Anti-LMP2 TCR-T cell therapy for the treatment of EBV-associated cancers

12139523 ยท 2024-11-12

Assignee

Inventors

Cpc classification

International classification

Abstract

The present disclosure provides compositions comprising anti-LMP2 TCR-T cell populations for the treatment of EBV-associated cancers and methods of making and using same.

Claims

1. A population of T-cells comprising an engineered T-cell receptor (TCR), wherein the engineered TCR activates T-cells in response to a Latent membrane protein 2 (LMP2) antigen; and wherein the engineered TCR comprises a variable alpha chain comprising the sequence as set forth in SEQ ID NO:4, and a variable beta chain comprising the amino acid sequence as set forth in SEQ ID NO:6; or a variable alpha chain comprising the sequence set forth in SEQ ID NO:10 and a variable beta chain comprising the sequence set forth in SEQ ID NO: 12.

2. The population of T-cells of claim 1, wherein the engineered TCR comprises the amino acid sequence as set forth in SEQ ID NO:3.

3. The population of T-cells of claim 1, wherein the engineered TCR comprises the amino acid sequence as set forth in SEQ ID NO:9.

4. The population of T-cells of claim 1, wherein the population of T-cells comprises a therapeutically effective amount of cells for the treatment of a cancer comprising LMP2 in a subject.

5. The population of T-cells of claim 4, wherein the subject expresses human leukocyte antigen subtype A11 (HLA-A11).

6. The population of T-cells of claim 1, wherein at least a portion of the population of T-cells produces or has the potential to produce one or more cytokines.

7. The population of T-cells of claim 6, wherein the one or more cytokines are selected from the group consisting of IL-2, IFN-gamma, TNF-alpha, Granzyme A, Granzyme B, and GM-CSF.

8. The population of T-cells of claim 4, wherein the cancer is selected from the group consisting of nasopharyngeal carcinoma (NPC), lymphoma, gastric cancer, lung cancer, melanoma, breast cancer, prostate cancer, colon cancer, renal cell carcinoma, ovarian cancer, neuroblastoma, rhabdomyosarcoma, and leukemia.

9. The population of T-cells of claim 8, wherein the cancer is an EBV-associated cancer.

10. The population of T-cells of claim 9, wherein the cancer is EBV-positive nasopharyngeal carcinoma (NPC), EBV-positive lymphoma, or EBV-positive gastric cancer.

11. A pharmaceutical composition, wherein the composition comprises the population of T-cells of claim 1, and a pharmaceutically acceptable carrier.

12. The pharmaceutical composition of claim 11, wherein the pharmaceutically acceptable carrier supports maintenance of a therapeutically effective amount of cells for the treatment of a cancer comprising LMP2.

13. The pharmaceutical composition of claim 11, further comprising at least one therapeutic agent.

14. A method of treating a subject suffering from a cancer comprising LMP2, said method comprising administering to the subject a therapeutically effective amount of the population of T-cells of claim 1.

15. The method of claim 14, wherein the cancer is selected from group consisting of nasopharyngeal carcinoma (NPC), lymphoma, gastric cancer, lung cancer, melanoma, breast cancer, prostate cancer, colon cancer, renal cell carcinoma, ovarian cancer, neuroblastoma, rhabdomyosarcoma, and leukemia.

16. The method of claim 15, wherein the cancer is an EBV-associated cancer.

17. The method of claim 16, wherein the cancer is EBV-positive nasopharyngeal carcinoma (NPC), EBV-positive lymphoma, or EBV-positive gastric cancer.

18. A method of inhibiting the growth of a tumor comprising LMP2 in a subject in need thereof, said method comprising administering to the subject a therapeutically effective amount of the population of T-cells of claim 1.

19. A method of inducing a T-cell response in a subject suffering from a cancer comprising LMP2, said method comprising administering to the subject a therapeutically effective amount of the population of T-cells of claim 1.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) The foregoing aspects and other features of the disclosure are explained in the following description, taken in connection with the accompanying drawings, herein:

(2) FIG. 1A-1B are flow cytometric results showing the expression and activity of candidate LMP2-A11 TCRs. (A) Candidate TCR sequences were cloned into retroviral vectors that were transduced into Jurkat cells, the percentages of TCRb-positive cells are indicated. (B) Jurkat cell lines in FIG. 1A were co-cultured with Ramos lymphoma cells engineered to express the HLA-A11-LMP2 peptide linker. T cell activation was quantified by measuring CD69 expression. The TCR identified as TCR-NPC-A11-03 was identified as LMP2-specific.

(3) FIG. 2A-2B are flow cytometric results showing the expression and activity of candidate LMP2-A11 TCRs. (A) Candidate TCR sequences were cloned into retroviral vectors that were transduced into Jurkat cells, the percentages of TCRb-positive cells are indicated. (B) Jurkat cell lines in 1 A were co-cultured with Ramos lymphoma cells engineered to express the HLA-A11-LMP2 peptide linker. T cell activation was quantified by measuring CD69 expression. The TCR identified as TCR-NPC-A11-125 was identified as LMP2-specific.

(4) FIG. 3A-3B are graphs showing in vitro antitumor activity of LMP2-A11 TCR-T cells. PBMCs engineered to express TCR-NPC-A11-03 (A) or TCR-NPC-A11-125 (B) were co-cultured with a mixed population of Ramos cells expressing the LMP2 peptide linked to HLA-A11 or HLA-A24. The competitive killing percentage was calculated as (1-A11:A24)100.

(5) FIG. 4A-4C are graphs showing the in vivo antitumor activity of LMP2-A11 TCR-T cells. Ramos (A11) lymphoma cells (510.sup.6) were subcutaneously inoculated in NSG mice. After 13 days, 110.sup.7 TCR-positive TCR-NPC-A11-03 or TCR-NPC-A11-125 TCR-T cells were injected via tail vein, as indicated. Tumor volumes were monitored and plotted individually (A) or as mean (B). Animal survival curve for each group is shown in (C).

