and to increase yields in production, for example, where murine mAbs have higher yields from hybridomas but higher immunogenicity in humans, such that human/murine chimeric mAbs are used. Chimeric antibodies and methods for their production are known in the art (for example PCT patent applications WO 86/01533, WO 97/02671, WO 90/07861, WO 92/22653 and U.S. Pat. Nos. 5,693,762, 5,693,761, 5,585,089, 5,530,101 and 5,225,539).

    [0282] According to some specific embodiments, the monoclonal antibody is a chimeric monoclonal antibody.

    [0283] According to some embodiments, the chimeric antibody comprises human-derived constant regions.

    [0284] According to some embodiments the human constant regions of the chimeric antibody are selected from the group consisting of: human lgG1, human lgG2, human lgG3, and human lgG4.

    [0285] According to a particular embodiment, a chimeric monoclonal antibody which recognizes human Nectin4 is provided comprising: [0286] i. a set of six CDRs wherein: HC CDR1 is (SEQ ID NO: 25); HC CDR2 is (SEQ ID NO: 26); HC CDR3 is (SEQ ID NO: 27); LC CDR1 is (SEQ ID NO: 28); LC CDR2 is (SEQ ID NO: 29); and LC CDR3 is (SEQ ID NO: 30); [0287] ii. a set of six CDRs wherein: HC CDR1 is (SEQ ID NO: 9); HC CDR2 is (SEQ ID NO: 10); HC CDR3 is (SEQ ID NO: 11); LC CDR1 is (SEQ ID NO: 12); LC CDR2 is (SEQ ID NO: 13); and LC CDR3 is (SEQ ID NO: 14); or [0288] iii. a set of six CDRs wherein: HC CDR1 sequence is (SEQ ID NO: 15); HC CDR2 is (SEQ ID NO: 16); HC CDR3 is (SEQ ID NO: 17); LC CDR1 is (SEQ ID NO: 18); LC CDR2 is (SEQ ID NO: 19); and LC CDR3 is (SEQ ID NO: 20).

    [0289] According to an aspect, the present invention provides a CAR comprising an antibody fragment that bind specifically to Nectin4.

    [0290] According to some embodiments, the CAR comprises: i) a specific binding agent that can specifically bind to nectin4; ii) a spacer or hinge domain; iii) a trans-membrane domain that anchor the CAR within the T cell membrane; iv) an endodomain which transmits signals within the T cell.

    [0291] According to some embodiments, the CAR comprises a CDR set selected from the group consisting of: [0292] i. a set of six CDRs wherein: HC CDR1 is SYYIH (SEQ ID NO: 25); HC CDR2 is WIYPGNVNTKYNERFKG (SEQ ID NO: 26); HC CDR3 is SNPYVMDY (SEQ ID NO: 27); LC CDR1 is KASQSVNNDVA (SEQ ID NO: 28); LC CDR2 is YASNRFT (SEQ ID NO: 29); and LC CDR3 is QQAYRSPYT (SEQ ID NO: 30); [0293] ii. a set of six CDRs wherein: HC CDR1 is AYNIH (SEQ ID NO: 9); HC CDR2 is YIYPNNGGSGYNQKFMN (SEQ ID NO: 10); HC CDR3 is FDYDEAWFIY (SEQ ID NO: 11); LC CDR1 is SASSSVSYMH (SEQ ID NO: 12); LC CDR2 is DTSKLAS (SEQ ID NO: 13); and LC CDR3 is FQGSGSPYT (SEQ ID NO: 14); and [0294] iii. a set of six CDRs wherein: HC CDR1 sequence is TYYIH (SEQ ID NO: 15); HC CDR2 is WIYPGNVNTKNNEKFKV (SEQ ID NO: 16); HC CDR3 is SNPYVMDY (SEQ ID NO: 17); LC CDR1 is KASQSVSNDVA (SEQ ID NO: 18); LC CDR2 is YASNRYT (SEQ ID NO: 19); and LC CDR3 is QQDYSSPYT (SEQ ID NO: 20).

    [0295] According to an aspect, the present invention provides an isolated nucleic acid molecule encoding a CAR comprising an antibody or antibody fragment which includes Nectin4 binding domain comprising a CDR set selected from the group consisting of: [0296] i. a set of six CDRs wherein: HC CDR1 is SYYIH (SEQ ID NO: 25); HC CDR2 is WIYPGNVNTKYNERFKG (SEQ ID NO: 26); HC CDR3 is SNPYVMDY (SEQ ID NO: 27); LC CDR1 is KASQSVNNDVA (SEQ ID NO: 28); LC CDR2 is YASNRFT (SEQ ID NO: 29); and LC CDR3 is QQAYRSPYT (SEQ ID NO: 30); [0297] ii. a set of six CDRs wherein: HC CDR1 is AYNIH (SEQ ID NO: 9); HC CDR2 is YIYPNNGGSGYNQKFMN (SEQ ID NO: 10); HC CDR3 is FDYDEAWFIY (SEQ ID NO: 11); LC CDR1 is SASSSVSYMH (SEQ ID NO: 12); LC CDR2 is DTSKLAS (SEQ ID NO: 13); and LC CDR3 is FQGSGSPYT (SEQ ID NO: 14); and [0298] iii. a set of six CDRs wherein: HC CDR1 sequence is TYYIH (SEQ ID NO: 15); HC CDR2 is WIYPGNVNTKNNEKFKV (SEQ ID NO: 16); HC CDR3 is SNPYVMDY (SEQ ID NO: 17); LC CDR1 is KASQSVSNDVA (SEQ ID NO: 18); LC CDR2 is YASNRYT (SEQ ID NO: 19); and LC CDR3 is QQDYSSPYT (SEQ ID NO: 20).

    [0299] According to some embodiments, a vector comprises a polynucleotide sequence set forth in SEQ ID NO: 31 or SEQ ID NO: 33 is provided. According to certain embodiments the vector is a viral vector. According to certain embodiments the viral vector is a lentiviral vector.

    [0300] According to some embodiments, a T cell engineered to express the CAR described herein is provided.

    [0301] With respect to the transmembrane domain, in various embodiments, a CAR can be designed to comprise a transmembrane domain that is attached to the extracellular domain of the CAR. A transmembrane domain can include one or more additional amino acids adjacent to the transmembrane region, e.g., one or more amino acid associated with the extracellular region of the protein from which the transmembrane was derived (e.g., 1, 2, 3, 4, 5, or more amino acids of the extracellular region) and/or one or more additional amino acids associated with the intracellular region of the protein from which the transmembrane protein is derived (e.g., 1, 2, 3, 4, 5, or more amino acids of the intracellular region). According to some embodiments, the transmembrane domain can be selected or modified by amino acid substitution to avoid binding of such domains to the transmembrane domains of the same or different surface membrane proteins, e.g., to minimize interactions with other members of the receptor complex.

    [0302] According to some embodiments, the trans membrane domain is a trans membrane domain of a protein selected from the group consisting of the alpha, beta or zeta chain of the T-cell receptor, CD27, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137 and CD154. Each possibility represents a separate embodiment of the invention.

    [0303] According to some embodiments, the antibody or antibody fragment which includes Nectin4 binding domain is connected to the transmembrane domain by a hinge region. According to some embodiments, the hinge is from a human protein. According to some embodiments, the hinge is a human Ig (immunoglobulin) hinge. According to certain embodiments, the hinge is an lgG4 hinge or a CD8a hinge.

    [0304] The cytoplasmic domain or region of the CAR includes an intracellular signaling domain. An intracellular signaling domain is generally responsible for activation of at least one of the normal effector functions of the immune cell in which the CAR has been introduced. The term effector function refers to a specialized function of a cell. Effector function of a T cell, for example, may be cytolytic activity or helper activity including the secretion of cytokines. Thus, the term intracellular signaling domain refers to the portion of a protein which transduces the effector function signal and directs the cell to perform a specialized function. The term intracellular signaling domain is meant to include any truncated portion of the intracellular signaling domain sufficient to transduce the effector function signal. Examples of intracellular signaling domains for use in the CAR of the invention include the cytoplasmic sequences of the T cell receptor (TCR) and co-receptors that act in concert to initiate signal transduction following antigen receptor engagement, as well as any derivative or variant of these sequences and any recombinant sequence that has the same functional capability.

    [0305] In some embodiments, signals generated through the TCR alone are insufficient for full activation of the T cell and that a secondary and/or costimulatory signal is also required. Thus, T cell activation can be said to be mediated by two distinct classes of cytoplasmic signaling sequences: those that initiate antigen-dependent primary activation through the TCR (primary intracellular signaling domains) and those that act in an antigen-independent manner to provide a secondary or costimulatory signal (secondary cytoplasmic domain, e.g., a costimulatory domain).