(6) FIG. 5A-5E are graphs and schematics showing (A) and Kaplan-Meier survival analysis (B) of the first-inhuman Ad5f35-LMP1-2 adenoviral vector-transduced DC vaccine trial. Of the 16 advanced NPC patients treated. DC vaccination therapy resulted in disease stabilization for >18 weeks in two patients (12.5%) and partial response in one patient. (C-E) Schematic diagram (C), patient sample collection procedure (D), and Kaplan-Meier survival analysis of the EBV-expanded T cell therapy trial. This Phase II clinical trial for advanced NPC combining chemotherapy with adoptive EBV-specific T cell therapy achieved a response rate of 71.4%, with 3 complete and 22 partial responses in accordance with one embodiment of the present disclosure.

(7) FIG. 6A-6B are graphs and images showing the experimental and computational platforms used to dissect tumor-antigen specific TCRs. (A) PBMCs from patients were aliquoted for direct repertoire sequencing or TCR analysis after tumor antigen stimulated proliferation. These two data sets were subjected to Motif analysis, which unbiasedly clusters TCRs together based on their motif similarities. In this way, even with distinct TCR sequences, TCRs recognizing the tested tumor antigen from the unstimulated pool were linked to TCRs with known tumor antigen specificity. (B) The diversity and frequency of tumor antigen-specific TCRs from a specific cluster with shared Motifs were quantified. With this procedure and longitude samples collected from the BMS CheckMate 143 Trial, we monitored the dynamics of T cell clonal expansion in glioblastoma patients treated with anti-PD-1 or anti-PD-1 plus anti-CTLA4 treatment. EGFR epitopes were used as a representative of tumor associated antigens, and CMV pp65 epitopes represented exogenous antigens.

(8) FIG. 7A-7D are graphs and flow cytometric analysis showing PEPCMV-HLA-A2-specific TCR cloning and TCR-T validation. Single T cell RNASeq was performed to clone TCRs recognizing the CMVpp65 epitope presented by HLA-A2 donor. (A) V segment usages of cloned TCR and chains. (B) Human TCR-T cells generated by retroviral transduction. (C) Antigen-specific activation of CMVpp65-TCR-T cells. Left, unstimulated; right, antigen simulated. CD107 is used as a marker for antigen-induced degranulation, a critical step in T cell-mediated cytolysis. (D) Antigen specific killing by A2-P8-036 TCR-T. Mouse OT-1 transgenic T cells were used as a positive control; target cells without loading CMVpp65 peptide antigen were used as a negative control.

DETAILED DESCRIPTION

(9) For the purposes of promoting an understanding of the principles of the present disclosure, reference will now be made to preferred embodiments and specific language will be used to describe the same. It will nevertheless be understood that no limitation of the scope of the disclosure is thereby intended, such alteration and further modifications of the disclosure as illustrated herein, being contemplated as would normally occur to one skilled in the art to which the disclosure relates.

(10) Articles a and an are used herein to refer to one or to more than one (i.e. at least one) of the grammatical object of the article. By way of example, an element means at least one element and can include more than one element.

(11) The term about is used to provide flexibility to a numerical range endpoint by providing that a given value may be slightly above or slightly below the endpoint without affecting the desired result.

(12) Throughout this specification, unless the context requires otherwise, the word comprise and include and variations (e.g., comprises, comprising, includes, including) will be understood to imply the inclusion of a stated component, feature, element, or step or group of components, features, elements or steps but not the exclusion of any other integer or step or group of integers or steps. Embodiments recited as including. comprising, or having certain elements are also contemplated as consisting essentially of and consisting of those certain elements.

(13) Recitation of ranges of values herein are merely intended to serve as a shorthand method of referring individually to each separate value falling within the range, unless otherwise indicated herein, and each separate value is incorporated into the specification as if it were individually recited herein. For example, if a concentration range is stated as 1% to 50%, it is intended that values such as 2% to 40%, 10% to 30%, or 1% to 3%, etc., are expressly enumerated in this specification. These are only examples of what is specifically intended, and all possible combinations of numerical values between and including the lowest value and the highest value enumerated are to be considered to be expressly stated in this disclosure.

(14) Unless otherwise defined, all technical terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure belongs.

(15) Definitions

(16) As used herein, treat, treatment, therapy, and/or therapy regimen refer to the clinical intervention made in response to a disease, disorder or physiological condition manifested by a patient or to which a patient may be susceptible. The aim of treatment includes the alleviation or prevention of symptoms, slowing or stopping the progression or worsening of a disease, disorder, or condition and/or the remission of the disease, disorder or condition.

(17) The terms effective amount or therapeutically effective amount refer to an amount sufficient to effect beneficial or desirable biological and/or clinical results. An effective amount or therapeutically effective amount can be determined by a skilled team of health professionals, and can include use of imaging tests, biomarker tests, or additional tests. Regarding cancer, administration of a therapeutically effective amount prevents metastasis of the cancer, result in a decrease in the size or mass of a solid tumor, or inhibits proliferation or growth of the cancer, or result in necrosis of a tumor.

(18) The term disease as used herein includes, but is not limited to, any abnormal condition and/or disorder of a structure or a function that affects a part of an organism. It may be caused by an external factor, such as an infectious disease, or by internal dysfunctions, such as cancer, cancer metastasis, and the like.

(19) As is known in the art, cancer is generally considered as uncontrolled cell growth. The compositions and methods of the present invention can be used to treat any cancer, and any metastases thereof, that expresses LMP2. Examples include, but are not limited to, nasopharyngeal carcinoma (NPC), lymphoma, gastric cancer, lung cancer, melanoma, breast cancer, prostate cancer, colon cancer, renal cell carcinoma, ovarian cancer, neuroblastoma, rhabdomyosarcoma, and leukemia. In certain embodiments, the cancer is nasopharyngeal carcinoma. In some embodiments, the cancer is lymphoma. In some embodiments, the cancer is gastric cancer. In certain embodiments, the cancer is an EBV-associated cancer or an EBV-positive cancer, for example, EBV-positive Hodgkin's Lymphoma, EBV-positive Burkitt Lymphoma, EBV-positive nasopharyngeal carcinoma, or EBV-positive gastric cancer.