    [0306] According to some embodiments, the intracellular signaling domain is designed to comprise two or more, costimulatory signaling domains. According to some embodiments, the two or more costimulatory signaling domains, are separated by a linker molecule. According to some embodiments, the linker molecule is a glycine residue. According to some embodiments, the linker is an alanine residue.

    [0307] According to some embodiments, the CAR comprises a costimulatory domain obtained from a protein selected from the group consisting of OX40, CD2, CD27, CD28, CDS, ICAM-1, LFA-1 (CD11a/CD18), ICOS (CD278), and 4-1BB (CD137). Each possibility represents a separate embodiment of the invention.

    [0308] The invention also relates to nucleic acid molecules encoding the CARS, together with vectors and host cells. The invention also relates to a (heterologous) T cell comprising a CAR of the invention, together with pharmaceutical compositions comprising such CARs together with a suitable carrier or excipient. The invention also relates to autologous T cell therapies incorporating the T cells, compositions and CARs of the invention (and corresponding medical uses).

    [0309] According to some embodiments, the CAR-expressing cell described herein can further comprise a second CAR, e.g., a second CAR that includes a different antigen binding domain, e.g., to the same target (Nectin4) or a different target. According to some embodiments, when the CAR-expressing cell comprises two or more different CARS, the antigen binding domains of the different CARs can be such that the antigen binding domains do not interact with one another.

    [0310] According to some embodiments, a population of cells wherein at least one cell in the population expresses a CAR having an anti-Nectin4 domain described herein, and a second cell expressing another agent, e.g., an agent which enhances the activity of a CAR-expressing cell, is provided.

    [0311] The invention also relates to a (heterologous) NK cell comprising a CAR of the invention, together with pharmaceutical compositions comprising such CARs together with a suitable carrier or excipient. The invention also relates to autologous NK cell therapies incorporating the NK cells, compositions and CARs of the invention (and corresponding medical uses).

    [0312] As used herein, chimeric antigen receptor or CAR refers to an artificially constructed hybrid polypeptide comprising an antigen-binding domain (e.g., an antigen-binding portion of an antibody (e.g., a scFV)), a transmembrane domain, and a T-cell or NK-cell signaling and/or T-cell or NK-cell activation domain. CARs have the ability to redirect T-cell or NK-cell specificity and reactivity toward a selected target in a non-MHC-restricted manner, exploiting the antigen-binding properties of monoclonal antibodies. The non-MHC-restricted antigen recognition gives T-cells or NK-cells expressing CARs the ability to recognize an antigen independent of antigen processing, thus bypassing a major mechanism of tumor escape. Most commonly, the CAR's extracellular binding domain is composed of a single chain variable fragment (scFv) derived from fusing the variable heavy and light regions of a murine or humanized monoclonal antibody.

    Pharmacology

    [0313] In pharmaceutical and medicament formulations, the active agent is preferably utilized together with one or more pharmaceutically acceptable carrier(s) and optionally any other therapeutic ingredients. The carrier(s) must be pharmaceutically acceptable in the sense of being compatible with the other ingredients of the formulation and not unduly deleterious to the recipient thereof. The active agent is provided in an amount effective to achieve the desired pharmacological effect, as described above, and in a quantity appropriate to achieve the desired exposure.

    [0314] Typically, the antibodies and fragments and conjugates thereof of the present invention comprising the antigen binding portion of an antibody or comprising another polypeptide including a peptide-mimetic will be suspended in a sterile saline solution for therapeutic uses. The pharmaceutical compositions may alternatively be formulated to control release of active ingredient (molecule comprising the antigen binding portion of an antibody) or to prolong its presence in a patient's system. Numerous suitable drug delivery systems are known and include, e.g., implantable drug release systems, hydrogels, hydroxymethylcellulose, microcapsules, liposomes, microemulsions, microspheres, and the like. Controlled release preparations can be prepared through the use of polymers to complex or adsorb the molecule according to the present invention. For example, biocompatible polymers include matrices of poly (ethylene-co-vinyl acetate) and matrices of a polyanhydride copolymer of a stearic acid dimer and sebaric acid. The rate of release of the molecule according to the present invention, i.e., of an antibody or antibody fragment, from such a matrix depends upon the molecular weight of the molecule, the amount of the molecule within the matrix, and the size of dispersed particles.

    [0315] The pharmaceutical composition of this invention may be administered by any suitable means, such as orally, topically, intranasally, subcutaneously, intramuscularly, intravenously, intra-arterially, intraarticulary, intralesionally, intratumorally or parenterally. Ordinarily, intravenous (i.v.) administration is used for delivering antibodies.

    [0316] It will be apparent to those of ordinary skill in the art that the therapeutically effective amount of the molecule according to the present invention will depend, inter alia upon the administration schedule, the unit dose of molecule administered, whether the molecule is administered in combination with other therapeutic agents, the immune status and health of the patient, the therapeutic activity of the molecule administered, its persistence in the blood circulation, and the judgment of the treating physician.

    [0317] As used herein the term therapeutically effective amount refers to an amount of a drug effective to treat a disease or disorder in a mammal. In the case of cancer, the therapeutically effective amount of the drug may reduce the number of cancer cells; reduce the tumor size; inhibit (i.e., slow to some extent and preferably stop) cancer cell infiltration into peripheral organs; inhibit (i.e., slow to some extent and preferably stop) tumor metastasis; inhibit, to some extent, tumor growth; and/or relieve to some extent one or more of the symptoms associated with the disorder. To the extent the drug may prevent growth and/or kill existing cancer cells, it may be cytostatic and/or cytotoxic. For cancer therapy, efficacy in vivo can, for example, be measured by assessing the duration of survival, time to disease progression (TTP), the response rates (RR), duration of response, and/or quality of life.

    [0318] The cancer amendable for treatment by the present invention includes, but is not limited to: carcinoma, lymphoma, blastoma, sarcoma, and leukemia or lymphoid malignancies. More particular examples of such cancers include squamous cell cancer, lung cancer (including small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung, and squamous carcinoma of the lung), cancer of the peritoneum, hepatocellular cancer, gastric or stomach cancer (including gastrointestinal cancer), pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma, breast cancer, colon cancer, colorectal cancer, endometrial or uterine carcinoma, salivary gland carcinoma, kidney or renal cancer, liver cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma and various types of head and neck cancer, as well as B-cell lymphoma (including low grade/follicular non-Hodgkin's lymphoma (NHL); small lymphocytic (SL) NHL; intermediate grade/follicular NHL; intermediate grade diffuse NHL; high-grade immunoblastic NHL; high-grade lymphoblastic NHL; high-grade small non-cleaved cell NHL; bulky disease NHL; mantle cell lymphoma; AIDS-related Waldenstrom's Macroglobulinemia); chronic lymphocytic leukemia (CLL); acute lymphoblastic leukemia (ALL); Hairy cell leukemia; chronic myeloblastic leukemia; and post-transplant lymphoproliferative disorder (PTLD), as well as abnormal vascular proliferation associated with phakomatoses, edema (such as that associated with brain tumors), and Meigs' syndrome. Preferably, the cancer is selected from the group consisting of breast cancer, colorectal cancer, rectal cancer, non-small cell lung cancer, non-Hodgkins lymphoma (NHL), renal cell cancer, prostate cancer, liver cancer, pancreatic cancer, soft-tissue sarcoma, Kaposi's sarcoma, carcinoid carcinoma, head and neck cancer, melanoma, ovarian cancer, mesothelioma, and multiple myeloma. The cancerous conditions amendable for treatment of the invention include metastatic cancers.

    [0319] According to other embodiments, the pharmaceutical composition according to the invention are for use in treating cancer characterized by overexpression of Nectin4. Nectin4 overexpression related cancer types can be identified using known data bases such as The Cancer Genome Atlas (TCGA). According to certain embodiments, the cancer treatable with a composition according to the present invention is selected from the group consisting of adrenocortical carcinoma (ACC), chromophobe renal cell carcinoma (KICH), liver hepatocellular carcinoma (LIHC), colon and rectal adenocarcinoma (COAD, READ), pancreatic ductal adenocarcinoma (PAAD), pheochromocytoma & paraganglioma (PCPG), papillary kidney carcinoma (KIRP), lung adenocarcinoma (LUAD), head and neck squamous cell carcinoma (HNSC), prostate adenocarcinoma (PRAD), uterine corpus endometrial carcinoma (UCEC), cervical cancer (CESC), cutaneous melanoma (SKCM), mesothelioma (MESO), urothelial bladder cancer (BLCA), clear cell kidney carcinoma (KIRC), lung squamous cell carcinoma (LUSC), uterine carcinosarcoma (UCS), sarcoma (SARC), ovarian serous cystadenocarcinoma (OV), papillary thyroid carcinoma (THCA), glioblastoma multiforme (GBM), breast cancer (BRCA), lower grade glioma (LGG), and diffuse large B-cell lymphoma (DLBC). Each possibility represents a separate embodiment of the invention.

    [0320] The molecules of the present invention as active ingredients are dissolved, dispersed or admixed in an excipient that is pharmaceutically acceptable and compatible with the active ingredient as is well known. Suitable excipients are, for example, water, saline, phosphate buffered saline (PBS), dextrose, glycerol, ethanol, or the like and combinations thereof. Other suitable carriers are well known to those skilled in the art. In addition, if desired, the composition can contain minor amounts of auxiliary substances such as wetting or emulsifying agents, pH buffering agents.

    [0321] The pharmaceutical composition according to the present invention may be administered together with an anti-neoplastic composition.

    [0322] The term treatment as used herein refers to both therapeutic treatment and prophylactic or preventative measures. Those in need of treatment include those already with the disorder as well as those in which the disorder is to be prevented.

    [0323] The terms cancer and cancerous refer to or describe the physiological condition in mammals that is typically characterized by unregulated cell growth. Examples of cancer include but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia. More particular examples of such cancers include melanoma, lung, thyroid, breast, colon, prostate, hepatic, bladder, renal, cervical, pancreatic, leukemia, lymphoma, myeloid, ovarian, uterus, sarcoma, biliary, or endometrial cancer.

    [0324] According to some embodiments, the method of treating cancer comprises administering the pharmaceutical composition as part of a treatment regimen comprising administration of at least one additional anti-cancer agent.

    [0325] According to some embodiments, the anti-cancer agent is selected from the group consisting of an antimetabolite, a mitotic inhibitor, a taxane, a topoisomerase inhibitor, a topoisomerase II inhibitor, an asparaginase, an alkylating agent, an antitumor antibiotic, and combinations thereof. Each possibility represents a separate embodiment of the invention.

    [0326] According to some embodiments, the antimetabolite is selected from the group consisting of cytarabine, gludarabine, fluorouracil, mercaptopurine, methotrexate, thioguanine, gemcitabine, and hydroxyurea. According to some embodiments, the mitotic inhibitor is selected from the group consisting of vincristine, vinblastine, and vinorelbine. According to some embodiments, the topoisomerase inhibitor is selected from the group consisting of topotecan and irenotecan. According to some embodiments, the alkylating agent is selected from the group consisting of busulfan, carmustine, lomustine, chlorambucil, cyclophosphamide, cisplatin, carboplatin, ifosamide, mechlorethamine, melphalan, thiotepa, dacarbazine, and procarbazine. According to some embodiments, the antitumor antibiotic is selected from the group consisting of bleomycin, dactinomycin, daunorubicin, doxorubicin, idarubicin, mitomycin, mitoxantrone, and plicamycin. According to some embodiments, the topoisomerase II is selected from the group consisting of etoposide and teniposide. Each possibility represents a separate embodiment of the present invention.

    [0327] According to some particular embodiments, the additional anti-cancer agent is selected from the group consisting of bevacizumab, carboplatin, cyclophosphamide, doxorubicin hydrochloride, gemcitabine hydrochloride, topotecan hydrochloride, thiotepa, and combinations thereof. Each possibility represents a separate embodiment of the present invention.

    [0328] Monoclonal antibodies according to the present invention may be used as part of combined therapy with at least one anti-cancer agent. According to some embodiments, the additional anti-cancer agent is an immuno-modulator, an activated lymphocyte cell, a kinase inhibitor or a chemotherapeutic agent.

    [0329] According to some embodiments, the anti-cancer agent is an immuno-modulator, whether agonist or antagonist, such as antibody against an immune checkpoint molecule.

    [0330] Checkpoint immunotherapy blockade has proven to be an exciting new venue of cancer treatment. Immune checkpoint pathways consist of a range of co-stimulatory and inhibitory molecules which work in concert in order to maintain self-tolerance and protect tissues from damage by the immune system under physiological conditions. Tumors take advantage of certain checkpoint pathways in order to evade the immune system. Therefore, the inhibition of such pathways has emerged as a promising anti-cancer treatment strategy.

    [0331] The anti-cytotoxic T lymphocyte 4 (CTLA-4) antibody ipilimumab (approved in 2011) was the first immunotherapeutic agent that showed a benefit for the treatment of cancer patients. The antibody interferes with inhibitory signals during antigen presentation to T cells. Anti-programmed cell death 1 (PD-1) antibody pembrolizumab (approved in 2014) blocks negative immune regulatory signaling of the PD-1 receptor expressed by T cells. An additional anti-PD-1 agent was filed for regulatory approval in 2014 for the treatment of non-small cell lung cancer (NSCLC). Active research is currently exploring many other immune checkpoints, among them: CEACAM1, NKG2A, B7-H3, B7-H4, VISTA, CD112R, lymphocyte activation gene 3 (LAG3), CD137, OX40 (also referred to as CD134), and killer cell immunoglobulin-like receptors (KIR).

    [0332] According to some specific embodiments, the immuno-modulator is selected from the group consisting of: an antibody inhibiting CTLA-4, an anti-human programmed cell death protein 1 (PD-1), PD-L1 and PD-L2 antibody, an activated cytotoxic lymphocyte cell, a lymphocyte activating agent, an antibody against CEACAM, an antibody against TIGIT, and a RAF/MEK pathway inhibitor. Each possibility represents a separate embodiment of the present invention. According to some specific embodiments, the additional immuno-modulator is selected from mAb to PD-1, mAb to PD-L1, mAb to PD-L2, mAb to CEACAM1, mAb to CTLA-4, mAB to TIGIT, PVR, Interleukin 2 (IL-2) or lymphokine-activated killer (LAK) cell.

    [0333] According to other embodiments the additional anti-cancer agent is a chemotherapeutic agent. The chemotherapy agent, which could be administered together with the antibody according to the present invention, or separately, may comprise any such agent known in the art exhibiting anticancer activity, including but not limited to: mitoxantrone, topoisomerase inhibitors, spindle poison vincas: vinblastine, vincristine, vinorelbine (taxol), paclitaxel, docetaxel; alkylating agents: mechlorethamine, chlorambucil, cyclophosphamide, melphalan, ifosfamide; methotrexate; 6-mercaptopurine; 5-fluorouracil, cytarabine, gemcitabin; podophyllotoxins: etoposide, irinotecan, topotecan, dacarbazin; antibiotics: doxorubicin (adriamycin), bleomycin, mitomycin; nitrosoureas: carmustine (BCNU), lomustine, epirubicin, idarubicin, daunorubicin; inorganic ions: cisplatin, carboplatin; interferon, asparaginase; hormones: tamoxifen, leuprolide, flutamide, and megestrol acetate.

    [0334] According to some embodiments, the chemotherapeutic agent is selected from alkylating agents, antimetabolites, folic acid analogs, pyrimidine analogs, purine analogs and related inhibitors, vinca alkaloids, epipodophyllotoxins, antibiotics, L-asparaginase, topoisomerase inhibitor, interferons, platinum coordination complexes, anthracenedione substituted urea, methyl hydrazine derivatives, adrenocortical suppressant, adrenocorticosteroides, progestins, estrogens, antiestrogen, androgens, antiandrogen, and gonadotropin-releasing hormone analog. According to another embodiment, the chemotherapeutic agent is selected from the group consisting of 5-fluorouracil (5-FU), leucovorin (LV), irenotecan, oxaliplatin, capecitabine, paclitaxel and doxetaxel. One or more chemotherapeutic agents can be used.

    [0335] In some embodiments, the pharmaceutical composition according to the present invention is for use in treating cancer or for use in enhancing the immune response.

    [0336] The term enhancing immune response refers to increasing the responsiveness of the immune system and inducing or prolonging its memory. The pharmaceutical composition according to the present invention may be used to stimulate immune system upon vaccination. Thus, in one embodiment the pharmaceutical composition can be used for improving vaccination.

    [0337] In certain embodiments, the cancer is selected from lung, thyroid, breast, colon, melanoma, prostate, hepatic, bladder, renal, cervical, pancreatic, leukemia, lymphoma, myeloid, ovarian, uterus, sarcoma, biliary, and endometrial cells cancer. Each possibility represents a separate embodiment of the invention.

    [0338] According to some embodiments, a pharmaceutical composition, comprising at least one antibody or fragment thereof according to the present invention, and a pharmaceutical composition, comprising an additional immuno-modulator or a kinase inhibitor, are used in treatment of cancer by separate administration.

    [0339] According to still another aspect the present invention provides a method of treating cancer in a subject in need thereof comprising administering to said subject a therapeutically effective amount of a monoclonal antibody or antibody fragment according to the present invention.