(20) Nasopharyngeal carcinoma (NPC) is a multifactorial malignancy associated with both genetic and environmental factors (for example, the Epstein-Barr virus has been implicated). The viral influence is associated with infection with Epstein-Barr virus (EBV; also referred to as human herpesvirus 4), and EBV is one of the most common viruses (for example, about 95% of all people in the U.S. are exposed to this virus by the time they are 30-40 years old). Thus, the high frequency of NPC in southeast Asian individuals, especially persons of Cantonese Chinese ancestry, suggests a strong genetic factor predisposing to the development of the disorder. In areas with high incidence, NPC clusters in families, which suggests that both geography and genetics may influence disease risk. NPC can be treated by surgery, by chemotherapy, or by radiotherapy. There are different forms of radiation therapy, including 3D conformal radiation therapy, intensity-modulated radiation therapy, particle beam therapy and brachytherapy, which are commonly used in the treatments of cancers of the head and neck. The expression of EBV latent proteins within undifferentiated nasopharyngeal carcinoma can be potentially exploited for immune-based therapies as disclosed herein.

(21) As used herein, the terms subject and patient are used interchangeably herein and refer to both human and nonhuman animals. The term nonhuman animals of the disclosure includes all vertebrates, e.g., mammals and non-mammals, such as nonhuman primates, sheep, dog, cat, horse, cow, chickens, amphibians, reptiles, and the like. In certain embodiments, the subject is a human patient that is suspected of having cancer, has cancer, or suffers from cancer. In an embodiment, the human is a subject suspected of having a cancer comprising LMP2. In another embodiment, the human is a subject having a cancer comprising LMP2. In yet another embodiment, the human is a subject suffering from a cancer comprising LMP2. In certain embodiments, the subject is a human suffering from an LMP2-associated cancer. In certain embodiments, the subject is a human suffering from an EBV-associated cancer. In certain embodiments, the patient is EBV serum positive. In certain embodiments, the LMP2 antigen is in complex with an MHC class I molecule having human leukocyte antigen subtype A11 (HLA-A11).

(22) As used herein, the terms latent membrane protein 2 and LMP2 refer to EBV antigen latent membrane protein 2 (LMP2). LMP2 is expressed in many EBV-associated cancers. In certain embodiments, the LMP2 antigen is in complex with an MHC class I molecule having human leukocyte antigen subtype A1 (HLA-A11). LMP2 can exist in two isoforms, LMP2A or LMP2B. LMP2A is an EBV-encoded protein with three domains: (a) an N-terminal cytoplasmic domain, which has PY motifs that bind to WW domain-containing E3 ubiquitin ligases and an ITAM that binds to SH2 domain-containing proteins, (b) a transmembrane domain with 12 transmembrane segments that localizes LMP2A in cellular membranes, and (c) a 27-amino acid C-terminal domain which mediates homodimerization and heterodimerization of LMP2 protein isoforms. LMP2B, unlike LMP2A, does not contain the N-terminal 1-119 amino acids of the cytoplasmic signaling domain. In some embodiments, the LMP2 antigen can be a fragment from the amino acid sequence of SEQ ID NO:02. In some embodiments, the LMP2 antigen can be SSCSSCPLSK (SEQ ID NO:01)

(23) TABLE-US-00001 >sp|P13285|LMP2_EBVB9Latentmembraneprotein2 (SEQIDNO:02) MGSLEMVPMGAGPPSPGGDPDGYDGGNNSQYPSASGSSGNTPTPPNDEER ESNEEPPPPYEDPYWGNGDRHSDYQPLGTQDQSLYLGLQHDGNDGLPPPP YSPRDDSSQHIYEEAGRGSMNPVCLPVIVAPYLFWLAAIAASCFTASVST VVTATGLALSLLLLAAVASSYAAAQRKLLTPVTVLTAVVTFFAICLTWRI EDPPFNSLLFALLAAAGGLQGIYVLVMLVLLILAYRRRWRRLTVCGGIMF LACVLVLIVDAVLQLSPLLGAVTVVSMTLLLLAFVLWLSSPGGLGTLGAA LLTLAAALALLASLILGTLNLTTMFLLMLLWTLVVLLICSSCSSCPLSKI LLARLFLYALALLLLASALIAGGSILQTNFKSLSSTEFIPNLFCMLLLIV AGILFILAILTEWGSGNRTYGPVFMCLGGLLTMVAGAVWLTVMSNTLLSA WILTAGFLIFLIGFALFGVIRCCRYCCYYCLTLESEERPPTPYRNTV

(24) The terms T-cell receptor or TCR or engineered TCR refer to a molecule found on the surface of T-cells that is responsible for recognizing an antigen displayed on the surface of antigen-presenting cells (APCs). Each T-cell expresses a unique TCR that is generated by randomly assorting genes ensuring that T-cells can respond to almost any infection. TCRs can also recognize tumor-specific proteins (antigens) from the inside of cells. When tumor-specific proteins (i.e. LMP2) are broken into fragments, they show up on the cell surface with the major histocompatibility complex (MHC). MHC class I molecules present peptide antigens that are derived from intracellular proteins. TCRs can be engineered to recognize a tumor-specific protein fragment/MHC combination. In certain embodiments, the LMP2 antigen is in complex with an MHC class I molecule having human leukocyte antigen subtype A11 (HLA-A11). TCR structure is composed of two different protein chains comprising an alpha () chain and a beta () chain. In certain embodiments, the TCR can have one or more amino acid substitutions, deletions, insertions, or modifications compared to a naturally occurring sequence, so long as the TCR retains its ability to form TCRs in transfected T cells and maintain the ability to recognize the LMP2 antigen, and participate in immunologically-relevant cytokine signaling. The engineered TCRs preferably also bind target cells displaying the relevant tumor-associated peptide with high avidity, and optionally mediate efficient killing of target cells presenting the relevant antigen (LMP2). The heterodimeric TCR protein normally consisting of the highly variable alpha- and beta-chains expressed as part of a complex with the invariant CD3 chain molecules. The variable domains of both the TCR -chain and -chain each have three hypervariable or complementarity determining regions (CDRs). In one embodiment, the TCR comprises TCR-NPC-A11-003. In another embodiment, the TCR comprises TCR-NPC-A11-125.