    [0340] According to an additional aspect the present invention provides methods for treating a disease associated with Nectin4 overexpression.

    [0341] According to an aspect, the present invention provides a method of treating cancer in a subject in need thereof comprising administering to said subject a therapeutically effective amount of a plurality of T-cells comprising a CAR molecule as described herein.

    [0342] The term effective amount as used herein refers to a sufficient amount of the monoclonal antibody of the antibody fragment that, when administered to a subject will have the intended therapeutic effect. The effective amount required to achieve the therapeutic end result may depend on a number of factors including, for example, the specific type of the tumor and the severity of the patient's condition, and whether the combination is further co-administered with radiation. The effective amount (dose) of the active agents, in the context of the present invention should be sufficient to affect a beneficial therapeutic response in the subject over time, including but not limited to inhibition of tumor growth, reduction in the rate of tumor growth, prevention of tumor and metastasis growth and enhanced survival.

    [0343] Toxicity and therapeutic efficacy of the compositions described herein can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., by determining the IC50 (the concentration which provides 50% inhibition) and the maximal tolerated dose for a subject compound. The data obtained from these cell culture assays and animal studies can be used in formulating a range of dosages for use in humans. The dosage may vary depending inter alia upon the dosage form employed, the dosing regimen chosen, the composition of the agents used for the treatment and the route of administration utilized, among other relevant factors. The exact formulation, route of administration and dosage can be chosen by the individual physician in view of the patient's condition. Depending on the severity and responsiveness of the condition to be treated, dosing can also be a single administration of a slow release composition, with course of treatment lasting from several days to several weeks or until cure is affected or diminution of the disease state is achieved. The amount of a composition to be administered will, of course, be dependent on the subject being treated, the severity of the affliction, the manner of administration, the judgment of the prescribing physician, and all other relevant factors.

    [0344] The term administering or administration of a substance, a compound or an agent to a subject can be carried out using one of a variety of methods known to those skilled in the art. For example, a compound or an agent can be administered enterally or parenterally. Enterally refers to administration via the gastrointestinal tract including per os, sublingually or rectally. Parenteral administration includes intravenously, administration intradermally, intramuscularly, intraperitoneally, subcutaneously, ocularly, sublingually, intranasally, by inhalation, intraspinally, intracerebrally, and transdermally (by absorption, e.g., through a skin duct). A compound or agent can also appropriately be introduced by rechargeable or biodegradable polymeric devices or other devices, e.g., patches and pumps, or formulations, which provide for the extended, slow or controlled release of the compound or agent. Administering can also be performed, for example, once, a plurality of times, and/or over one or more extended periods. In some embodiments, the administration includes both direct administration, including self-administration, and indirect administration, including the act of prescribing a drug. For example, as used herein, a physician who instructs a patient to self-administer a drug, or to have the drug administered by another and/or who provides a patient with a prescription for a drug is administering the drug to the patient.

    [0345] Antibodies are generally administered in the range of about 0.1 to about 20 mg/kg of patient weight, commonly about 0.5 to about 10 mg/kg, and often about 1 to about 5 mg/kg. In this regard, it is preferred to use antibodies having a circulating half-life of at least 12 hours, preferably at least 4 days, more preferably up to 21 days. Chimeric antibodies are expected to have circulatory half-lives of up to 14-21 days. In some cases, it may be advantageous to administer a large loading dose followed by periodic (e.g., weekly) maintenance doses over the treatment period. Antibodies can also be delivered by slow-release delivery systems, pumps, and other known delivery systems for continuous infusion.

    [0346] The term about means that an acceptable error range, e.g., up to 5% or 10%, for the particular value should be assumed.

    Diagnosis

    [0347] The present invention further discloses methods for diagnosing and prognosing cancer.

    [0348] According to an aspect, the present invention provides a diagnostic and/or prognostic method of cancer or infectious disease in a subject, the method comprises the step of determining the expression level of Nectin4 in a biological sample of said subject using at least one antibody as described herein.

    [0349] The term biological sample encompasses a variety of sample types obtained from an organism that may be used in a diagnostic or monitoring assay. The term encompasses blood and other liquid samples of biological origin, solid tissue samples, such as a biopsy specimen, or tissue cultures or cells derived there from and the progeny thereof. Additionally, the term may encompass circulating tumor or other cells. The term specifically encompasses a clinical sample, and further includes cells in cell culture, cell supernatants, cell lysates, serum, plasma, urine, amniotic fluid, biological fluids including aqueous humour and vitreous for eyes samples, and tissue samples. The term also encompasses samples that have been manipulated in any way after procurement, such as treatment with reagents, solubilisation, or enrichment for certain components.

    [0350] Determining the expression level of Nectin4 can be performed by a labeled anti-Nectin4 antibody as described herein. Determining the expression can be performed, for example, by ELISA. The method of the invention can further comprise the step of comparing said level of expression to a control level.

    [0351] The following examples are presented in order to more fully illustrate some embodiments of the invention. They should, in no way be construed as limiting the scope of the invention.

    EXAMPLES

    Experimental Procedures

    [0352] Reference is now made to the following examples, which together with the above descriptions, illustrate the invention in a non-limiting fashion. [0353] Generally, the nomenclature used herein and the laboratory procedures utilized in the present invention include molecular, biochemical, microbiological, immunological and recombinant DNA techniques. Such techniques are well known in the art. Other general references referring to well-known procedures are provided throughout this document for the convenience of the reader.

    Methods

    Cell Lines

    [0354] The cell lines used were LNCap, JEG3, MCF-7, RAJI, MDA-MD-453, HT1376 and CHO cells. In some cases, CHO cells were stably transfected with cynomolgus (Cyno) or murine Nectin-4. The cells were grown at 37 C., >95% humidity and 5% CO.sub.2 in DMEM for all cells except RAJI cells, which were cultured in RPMI supplemented with 10% heat inactivated FCS (media and sera from Sigma-Aldrich).

    Flow Cytometry

    [0355] Flow cytometry was performed using anti murine Nectin4 mAb (Clone 356704). Cells were incubated on ice for 30 minutes with 0.2 ug of mAb per 100,000 cells. Detection was performed with a secondary goat Ab coupled to AlexaFluor 647 (Jackson ImmunoResearch) for 30 min on ice.

    [0356] In some cases, anti-Nectin-4 Abs were used at various concentrations and incubated on ice with target cells for 30 minutes. Detection was performed with secondary Abs directed against murine or human Fc, coupled to AlexaFluor 647 (Jackson ImmunoResearch) for 30 min on ice.

    [0357] For staining of human TIGIT-Ig or human Nectin1-Ig, cells were incubated on ice for 1 hour with 3 ug of TIGIT-Ig per 100,000 cells. Detection was performed with a secondary Alexa Fluor 647 anti-human (Jackson ImmunoResearch) for 30 min on ice. For blocking experiments cells were pre-incubated with 1 pg of the indicated antibody prior to the TIGIT-Ig or human Nectin1-Ig staining. In some cases, cells were incubated with 8 ug/ml of the indicated Ab together with human TIGIT-Ig or human Nectin-1-Ig (at 20 ug/ml). Detection of ligand binding was performed with a secondary Alexa Fluor 647 anti-human Ab (Jackson ImmunoResearch).

    [0358] Analysis was performed using the FACS-Calibur (BD Biosciences) or Cytoflex Becman Coulter flow cytometers and FCS express software.

    Killing Assay

    [0359] For evaluation of NK cell cytotoxic activity against targets cells, S35 release assays were performed as described (Mandelboim et al., Exp. Med. 184 (3): 913-22). NK cells were isolated from healthy donors using EasySep human NK separation kit (19055 STEMCELL TECHNOLOGIES) and were grown with PHA and IL-2. Target cells were incubated overnight in methionine free medium with radioactive methionine [S35]. Next, the cells were washed and incubated on ice with 1 pg of the antibodies per 5000 cells per well. The cells were then incubated with the NK cells for 5 hours. S35 release was measured with B-counter TopCount (Packard). The results are represented as: (CPM (sample)-CPM (spontaneous release))/(CPM (total release)-CPM (spontaneous release))100, wherein CPM denotes counts per minute.

    ADCC Assay

    [0360] NK cells were isolated from healthy donors using EasySep human NK separation kit (19055 STEMCELL TECHNOLOGIES) and were grown with PHA and IL-2. Target cells were plated at 2.5*104 cells per well in 96U plates and co-incubated with activated NK cells at ET ratio of 2:1. Incubation was done in the presence of 12 ug/ml chimeric clones hNec4.05hlgG1 and hNec4.11hlgG1 or a control hlgG1. After two hours NK cells were analyzed by FACS for their CD107a (Biolegend cat 328619) degranulation marker expression.

    CAR-T Generation and Functional Assay

    [0361] Single chain of the hNec4.11 Ab was cloned in-frame to the CD8 stalk region followed by the CD28 TM domain, 41BB intracellular domain, and the intracellular domain of CD3Zeta chain. A schematic drawing of the CAR-T construct is shown in FIG. 11A. The construct was introduced into a hEf1a containing promoter lentiviral vector (pHAGE2) followed by IRES GFP cassette to monitor transduction efficacy. Jurkat cells were transduced by lenti particles encoding for the construct. The transduction efficacy was above 99% (FIG. 11B).

    [0362] Parental Jurkat cells or Jurkat cells expressing the CAR-T construct (Jurkat pHAGE2.4.11) (5*104 per well) were incubated with the target cells HT1376 and MDA-MD-453 at ET ratio of 1:1 for 48 hours. Sups were collected after centrifugation and IL-2 levels were measured using the IL-2 ELISA kit of Peprotech (cat 900-T12) according to the manufacturer protocol.

    [0363] PBMCs from healthy donor were preactivated for 72 hours, using ImmunoCult Human CD3/CD28 T Cell Activator according to the manufacturer protocol. The cells were transduced using pHAGE2.4.11 lenti according to Kochenderfer J N et al. (J Immunother. 2009 doi: 10.1097/CJI.Ob013e3181ac6138) and the expression was validated by GFP levels. The CART PBMCs were incubated with HT1376 (2.5*104/well) cells through a range of E: Ts. After 48 hours the effector cells were removed, the target cells were washed three times and viability measured using CellTiter-Glo Luminescent Cell Viability Assay according to the manufacturer protocol.

    In Vivo Mice Tumor Model

    [0364] All experiments were performed using 6-8 weeks old SCID-beige female mice. All mice were housed under SPF conditions, normal light/dark cycles and 22+/2 C. in a specific pathogen free unit of the Hebrew University Medical School (Ein-Kerem, Jerusalem) and in accordance with the guidelines of the ethics committee. Every group of mice contained 7 females (n=7). Xenografts were generated by administering subcutaneous injection of the indicated cells into the left flank region. Injection of anti Nectin4 clone.05 and control (anti-murine CD3, InVivoMAb-clone 17A2) antibodies was administrated intraperitoneally twice a week. The mice were monitored daily. On the day of assay termination (see figure legends) all mice were sacrificed and individual tumor weights were recorded. No differences were observed between the various mice groups in their general health at baseline.

    Example 1. Generation and Selection of Anti-Nectin-4 mAbs

    [0365] The immunogen (Nec4-Fc) expression technology is based on mammalian HEK 293T cells, a method of choice especially in the case of glycoproteins that gives the best quality, stability, solubility and yield. Nec4-Fc protein which is a fusion protein of the ectodomain of Nectin-4 and human lgG1 Fc domain was produces recombinantly and purified as following:

    [0366] The coding sequence of human Nectin4 was cloned as a fusion to the Fc fragment of human lgG1 to generate the recombinant Fc-fusion protein. The ectodomain (extracellular) part of the human Nectin4 molecule, spanning residues 32 to 349 was used. C-terminal Serine residue at position 349 of the Nectin4 amino acid sequence was fused to the heavy chain hinge of a deglycosyltaed Fc (N297A) of human lgG1, followed by the C.sub.H2 and C.sub.H3 constant regions. The open reading frame (ORF) of the recombinant protein was codon optimized for high-level expression in mammalian cells. The optimized DNA sequence was produced by GeneArt synthesis service (Invitrogen) with the addition of flanking DNA sequences corresponding to EcoRI and Notl restriction sites at the 5 and 3 ends of the DNA fragment, respectively. The expression vector was constructed by double digestion of the optimized DNA fragment with EcoRI and Notl, followed by its ligation into plRESpuro3 (Clontech Laboratories, Inc.). The resulting constructs were transfected into HEK-293T cells by using the FuGENE 6 Transfection Reagent (Roche Diagnostics). After 48 h, transfected cells were subjected to antibiotic selection with 5 g/mL puromycin (Sigma-Aldrich). Stable pools were analyzed for protein secretion by SDS/PAGE. Supernatants were collected and purified on a Poros 20 protein G column in the High-Pressure Perfusion Chromatography Station, BioCAD (PerSeptive Biosystems). The resulted fusion protein immunogen is denoted Nectin4-Fc.

    [0367] For immunization, BALB/c mice were injected with 50 ug of the immunogen in complete Freund's adjuvant (CFA) followed by 50 ug of the immunogen in incomplete Freund's adjuvant (IFA) at day 14 post first immunization. Next, the sera were analyzed for anti-Nec-4-Fc antibody titer by ELISA. The mice with the highest titer were boosted with the 50 ug of the immunogen in PBS. After three days, the spleen of immune mice was taken and, after lysis of red blood cells, the splenocytes were fused with SP2/0 cell line. The potential hybridoma cells were seeded in 20% RPMI 1640 medium containing hypoxanthine, aminopterin, and thymidine (HAT) for selection of stable hybridoma cell lines. The abovementioned procedure was repeated twice and in total, 1034 wells were screened for anti-Nec4-Fc antibody secretion by ELISA. Next, 30 wells that their supernatant where positive for binding to Nec4-Fc coated on ELISA plates, were retested for their positivity, and in parallel a cross-reactivity test was performed on an irrelevant Fc fusion protein. This resulted in 10 hybridoma cell lines that secreted antibodies specifically recognizing Nectin-4 ectodomain. All these candidates that showed the specific signal in ELISA were tested for their ability to recognize a native human Nectin-4 protein on transfectant cell lines.

    [0368] RAJI Burkitt's lymphoma cells were transfected with human Nectin4 and analyzed by FACS for determining the binding of the five hybridoma clones indicated. The cells were incubated with different clones and then incubated with human TIGIT-Ig and stained with a secondary antibody. The Mean Fluorescence Intensity (MFI) values of the FACS staining are depicted in FIG. 2. As shown, monoclonal antibodies produced by clones hNec4.01 (Clone 1) and hNec4.05 (Clone 5), exhibited the best blocking capability of TIGIT-Nectin4 interactions.

    [0369] Similar assays, using JEG3 and LNCap cell lines that naturally expressed Nectin4 were also performed and have yielded similar results.

    [0370] Five antibodies showed positive staining. Out of those 5, 4 were further selected for their IgG isotype (and not IgM isotype). Finally, the 4 remaining candidates all showed a strong binding capacity to the native human Nectin-4 molecules expressed on the surface of live cells and were repetitively tested on several irrelevant fusion proteins to select for those with zero cross-reactivity between Nectin-4 and other ligands of the immune cell receptors. However, only 2 of those were shown to be blocking antibodies against Nectin-4. Thus, 2 stable clonal cell lines, hNec4.01 and hNec4.05, have been generated, both of the isotype kappa lgG1. Next, a large-scale Ab production was performed and both monoclonal antibodies were purified from the serum free medium, using GE AKTA Prime Plus Liquid Chromatography System and HiTrap Protein G columns, in an amount of few milligrams.

    [0371] Similarly to the above, additional clones were identified, out of which clone 11 (hNec4.11) had the best binding and blocking capacities and thus was screened in parallel to hNec4.05 as described below.

    [0372] Based on the above attempts, it was concluded that even in the case of an immunogen closely resembling the target protein Nectin-4 (in terms that it is a dimer, glycosylated by mammalian cell machinery and produced under non-denaturing conditions), the chance of obtaining a hybridoma cell line secreting blocking anti-Nectin 4 antibodies is less than 2% (per mille).

    Example 2. Affinity of the Anti-Nectin-4 mAbs to Human Nectin4

    [0373] The affinity of antibodies hNec4.01 and hNec4.05 to fluorophore-labeled human Nectin4-Ig molecule was further determined using microscale thermophoresis assay (Wienken et al. 2010, Nat. Commun.1:100). Measurements were repeated with at least three independent protein preparations. As shown in FIG. 3, very high binding affinities were observed for both antibodies. For clone hNec4.05 the calculated Kd is 272154 pM, and for the hNec4.01 clone the calculated Kd was 107115 pM.

    Example 3. Sequencing of the Anti-Nectin-4 mAbs

    [0374] The two hybridoma clones, No. 0.1 and No. 0.5, which demonstrated the best inhibition of Nectin4-TIGIT binding, were sent for nucleotide and amino acid sequencing.