(25) TABLE-US-00002 TCRA11-003sequences: TCRA11-003AminoAcid (SEQIDNO:03) MKRILGALLGLLSAQVCCVRGIQVEQSPPDLILQEGANSTLRCNFSDSVN NLQWFHQNPWGQLINLFYIPSGTKQNGRLSATTVATERYSLLYISSSQTT DSGVYFCAVVNNNDMRFGAGTRLTVKPDIQNPEPAVYQLKDPRSQDSTLC LFTDFDSQINVPKTMESGTFITDKTVLDMKAMDSKSNGAIAWSNQTSFTC QDIFKETNACYPSSDVPCDATLTEKSFETDMNLNFQNLSVMGRLILLLKV AGFNLLMTLRLWSSRAKRGSGATNFSLLKQAGDVEENPGPMGCRLLCCAV LCLLGAVPIDTEVTQTPKHLVMGMTNKKSLKCEQHMGHRAMYWYKQKAKK PPELMFVYSYEKLSINESVPSRFSPECPNSSLLNLHLHALQPEDSALYLC ASSPGRWYEQFFGPGTRLTVL TCRA11-03VariablealphachainAminoAcid (SEQIDNO:04) MKRILGALLGLLSAQVCCVRGIQVEQSPPDLILQEGANSTLRCNFSDSVN NLQWHQNPWGQLINLFYIPSGTKQNGRLSATTVATERYSLLYISSSQTTD SGVYFCAVVNNNDMRFGAGTRLTVKP TCRA11-003VariableCDR3alphaAminoAcid (SEQIDNO:05) AVVNNNDMRFG TCRA11-003VariablebetachainAminoAcid (SEQIDNO:06) MGCRLLCCAVLCLLGAVPIDTEVTQTPKHLVMGMTNKKSLKCEQHMGHRA MYWYKQKAKKPPELMFVYSYEKLSINESVPSRFSPECPNSSLLNLHLHAL QPEDSALYLCASSPGRWYEQFFGPGTRLTVL TCRA11-003VariableCDR3betaAminoAcid (SEQIDNO:07) ASSPGRWYEQF TCRA11-003NucleicAcid (SEQIDNO:08) ATGAAGAGAATCCTGGGCGCTCTGCTGGGACTGCTGTCTGCTCAAGTGTG CTGTGTGCGGGGCATCCAGGTGGAACAAAGCCCTCCTGACCTGATCCTGC AAGAGGGCGCCAATAGCACCCTGCGGTGCAACTTTAGCGACAGCGTGAAC AACCTGCAGTGGTTCCACCAGAATCCTTGGGGCCAGCTGATCAACCTGTT CTACATCCCCAGCGGCACCAAGCAGAACGGCAGACTGTCTGCTACCACCG TGGCCACCGAGAGATACAGCCTGCTGTACATCAGCAGCAGCCAGACCACA GACAGCGGCGTGTACTTTTGCGCCGTGGTCAACAACAACGACATGAGATT CGGAGCCGGCACCAGACTGACCGTGAAGCCCGATATCCAGAATCCAGAGC CTGCCGTGTACCAGCTGAAGGACCCTAGAAGCCAGGACAGCACCCTGTGC CTGTTCACCGACTTCGACAGCCAGATCAACGTGCCCAAGACCATGGAAAG CGGCACCTTCATCACCGACAAGACCGTGCTGGACATGAAGGCCATGGACA GCAAGAGCAACGGCGCCATTGCCTGGTCCAACCAGACCAGCTTCACATGC CAGGACATCTTCAAAGAGACAAACGCCTGCTATCCCAGCAGCGACGTGCC CTGTGATGCCACACTGACCGAGAAGTCCTTCGAGACAGACATGAACCTGA ACTTCCAGAACCTGAGCGTGATGGGCCTGCGCATCCTGCTGCTTAAAGTG GCCGGCTTCAACCTGCTGATGACCCTGAGACTGTGGTCCAGCAGGGCCAA GAGAGGAAGCGGCGCCACAAACTTTAGCCTGCTGAAACAGGCCGGCGACG TGGAAGAAAACCCTGGACCTATGGGCTGCAGACTGCTGTGTTGTGCCGTG CTGTGTCTGCTGGGCGCCGTGCCTATTGACACCGAAGTGACCCAGACACC TAAGCACCTGGTCATGGGCATGACAAACAAGAAAAGCCTGAAGTGCGAGC AGCACATGGGCCACAGAGCCATGTACTGGTACAAGCAGAAGGCCAAGAAA CCTCCAGAGCTGATGTTCGTGTACAGCTACGAGAAGCTGAGCATCAACGA GAGCGTGCCCAGCAGGTTCAGCCCTGAGTGTCCTAATAGCTCCCTGCTGA ATCTGCATCTGCACGCCCTGCAGCCTGAGGATTCTGCCCTGTACCTGTGT GCCAGCTCTCCCGGACGTTGGTACGAGCAGTTTTTCGGCCCTGGCACACG GCTGACAGTTCTG TCRA11-125sequences: TCRA11-125AminoAcid (SEQIDNO:09) MKRILGALLGLLSAQVCCVRGIQVEQSPPDLILQEGANSTLRCNFSDSVN NLQWFHQNPWGQLINLFYIPSGTKQNGRLSATTVATERYSLLYISSSQTT DSGVYFCAVLNNNDMRFGAGTRLTVKPDIQNPEPAVYQLKDPRSQDSTLC LFTDFDSQINVPKTMESGTFITDKTVLDMKAMDSKSNGAIAWSNQTSFTC QDIFKETNACYPSSDVPCDATLTEKSFETDMNLNFQNLSVMGLRILLLKV AGFNLLMTLRLWSSRAKRGSGATNFSLLKQAGDVEENPGPMGCRLLCCAV LCLLGAVPIDTEVTQTPKHLVMGMTNKKSLKCEQHMGHRAMYWYKQKAKK PPELMFVYSYEKLSINESVPSRFSPECPNSSLLNLHLHALQPEDSALYLC ASSQGRWYEAFFGQGTRLTVV TCRA11-125VariablealphaAminoAcid (SEQIDNO:10) MKRILGALLGLLSAQVCCVRGIQVEQSPPDLILQEGANSTLRCNFSDSVN NLQWFHQNPWGQLINLFYIPSGTKQNGRLSATTVATERYSLLYISSSQTT DSGVYFCAVLNNNDMRFGAGTRLTVKP TCRA11-125VariableCDR3alphaAminoAcid (SEQIDNO:11) AVLNNNDMRFG TCRA11-125VariablebetachainAminoAcid (SEQIDNO:12) MGCRLLCCAVLCLLGAVPIDTEVTQTPKHLVMGMTNKKSLKCEQHMGHRA MYWYKQKAKKPPELMFVYSYEKLSINESVPSRFSPECPNSSLLNLHLHAL QPEDSALYLCASSQGRWYEAFFGQGTRLTVV TCRA11-125VariableCDR3betaAminoAcid (SEQIDNO:13) ASSQGRWYEAF TCRA11-125NucleicAcid (SEQIDNO:14) ATGAAGAGAATCCTGGGCGCTCTGCTGGGACTGCTGTCTGCTCAAGTGTG CTGTGTGCGGGGCATCCAGGTGGAACAGTCTCCACCAGACCTGATCCTGC AAGAGGGCGCCAATAGCACCCTGCGGTGCAACTTTAGCGACAGCGTGAAC AACCTGCAGTGGTTCCACCAGAATCCTTGGGGCCAGCTGATCAACCTGTT CTACATCCCCAGCGGCACCAAGCAGAACGGCAGACTGTCTGCTACCACCG TGGCCACCGAGAGATACAGCCTGCTGTACATCAGCAGCAGCCAGACCACA GACAGCGGCGTGTACTTTTGCGCCGTGCTGAACAACAACGACATGAGATT CGGAGCCGGCACCAGACTGACCGTGAAGCCCGATATCCAGAATCCAGAGC CTGCCGTGTACCAGCTGAAGGACCCTAGAAGCCAGGACAGCACCCTGTGC CTGTTCACCGACTTCGACAGCCAGATCAACGTGCCCAAGACCATGGAAAG CGGCACCTTCATCACCGACAAGACCGTGCTGGACATGAAGGCCATGGACA GCAAGAGCAACGGCGCCATTGCCTGGTCCAACCAGACCAGCTTCACATGC CAGGACATCTTCAAAGAGACAAACGCCTGCTATCCCAGCAGCGACGTGCC CTGTGATGCCACACTGACCGAGAAGTCCTTCGAGACAGACATGAACCTGA ACTTCCAGAACCTGAGCGTGATGGGCCTGCGCATCCTGCTGCTTAAAGTG GCCGGCTTCAACCTGCTGATGACCCTGAGACTGTGGTCCAGCAGGGCCAA GAGAGGAAGCGGCGCCACAAACTTTAGCCTGCTGAAACAGGCCGGCGACG TGGAAGAAAACCCTGGACCTATGGGCTGCAGACTGCTGTGTTGTGCCGTG CTGTGTCTGCTGGGCGCCGTGCCTATTGACACCGAAGTGACCCAGACACC TAAGCACCTGGTCATGGGCATGACAAACAAGAAAAGCCTGAAGTGCGAGC AGCACATGGGCCACAGAGCCATGTACTGGTACAAGCAGAAGGCCAAGAAA CCTCCTGAGCTGATGTTCGTGTACAGCTACGAGAAGCTGAGCATCAACGA GAGCGTGCCCAGCAGGTTCAGCCCTGAGTGTCCTAATAGCTCCCTGCTGA ATCTGCATCTGCACGCCCTGCAGCCTGAGGATTCTGCCCTGTATCTGTGC GCCAGCTCTCAAGGACGTTGGTACGAGGCCTTCTTCGGCCAAGGCACAAG GCTGACAGTGGTG