    Methods

    [0375] Total RNA was isolated from the hybridoma cells following the technical manual of TRIzol Reagent (Ambion, Cat. No.: 15596-026). Total RNA was then reverse transcribed into cDNA using isotype-specific anti-sense primers or universal primers following the technical manual of PrimeScript 1st Strand cDNA Synthesis Kit (Takara, Cat. No.: 6110A). The antibody fragments of V.sub.H and Vi were amplified according to the standard operating procedure (SOP) of rapid amplification of cDNA ends (RACE) of GenScript. Amplified antibody fragments were cloned into a standard cloning vector separately. Colony P CR was performed to screen for clones with inserts of correct sizes. No less than five colonies with inserts of correct sizes were sequenced for each fragment. The sequences of different clones were aligned and the consensus sequence of these clones was provided.

    [0376] The following tools for sequence analysis of immunoglobulin variable regions were used: [0377] i. NCBI Nucleotide BLAST; [0378] ii. IMGT/V Quest program; and [0379] iii. NCBI IgBLAST.

    [0380] The obtained sequences are:

    TABLE-US-00001 ClonehNec4.01: HeavychainvariableregionDNAsequence,414basepairs(SEQIDNO:1): Leadersequence-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 ATGGGATGGAGCTGGATCTTTCTCTTCCTCCTGTCAGGAACTGCAGGCTTCCACTCTGAGGT CCAACTTCAGCAGTCAGGACCTGAACTGGTGAAACCTGGGGCCTCAGTGAAGATTGCCTGCA GGGCCTCTGGATACACATTCACTGCCTACAATATCCACTGGGTGAGCCAGAGACATGGAAAG AGCCTTGAATGGATTGGATATATCTATCCTAACAATGGTGGTTCTGGCTACAACCAGAAATT CATGAACAAGGCCACATTGACTGTAGACCATTCCTCCAATACAGCCTACATGGAGCTCCGCA GCCTGACGTCTGAGGACTCTGCAGTCTATTACTGTGCAATATTTGATTACGACGAGGCCTGG TTTATTTACTGGGGCCAAGGGACTCTGGTCACTGTCTCTGCA Heavychainvariableregionpolypeptidesequence,138aminoacids,(SEQIDNO:2): Leadersequence-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 MGWSWIFLFLLSGTAGFHSEVQLQQSGPELVKPGASVKIACRASGYTFTAYNIHWVSQRHGK SLEWIGYIYPNNGGSGYNQKFMNKATLTVDHSSNTAYMELRSLTSEDSAVYYCAIFDYDEAW FIYWGQGTLVTVSA Heavychainvariableregionpolypeptidesequence(FR1-CDR1-FR2-CDR2-FR3-CDR3- FR4(SEQIDNO:35) EVQLQQSGPELVKPGASVKIACRASGYTFTAYNIHWVSQRHGKSLEWIGYIYPNNGGSGYNQ KFMNKATLTVDHSSNTAYMELRSLTSEDSAVYYCAIFDYDEAWFIYWGQGTLVTVSA LightchainvariableregionDNAsequence,384basepairs(SEQIDNO:3): Leadersequence-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 ATGGATTTTCAAGTGCAGATTTTCAGCTTCCTGCTAATCAGTGCCTCAGTCATAATGTCCAG AGGAGAAAATGTTCTCACCCAGTCTCCAGAAATCATGTCTGCATCTCCCGGGGAAGAGGTCA CCATGACCTGTAGTGCCAGCTCAAGTGTTAGTTACATGCACTGGTTCCAGCAGAAGTCAACT ATCTCCCCCAAACTCTGGATTTATGACACATCCAAACTGGCTTCTGGAGTCCCCGGTCGCTT CAGTGGCAGTGGGTCTGGCAAGTCTTACTCTCTCACGATCAGAAACATGGAGGCTGAAGATG TTGCCACCTATTACTGTTTTCAGGGGAGTGGGAGCCCGTACACGTTCGGAGGGGGGACCAAG CTGGAAATTAAA Lightchainvariableregionpolypeptidesequence,128aminoacids(SEQIDNO:4): Leadersequence-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 MDFQVQIFSFLLISASVIMSRGENVLTQSPEIMSASPGEEVTMTCSASSSVSYMHWFQQKST ISPKLWIYDTSKLASGVPGRFSGSGSGKSYSLTIRNMEAEDVATYYCFQGSGSPYTFGGGTK LEIK Lightchainvariableregionpolypeptidesequence(FR1-CDR1-FR2-CDR2-FR3-CDR3- FR4(SEQIDNO:36) ENVLTQSPEIMSASPGEEVTMTCSASSSVSYMHWFQQKSTISPKLWIYDTSKLASGVPGRFS GSGSGKSYSLTIRNMEAEDVATYYCFQGSGSPYTFGGGTKLEIK ClonehNec4.05 HeavychainvariableregionDNAsequence,408basepairs(SEQIDNO:5): Leadersequence-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 ATGGGATGGAGCCGGATCTTTCTCTTCCTCCTGTCAATAATTGCAGGTGTCCATTGCCAGGT CCAGCTGCAGCAGTCTGGACCTGAGCTGGTGAAGCCTGGGGCTTCAGTGAGGATATCCTGCA AGGCCTCTGGCTACACCTTCACAACCTACTATATACACTGGGTGAAGCAGAGGCCTGGACAG GGACTTGAGTGGATTGGATGGATTTATCCTGGAAATGTTAATACTAAGAACAATGAGAAGTT CAAGGTCAAGGCCACACTGACTGCAGACAAATCCTCCAGCACAGCCTACATGCAGCTCAGCA GCCTGACCTCTGAGGACTCTGCGGTCTATTTCTGTGCAAGATCGAACCCCTATGTTATGGAC TACTGGGGTCAGGGAACCTCAGTCACCGTCTCCTCA Heavychainvariableregionpolypeptidesequence,136aminoacids(SEQIDNO:6): Leadersequence-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 MGWSRIFLFLLSIIAGVHCQVQLQQSGPELVKPGASVRISCKASGYTFTTYYIHWVKQRPGQ GLEWIGWIYPGNVNTKNNEKFKVKATLTADKSSSTAYMQLSSLTSEDSAVYFCARSNPYVMD YWGQGTSVTVSS Heavychainvariableregionpolypeptidesequence(FR1-CDR1-FR2-CDR2-FR3-CDR3- FR4(SEQIDNO:37) QVQLQQSGPELVKPGASVRISCKASGYTFTTYYIHWVKQRPGQGLEWIGWIYPGNVNTKNNE KFKVKATLTADKSSSTAYMQLSSLTSEDSAVYFCARSNPYVMDYWGQGTSVTVSS LightchainvariableregionDNAsequence,381basepairs(SEQIDNO:7): Leadersequence-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 ATGAAGTCACAGACCCAGGTCTTCGTATTTCTACTGCTCTGTGTGTCTGGTGCTCATGGGAG TATTGTGATGACCCAGACTCCCAAATTCCTGCTTGTATCAGCAGGAGACAGGGTTACCATAA CCTGCAAGGCCAGTCAGAGTGTGAGTAATGATGTAGCTTGGTACCAACAGAAGCCAGGGCAG TCTCCTAAACTGCTGATATACTATGCATCCAATCGCTACACTGGAGTCCCTGATCGCTTCAC TGGCAGTGGATATGGGACGGATTTCACTTTCACCATCAGCGCTGTGCAGGCTGAAGACCTGG CAGTTTATTTCTGTCAGCAGGATTATAGCTCTCCGTACACGTTCGGAGGGGGGACCAAGCTG GAAATAAAA Lightchainvariableregionpolypeptidesequence,127aminoacids(SEQIDNO:8): Leadersequence-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 MKSQTQVFVFLLLCVSGAHGSIVMTQTPKFLLVSAGDRVTITCKASQSVSNDVAWYQQKPGQ SPKLLIYYASNRYTGVPDRFTGSGYGTDFTFTISAVQAEDLAVYFCQQDYSSPYTFGGGTKL EIK Lightchainvariableregionpolypeptidesequence(FR1-CDR1-FR2-CDR2-FR3-CDR3- FR4(SEQIDNO:38) SIVMTQTPKFLLVSAGDRVTITCKASQSVSNDVAWYQQKPGQSPKLLIYYASNRYTGVPDRF TGSGYGTDFTFTISAVQAEDLAVYFCQQDYSSPYTFGGGTKLEIK ClonehNec4.11 HeavychainvariableregionDNAsequence,408basepairs(SEQIDNO:21): Leadersequence-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 ATGGGATGGAGCCGGATCTTTCTCTTCCTCCTGTCAATAATTGCAGGTGTCCATTGC CAGGTCCAGCTGCAGCAGTCTGGACCTGAACTGGTGAAGCCTGAGACTTCAGTG AAGATATCCTGCAAGGCTTCTGGCTACACCTTCACAAGTTACTATATACACTGG GTGAAACAGAGGCCTGGACAGGGACTTGAGTGGATTGGCTGGATTTATCCTGG AAATGTTAATACTAAGTATAATGAGAGGTTTAAGGGCAAGGCCACTCTGACTG CAGACAAATCCTCCAACACAGCCCACATGCAGCTCACCAGCCTGACCTCTGAGG ACTCTGCGGTCTATTTCTGTGCAAGATCGAACCCCTATGTTATGGACTACTGGG GTCAAGGAACCTCAGTCACCGTCTCCTCA Heavychainvariableregionpolypeptidesequence,136aminoacids(SEQIDNO:22): Leadersequence-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 MGWSRIFLFLLSIIAGVHCQVQLQQSGPELVKPETSVKISCKASGYTFTSYYIHWVKQR PGQGLEWIGWIYPGNVNTKYNERFKGKATLTADKSSNTAHMQLTSLTSEDSAVYF CARSNPYVMDYWGQGTSVTVSS Heavychainvariableregionpolypeptidesequence(FR1-CDR1-FR2-CDR2-FR3-CDR3- FR4(SEQIDNO:39) QVQLQQSGPELVKPETSVKISCKASGYTFTSYYIHWVKQRPGQGLEWIGWIYPGNVN TKYNERFKGKATLTADKSSNTAHMQLTSLTSEDSAVYFCARSNPYVMDYWGQGTS VTVSS LightchainvariableregionDNAsequence,381basepairs(SEQIDNO:23): Leadersequence-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 ATGAAGTCACAGACCCAGGTCTTCGTATTTCTACTGCTCTGTGTGTCTGGTGCTCATGG GAGTATTGTGATGACCCAGACTCCCAAATTCCTGCTTGTATCAGCAGGAGACAGA GTCACCATAACCTGCAAGGCCAGTCAGAGTGTGAATAATGATGTGGCTTGGTA TCAACAGAAGCCAGGGCTGTCTCCTGAACTGCTTATGTATTATGCATCCAATCG CTTCACTGGAGTCCCTGATCGCTTCACTGGCAGTGGATATGGGACGGATTTCACT TTCACCATCAGCTCTGTGCAGGCTGAAGACCTGGCAATTTATTTCTGTCAGCAGG CTTATAGGTCTCCGTACACGTTCGGAGGGGGGACCAAGCTGGAAATTCAA Lightchainvariableregionpolypeptidesequence,127aminoacids(SEQIDNO:24): Leadersequence-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 MKSQTQVFVFLLLCVSGAHGSIVMTQTPKFLLVSAGDRVTITCKASQSVNNDVAWYQ QKPGLSPELLMYYASNRFTGVPDRFTGSGYGTDFTFTISSVQAEDLAIYFCQQAYRS PYTFGGGTKLEIQ Lightchainvariableregionpolypeptidesequence(FR1-CDR1-FR2-CDR2-FR3-CDR3- FR4(SEOIDNO:40) SIVMTQTPKFLLVSAGDRVTITCKASQSVNNDVAWYQQKPGLSPELLMYYASNRFT GVPDRFTGSGYGTDFTFTISSVQAEDLAIYFCQQAYRSPYTFGGGTKLEIQ