(26) The term TCR-T cells as used herein refer to a T-cell or population of T-cells, which have been selected, isolated and/or characterized through molecular biological methods to express an engineered T-cell receptor as disclosed herein that is capable of being activated in response to an antigen of interest. In some embodiments, the T-cell population comprises peripheral blood mononuclear cells (PBMC's), which are any peripheral blood cell having a round nucleus. PBMC's can comprise of lymphocytes (T cells, B cells, NK cells), monocytes, and granulocytes (neutrophils, basophils, and eosinophils). In humans, lymphocytes make up the majority of the PBMC population, followed by monocytes, and only a small percentage of dendritic cells. In some embodiments, the T-cell population is isolated from PBMCs. In some embodiments, the TCR may be modified on any cell comprising a TCR, including, for example, a helper T cell, a cytotoxic T cell, a memory T cell, regulatory T cell, natural killer T cell, and gamma delta T cell. In certain embodiments, the T-cell receptor comprises a sequence capable of activating in response to a LMP2 antigen. In an embodiment, the TCR comprises TCR-NPC-A11-003. In another embodiment, the TCR comprises TCR-NPC-A11-125. Techniques for engineering and expressing T cell receptors include, but are not limited to, the production of TCR heterodimers which include the native disulphide bridge which connects the respective subunits (Garboczi, et al., (1996), Nature 384(6605): 134-41; Garboczi, et al., (1996), J Immunol 157(12): 5403-10; Chang et al., (1994), PNAS USA 91: 11408-11412; Davodeau et al., (1993), J. Biol. Chem. 268(21): 15455-15460; Golden et al., (1997), J. Imm. Meth. 206: 163-169; U.S. Pat. No. 6,080,840).

(27) The term antigen or Ag as used herein is defined as a molecule that provokes an immune response. This immune response may involve either antibody production, or the activation of specific immunologically-competent cells, or both. The skilled artisan will understand that any macromolecule, including virtually all proteins or peptides, can serve as an antigen. Furthermore, one skilled in the art will understand that an antigen need not be encoded solely by a full length nucleotide sequence of a gene. It is readily apparent that an antigen can be generated synthesized or can be derived from a biological sample. Such a biological sample can include, but is not limited to a tissue sample, a tumor sample, a cell or a biological fluid. In certain embodiments, the antigen of interest comprises a fragment of the LMP2 protein (SEQ ID NO:2). In some embodiments, the antigen of interest comprises SSCSSCPLSK (SEQ ID NO:1).

(28) As used herein, the terms specifically binds or selectively binds, when referring to an antibody/antigen, TCR/epitope, ligand/receptor, nucleic acid/complementary nucleic acid, or other binding pair (e.g., a cytokine to a cytokine receptor) indicate a binding reaction which is determinative of the presence of the protein in a heterogeneous population of proteins and other biologics. Thus, under designated conditions, a specified TCR or binding domain thereof binds to a particular antigen and does not bind in a significant amount to other proteins present in the sample. In particular, the engineered TCR as disclosed herein selectively recognizes or binds to preferably only one specific epitope (LMP2 antigen) and preferably shows no or substantially no cross-reactivity to another epitope, wherein said epitope is unique for one protein (LMP2), such that the antigen recognizing construct shows no or substantially no cross-reactivity to another epitope and another protein. Specific binding can also mean, e.g., that the binding compound, nucleic acid ligand, antibody, or binding composition derived from the antigen-binding site of an antibody, of the contemplated method binds to its target with an affinity that is often at least 25% greater, more often at least 50% greater, most often at least 100% (2-fold) greater, normally at least ten times greater, more normally at least 20-times greater, and most normally at least 100-times greater than the affinity with any other binding compound. In certain embodiments, the engineered T cell receptor, or derivative or fragment thereof, specifically binds a LMP2 antigen. A derivative or fragment of the TCR retains the antigen binding/recognizing ability of the parent molecule, in particular its specificity and/or selectivity. Such binding functionality may be retained by the presence of a CDR3 region.

(29) The term administration as it applies to a human, primate, mammal, mammalian subject, animal, veterinary subject, placebo subject, research subject, experimental subject, cell, tissue, organ, or biological fluid, refers without limitation to contact of an exogenous ligand, reagent, placebo, small molecule, pharmaceutical agent, therapeutic agent, diagnostic agent, or composition to the subject, cell, tissue, organ, or biological fluid, and the like. Administration can also refer to, for example, therapeutic, pharmacokinetic, diagnostic, research, placebo, and experimental methods. Treatment of a cell encompasses contact of a reagent to the cell, as well as contact of a reagent to a fluid, where the fluid is in contact with the cell. Administration can also encompass in vitro and ex vivo treatments, e.g., of a cell, by a reagent, diagnostic, binding composition, or by another cell. Routes of administration can include, but are not limited to, intravenous administration or infusion techniques. Infusion techniques can involve the administration of the population of activated T-cells through a needle or catheter. Typically, infusion means that the population of activated T-cells is administered intravenously or subcutaneously. In certain embodiments, the population of activated T-cells is administered systemically. In certain embodiments, the population of activated T-cells is administered intravenously (i.e., by intravenous (IV) injection). Preferred routes of administration are intraperitoneally or intravenously.

(30) TCR-T Cells

(31) The present disclosure relates, in part, to the preparation and use in recipients of TCR-T cell-derived effector cells which are capable of being activated in response to an antigen of interest (for example, LMP2). One aspect of the present disclosure provides a TCR-T cell-derived effector cell population comprising, consisting of, or consisting essentially of a population of T cells expressing a T cell receptor (TCR), the TCR comprising a sequence capable of activating in response to a LMP2 antigen. In one embodiment, the TCR comprises TCR-NPC-A11-003. In another embodiment, the TCR comprises TCR-NPC-A11-125.

(32) T-cells used in the methods disclosed herein can be isolated by methods known in the art, including commercially available isolation methods. Sources for the T-cells include, but are not limited to, peripheral blood, umbilical cord blood, bone marrow, or other sources of hematopoietic cells. Various techniques can be employed to separate the cells to isolate or enrich for desired T-cells. Furthermore, methods for expanding T-cells are well known in the art (see, for example see, for example, Cartellieri et al., A Novel Ex Vivo Isolation and Expansion Procedure for Chimeric Antigen Receptor Engrafted Human T Cells, 2014). Methods for isolating and expanding regulatory T-cells are also commercially available (see, for example, BD Biosciences, San Jose, Calif.; STEMCELL Technologies Inc., Vancouver, Canada: eBioscience, San Diego, Calif.; Invitrogen, Carlsbad, Calif.). The term expand as used herein refers to increasing in number, as in an increase in the number of T-cells. In an embodiment, the T-cells can be expanded ex vivo to increase in number relative to the number originally present in the culture. In another embodiment, the T-cells are expanded ex vivo to increase in number relative to other cell types in the culture. The term ex vivo, as used herein, refers to cells that have been removed from a living organism (e.g., a human) and propagated outside the organism (e.g., in a culture dish, test tube, or bioreactor). In some embodiments, the T-cells can be expanded by culturing in the presence of IL-2. In certain embodiments, the T-cells can be expanded by culturing in the presence of anti-CD3 antibodies and/or anti-CD28 antibodies. In some embodiments, the T-cells can be expanded by culturing in the presence of IL-2, and by culturing in the presence of anti-CD3 antibodies and/or anti-CD28 antibodies.