    Example 4. Blocking of Nectin4-TIGIT Interactions with Anti-Nectin4 mAb Enhanced NK Cell Killing of Human Cell Lines

    [0381] Antibody clones hNec4.05 and hNec4.01 were tested for blocking Nectin4 binding to TIGIT and inhibiting NK cytotoxicity. [35S]methionine-labelled RAJI Burkitt's lymphoma cells transfected with Nectin4, and LNCap prostate carcinoma cells (naturally expressing Nectin4), were incubated with 1 pg/well of either mouse lgG1 as control antibody or mouse anti human Nectin4 mAbs hNec4.01 or hNec4.05. After 1h the cells were supplemented with NK cells and incubated for 5 hours. The average specific killing (+s.d.) in various Effector: Target (E: T) ratios of the NK: Cancer cells is plotted in FIG. 4A (RAJI cells) and FIG. 4B (LNCap cells). * indicates significant effect (p<0.05) of the hNec4.01 and hNec4.05 clones in comparison with the control antibody. Each figure shows one representative experiment out of three performed. The same effect was determined when using MCF-7-breast cancer cell line.

    Example 5. Verifying the Specificity of Binding of the Anti-Nectin4 Antibodies

    [0382] As tested using FACS staining and demonstrated in FIGS. 5A-5C, the mAbs hNec4.01 and hNec4.05 are specific to human Nectin4 and do not bind the murine protein. RAJI cells were transfected with murine Nectin4 (black line histograms). First, RAJI cells transfected with murine Nectin4 lysates was used in Western blot assay with a commercial anti murine Nectin4 mAb (Clone 356704) in order to verify murine Nectin4 expression (A). Next, the cells were stained with 0.2 pg of (B) clone hNec4.01 or (C) clone hNec4.05. Both hNec4.01 and hNec4.05 mAbs do not show binding to murine Nectin4.

    Example 6. Anti-Nectin4 Antibodies are Able to Block Nectin4-Nectin1 Interactions

    [0383] The ability to the anti-Nectin4 to block Nectin4-Nectin1 interactions was also determined. FACS staining of RAJI cells transfected with Nectin4 is demonstrated in FIGS. 6A-6C. Cells were Pre-incubated with 1 pg of (FIG. 6A) clone hNec4.01 or (FIG. 6B) clone hNec4.05 and then incubated with 3 pg of Nectin1-Ig (black line). Staining without blocking appears as gray line. Grey filled histograms are background control staining of secondary antibody only. It is concluded that the mAbs are able to block Nectin4-Nectin1 interaction that is suspected to increase invasiveness of tumors expressing Nectin4.

    Example 7. In Vivo Models

    [0384] The efficacy of the anti-Nectin4 mAbs was determined in vivo in animal models. Cell lines that naturally (MDA-MB-453) or recombinantly (Raji Nectin4 OE) express Nectin4 were injected SC to mice (510.sup.6 cells per mouse). SCID beige mice, which lack NK, B and T cells were used. In order to study NK cell contribution to tumor cell growth in these models human NK cells at 1x10.sup.6 were co injected with the tumor cells in some of the treatment groups.

    [0385] The anti-Nectin4 mAbs clone hNec4.05, or a control Ab (anti murine CD3, InVivoMAb-clone 17A2) were tested for their in vivo effect on tumor growth directly, or together with NK cells. The mAbs were injected IP at 75 ug per mouse, twice a week. Tumor weights were measured at study termination. As seen in FIG. 7(A), overexpression (OE) of Nectin-4 on Raji cells did not affect their growth in comparison to the growth of their parental cells which were transfected with empty vector (EV). Nevertheless, in the presence of human NK cells, OE of nectin4 increased tumor growth suggesting a negative effect of Nectin4 on NK mediated tumor suppression activity of NK cells. As seen in FIG. 7B, the addition of anti-Nectin4 Ab blocked NK cell suppression leading to reduced tumor growth in comparison to control Ab treated animals. Last, and as can be seen in FIG. 7C these effects were also seen when a cell line (MDA-MB-453) that naturally express Nectin4 was used. In the absence of NK cells the Abs had no effect, while the Abs significantly enhanced the anti-tumor effect of human NK cells co injected with the tumor cells. Together, these experiments indicate that anti-Nectin4 antibodies, such as hNec4.05 mAbs, can augment NK cytotoxicity in vivo and lead to tumor growth inhibition.

    Example 8. Binding of Anti-Nectin-4 Clones to Human, Monkey and Murine Nectin-4 Expressed on Cells

    [0386] Binding of murine anti-human Nectin-4 clones hNec4.05 and hNec4.11 to Nectin-4 expressed on the human cell line MDA-MD-453 was evaluated by FACS analysis. FIG. 8A depicts the EC50 values that were calculated following titration of Ab binding (range of 20-0.01 nM), and the maximal binding signal for each clone. Similar values were reached when the chimeric versions of the murine Abs were tested, in which the murine lgG1 Fc chain was replaced with the human lgG1 Fc one. FIG. 8B depicts antibody binding to CHO cells transfected with Cynomolgus (Cyno)-Nectin-4 and FIG. 8C depicts antibody binding to CHO cells transfected with murine-Nectin-4. These data demonstrate EC50 values to the human target at the sub-nanomolar range, which are at the scale of the Kd values presented in FIG. 3 for clones hNec4.01 and hNec4.05. Additionally, these results demonstrate cross reactivity of these two clones to the monkey (cynomolgus) Nectin-4 target, as they bind it with similar EC50 values to the ones calculated for the human target. This may be important for pre-clinical studies of the Ab. Last, clone hNec4.11, but not clone hNec4.05, was shown to also cross react with the murine Nectin-4 target. Yet, in this case the calculated EC50 was about 10-fold higher than the one calculated for the human target.