(33) Procedures for separation of cells include, but are not limited to, density gradient centrifugation, coupling to particles that modify cell density, magnetic separation with antibody-coated magnetic beads, affinity chromatography; cytotoxic agents joined to or used in conjunction with a monoclonal antibody (mAb), including, but not limited to, complement and cytotoxins, and panning with an antibody attached to a solid matrix, for example, a plate or chip, elutriation, flow cytometry, or any other convenient techniques.

(34) The isolated T-cells can be autologous or non-autologous to the subject to which they are administered in the methods of treatment of as disclosed herein. Autologous cells are isolated from the subject to which the population of T-cells comprising the engineered TCR are to be administered. In certain embodiments, autologous cells are isolated from the subject to which the isolated and expanded cells comprising the engineered TCR are to be administered. In some embodiments, the cells can be obtained by leukapheresis, where leukocytes are selectively removed from withdrawn blood, made recombinant, and then re-transfused into the donor subject. Alternatively, allogeneic cells from a non-autologous donor that is not the subject can be used. In the case of a non-autologous donor, the cells are typed and matched for human leukocyte antigen (HLA) to determine an appropriate level of compatibility, as is well known in the art. In an embodiment, the population of T-cells is matched for human leukocyte antigen A11 (HLA-A11). For both autologous and non-autologous cells, the cells can optionally be cryopreserved until ready to be used for genetic manipulation and/or administration to a subject using methods well known in the art.

(35) Because cytokine release is a necessary consequence of T-cell activation and efficacy, for effective TCR T-cell-based therapy, it is preferred that at least a portion of the activated T-cells produce one or more cytokines or are capable of producing one or more cytokines, such as one or more cytokines selected from the group consisting of IL-2. TNF- (alpha), and IFN- (gamma), Granzyme A, Granzyme B, GM-CSF, IL-1, IL-10, and IL-1. Additionally, at least a portion of the population of the population of T-cells expresses one or more surface markers selected from the group consisting of CD2, CD3, CD4, CD8, CD28, CTLA4, CD16/CD56, CD18, CD25, CD40 ligand (gp39), CD69, MHC Class I, MHC Class II, CD54, LFA-1, and VLA-4.

(36) Therapeutic Compositions

(37) The cell compositions T-cell populations as described herein can be administered to a subject, either alone or in combination with a pharmaceutically acceptable carrier, in an amount sufficient to induce an appropriate anti-tumor response. The response can comprise, without limitation, specific immune response, non-specific immune response, both specific and non-specific response, innate response, primary immune response, adaptive immunity, secondary immune response, memory immune response, immune cell activation, immune cell proliferation, immune cell differentiation, and cytokine expression.

(38) The present disclosure provides methods of generating an anti-tumor immunity in a subject by administering to the subject an effective amount of a TCR T-cell population. An effective amount as used herein means an amount which provides a therapeutic or prophylactic benefit. Effective amounts of TCR T-cells can be determined by a physician with consideration of individual differences in age, weight, tumor size, extent of infection or metastasis, and condition of the patient (subject). It can generally be stated that a pharmaceutical composition comprising the population of T-cells comprising the anti-LMP2 engineered TCRs as described herein may be administered at a dosage of 10.sup.4 to 10.sup.11 cells/kg body weight, preferably 10.sup.5 to 10.sup.10 cells/kg body weight, including all integer values within those ranges. In some embodiments, the population of T-cells is administered by infusion of about 2-10.sup.8 TCR-T cells. In some embodiments, about 510.sup.6 to about 510.sup.7 TCR-T cells per kg of patient is administered. T-cell compositions and T-cell populations may also be administered multiple times at these dosages. The cells can be administered by using infusion techniques that are commonly known in immunotherapy (see, e.g., Rosenberg et al, New Eng. J. of Med. 319: 1676, 1988). The optimal dosage and treatment regime for a particular patient can readily be determined by one skilled in the art of medicine by monitoring the patient for signs of disease and adjusting the treatment accordingly.

(39) An effective amount of the cell compositions comprising a population of T-cells expressing the T-cell receptor as described herein, may be given in one administration of a dose of the population of T-cells, but is not restricted to one dose. Thus, the administration can be two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, fifteen, sixteen, seventeen, eighteen, nineteen, twenty, or more, doses of the population of T-cells expressing the engineered TCRs as disclosed herein. In certain embodiments, three doses are administered. Where there is more than one administration of a dose, the administration of the doses can be spaced by time intervals of one minute, two minutes, three, four, five, six, seven, eight, nine, ten, or more minutes, by intervals of about one hour, two hours, three, four, five, six, seven, eight, nine, ten, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 hours, and so on. In the context of hours, the term about means plus or minus any time interval within 30 minutes. The administration of the doses can also be spaced by time intervals of one day, two days, three days, four days, five days, six days, seven days, eight days, nine days, ten days, 11 days, 12 days, 13 days, 14 days, 15 days, 16 days, 17 days, 18 days, 19 days, 20 days, 21 days, or more, and any combination thereof. The invention is not limited to dosing intervals that are spaced equally in time, but also can encompass doses at non-equal intervals, such as a priming schedule consisting of administration at, for example, 1 day, 4 days, 7 days, and 25 days.