    Example 9. Blocking of Nectin-4 Ligands by Anti-Nectin-4 Clones

    [0387] Antibody clones hNec4.05 and hNec4.11 block the binding of Nectin-4 to its ligands TIGIT and Nectin-1. Binding of Nectin-4 ligands was assessed by FACS analysis. CHO cells transfected with human-Nectin-4 were incubated with either human TIGIT-Ig (FIGS. 9A & C) or with human Nectin-1-Ig (FIGS. 9B & D), both at 20 ug/ml, with or without anti-Nectin-4 clone hNec4.05 (9A & 9B) or clone hNec4.11 (9C & 9D), both at 8 ug/ml. Robust binding inhibition by the anti-Nectin-4 Abs is seen in all cases. Remaining signal is likely due to ligand binding to other receptors expressed by CHO cells, such as PVR, which are not affected by the anti-Nectin-4 Abs. These results suggest that Nectin-4 clones hNec4.05 and hNec4.11 may affect the target cancer cells by blocking signaling through cell surface Nectin-4. Additionally, these Abs may also affect effector cells which express Nectin-4 ligands, such as the inhibitory ligand TIGIT.

    Example 10. Human lgG1 Chimeric Ab Clones hNec4.05 and hNec4.1 Enhance NK Cell Activation in the Presence of Tumor Cells

    [0388] Depicted in FIG. 11 are relative expression levels of the degranulation marker CD107a on NK cells. Human NK cells (effector, E) were incubated with the target cells (T) HT1376 (FIG. 10A) and MDA-MD-453 (FIG. 10B) at ET ratio of 2:1. Incubation was done in the presence of 12 ug/ml chimeric clones hNec4.05hlgG1, hNec4.11hlgG1 or a control hlgG1. After two hours NK cells were assayed for their degranulation and activation status by FACS analysis of CD107a expression. Degranulation of NK cells in presence of control hlgG1 was set as 1 and fold induction was calculated accordingly. Shown are averages of 2-3 repeats and their normalized SDs. These results suggest an anti-cancer effect for these Abs by enhancing anti-tumor NK cell activity. Slight advantage of clone hNec4.11-hlgG1 over clone hNec4.05hlgG1 in ADCC induction was shown, which is in line with the higher max binding of clone hNec4.11 as shown in FIG. 8A.

    Example 11. CAR-T Driven by hNec4.11 Lead to Specific T Cell Activation in the Presence of Tumor Cells Expressing Nectin-4

    [0389] A schematic drawing of the CAR-T construct is seen in FIG. 11A. The transduction efficacy as judged by GFP expression was above 99% (FIG. 11B). Parental Jurkat cells or Jurkat cells expressing the CAR-T construct with hNec4.11-based single chain variable region (scFV) (Jurkat pHAGE2.4.11) were incubated with the target cells HT1376 and MDA-MD-453 (MDA-453) (FIG. 11C). The secretion of IL-2 by the Jurkat cells was significantly induced by the CAR-T expression. Next, PBMCs were transduced using pHAGE2.4.11 lenti particles (FIG. 11D). CAR-T PBMCs were incubated with HT1376 cells through a range of E: Ts. After 48 hours the effector cells were removed, and target cell viability was assessed using CellTiter-Glo Luminescent Cell Viability Assay. The killing of the target cells was significant. Taken together these observations point to the possibility of further developing CAR-T therapy that is based on the nectin4 Abs described herein.

    ScFv Sequences of CAR Construct

    [0390]

    TABLE-US-00002 Clone11-Nucleicacids (SEQIDNO:31) ATGGGATGGAGCTGTATCATCCTCTTCTTGGTAGCAACAGCTACAGGTG TGCATTCACAGGTCCAGCTGCAGCAGTCTGGACCTGAACTGGTGAAGCC TGAGACTTCAGTGAAGATTTCCTGCAAGGCTTCTGGCTACACCTTCACA AGTTACTATATACACTGGGTGAAACAGAGGCCTGGACAGGGACTTGAGT GGATTGGCTGGATTTATCCTGGAAATGTTAATACTAAGTATAATGAGAG GTTTAAGGGCAAGGCCACTCTGACTGCAGACAAATCCTCCAACACAGCC CACATGCAGCTCACCAGCCTGACCTCTGAGGACTCTGCGGTCTATTTCT GTGCAAGATCGAACCCCTATGTTATGGACTACTGGGGTCAAGGAACCTC AGTCACCGTCTCCTCAGGTGGAGGTGGCTCCGGAGGAGGTGGTTCTGGA GGAGGTGGTTCTGATATCGTGATGACCCAGACTCCCAAATTCCTGCTTG TATCAGCAGGAGACAGAGTCACCATAACCTGCAAGGCCAGTCAGAGTGT GAATAATGATGTGGCTTGGTATCAACAGAAGCCAGGGCTGTCTCCTGAA CTGCTTATGTATTATGCATCCAATCGCTTCACTGGAGTCCCTGATCGCT TCACTGGCAGTGGATATGGGACGGATTTCACTTTCACCATCAGCTCTGT GCAGGCTGAAGACCTGGCAATTTATTTCTGTCAGCAGGCTTATAGGTCT CCGTACACGTTCGGAGGGGGGACCAAGCTGGAAATTCAA Clone11-Aminoacids (SEQIDNO:32) MGWSCIILFLVATATGVHSQVQLQQSGPELVKPETSVKISCKASGYTFT SYYIHWVKQRPGQGLEWIGWIYPGNVNTKYNERFKGKATLTADKSSNTA HMQLTSLTSEDSAVYFCARSNPYVMDYWGQGTSVTVSSGGGGSGGGGSG GGGSDIVMTQTPKFLLVSAGDRVTITCKASQSVNNDVAWYQQKPGLSPE LLMYYASNRFTGVPDRFTGSGYGTDFTFTISSVQAEDLAIYFCQQAYRS PYTFGGGTKLEIQ Clone5-Nucleicacids (SEQIDNO:33) ATGGGATGGAGCTGTATCATCCTCTTCTTGGTAGCAACAGCTACAGGTG TGCATTCACAGGTCCAGCTGCAGCAGTCTGGACCTGAGCTGGTGAAGCC TGGGGCTTCAGTGAGGATATCCTGCAAGGCCTCTGGCTACACCTTCACA ACCTACTATATACACTGGGTGAAGCAGAGGCCTGGACAGGGACTTGAGT GGATTGGATGGATTTATCCTGGAAATGTTAATACTAAGAACAATGAGAA GTTCAAGGTCAAGGCCACACTGACTGCAGACAAATCCTCCAGCACAGCC TACATGCAGCTCAGCAGCCTGACCTCTGAGGACTCTGCGGTCTATTTCT GTGCAAGATCGAACCCCTATGTTATGGACTACTGGGGTCAGGGAACCTC AGTCACCGTCTCCTCAGGTGGAGGTGGCTCCGGAGGAGGTGGTTCTGGA GGAGGTGGTTCTAGTATTGTGATGACCCAGACTCCCAAATTCCTGCTTG TATCAGCAGGAGACAGGGTTACCATAACCTGCAAGGCCAGTCAGAGTGT GAGTAATGATGTAGCTTGGTACCAACAGAAGCCAGGGCAGTCTCCTAAA CTGCTGATATACTATGCATCCAATCGCTACACTGGAGTCCCTGATCGCT TCACTGGCAGTGGATATGGGACGGATTTCACTTTCACCATCAGCGCTGT GCAGGCTGAAGACCTGGCAGTTTATTTCTGTCAGCAGGATTATAGCTCT CCGTACACGTTCGGAGGGGGGACCAAGCTGGAAATAAAA Clone5-Aminoacids (SEQIDNO:34) MGWSCIILFLVATATGVHSQVQLQQSGPELVKPGASVRISCKASGYTFT TYYIHWVKQRPGQGLEWIGWIYPGNVNTKNNEKFKVKATLTADKSSSTA YMQLSSLTSEDSAVYFCARSNPYVMDYWGQGTSVTVSSGGGGSGGGGSG GGGSSIVMTQTPKFLLVSAGDRVTITCKASQSVSNDVAWYQQKPGQSPK LLIYYASNRYTGVPDRFTGSGYGTDFTFTISAVQAEDLAVYFCQQDYSS PYTFGGGTKLEIK

    [0391] The foregoing description of the specific embodiments will so fully reveal the general nature of the invention that others can, by applying current knowledge, readily modify and/or adapt for various applications such specific embodiments without undue experimentation and without departing from the generic concept, and, therefore, such adaptations and modifications should and are intended to be comprehended within the meaning and range of equivalents of the disclosed embodiments. It is to be understood that the phraseology or terminology employed herein is for the purpose of description and not of limitation.