(40) As used herein, the terms pharmaceutically acceptable carrier or pharmaceutically acceptable excipient refer to any material which, when combined with the population of T-cells comprising the engineered TCRs, allow the population of T-cells to retain biological activity. Examples include, but are not limited to, any of the standard pharmaceutical carriers such as a phosphate buffered saline solution, water, emulsions such as oil/water emulsion, amino acid-based buffers, or bicarbonate buffered solutions, and various types of wetting agents. In certain embodiments, the carrier does not produce adverse, allergic, or other untoward reactions when administered to a subject. In some embodiments, the pharmaceutical composition comprising the carrier is free of pyrogens, as well as other impurities that could be harmful to the subject. Pharmaceutically acceptable carriers can include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents and the like; the use of which are well known in the art. Acceptable carriers, excipients or stabilizers are nontoxic to recipients and are preferably inert at the dosages and concentrations employed, and include buffers such as phosphate, citrate, or other organic acids; antioxidants such as ascorbic acid, low molecular weight polypeptides; proteins, such as scrum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, arginine or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugar alcohols such as mannitol or sorbitol; salt-forming counterions such as sodium; and/or nonionic surfactants such as Tween, Pluronics or polyethylene glycol (PEG). Compositions comprising such carriers are formulated by well-known conventional methods (see, for example, Remington's Pharmaceutical Sciences, 18th edition, A. Gennaro, ed., Mack Publishing Co., Easton, Pa., 1990; and Remington, The Science and Practice of Pharmacy 21st Ed. Mack Publishing, 2005). The carrier selected and the amount of carrier used can depend upon the mode of administration.

(41) An effective amount for a particular subject/patient can vary depending on factors such as the condition or cancer being treated, the overall health of the patient, the route and dose of administration and the severity of side effects. Guidance for methods of treatment and diagnosis is available (see, e.g., Maynard, et al. (1996) A Handbook of SOPs for Good Clinical Practice. Interpharm Press, Boca Raton, Fla.; Dent (2001) Good Laboratory and Good Clinical Practice, Urch Publ., London, UK). Determination of the number of cells to be administered will be made by one of skill in the art, and will in part be dependent on the extent and severity of cancer, and whether the transfected cells are being administered for treatment of existing cancer or prevention of cancer. The preparation of the pharmaceutical composition containing the population of T-cells comprising the engineered TCRs will be known to those of skill in the art in light of the present disclosure.

(42) The population of T-cells expressing an engineered TCR of the present disclosure can be administered in a dose, or dosages, where each dose comprises at least 100 cells/kg body weight; at least 1,000 cells/kg body weight; at least 10,000 cells/kg body weight; at least 100,000 cells/kg body weight; at least 1,000,000 cells/kg body weight; at least 10,000,000 cells/kg body weight; at least 100,000,000 cells/kg body weight; at least 110.sup.9 cells/kg body weight; at least 1010.sup.9 cells/kg body weight; at least 10010.sup.9 cells/kg body weight; or at least 110.sup.12 cells/kg body weight.

(43) A dosing schedule of, for example, once/week, twice/week, three times/week, four times/week, five times/week, six times/week, seven times/week, once every two weeks, once every three weeks, once every four weeks, once every five weeks, and the like, can be used. The dosing schedules encompass dosing for a total period of time of, for example, one week, two weeks, three weeks, four weeks, five weeks, six weeks, two months, three months, four months, five months, six months, seven months, eight months, nine months, ten months, eleven months, and up to twelve months or more.

(44) Provided are cycles of the above dosing schedules. The cycle can be repeated about, e.g., every seven days; every 14 days; every 21 days; every 28 days; every 35 days; 42 days; every 49 days; every 56 days; every 63 days; every 70 days; and the like. An interval of non-dosing can occur between a cycle, where the interval can be about, e.g., seven days; 14 days; 21 days; 28 days; 35 days; 42 days; 49 days; 56 days; 63 days; 70 days; and the like. In this context, the term about means plus or minus one day, plus or minus two days, plus or minus three days, plus or minus four days, plus or minus five days, plus or minus six days, or plus or minus seven days.

(45) The TCR T-cells according to the present disclosure may also be administered with one or more additional therapeutic agents. Methods for co-administration with an additional therapeutic agent are well known in the art (for example, Hardman, et al. (eds.) (2001) Goodman and Gilman's The Pharmacological Basis of Therapeutics, 10th ed., McGraw-Hill, New York. N.Y.; Poole and Peterson (eds.) (2001) Pharmacotherapeutics for Advanced Practice: A Practical Approach, Lippincott, Williams & Wilkins, Phila., Pa., Chabner and Longo (eds.) (2001) Cancer Chemotherapy and Biotherapy, Lippincott, Williams & Wilkins, Phila., Pa.). Examples include, but are not limited to, chemotherapeutic agents, radiation, anti-cancer agents, anti-inflammatory agents, anti-infective agents, NSAIDS, anti-pain agents, and the like. The additional therapeutic may also comprise a different TCR-T effector population. Other agents that can be part of the therapeutic regimen of the subject, such as other immunotherapy, checkpoint inhibitors, immuno-oncology drugs, targeted agents, chemotherapy, and/or radiation. Examples of agents/therapeutic regimens that may be used in combination with the compositions of the present disclosure include, but are not limited to, CTLA-4 inhibitors, PD-1 inhibitors, and/or PD-L1 inhibitors, CSF-1R inhibitors, TLR agonists, nivolumab, pembrolizumab, ipilimumab, atezolizumab, alemtuzumab, avelumab, ofatumumab, nivolumab, pembrolizumab, rituximab, durvalumab, cytokine therapy, interferons, interferon-alpha, interleukins, interleukin-2, dendritic cell therapy (e.g. Sipuleucel-T), CHOP, cyclophosphamide, fludarabine, methotrexate, 5-fluorouracil, vinorelbine, doxorubicin, docetaxel, bleomycin, dacarbazine, mustine, procarbazine, prednisolone, etoposide, cisplatin, epirubicin, folinic acid, and oxaliplatin. The T-cell population compositions of the disclosure may be administered before the additional therapeutic agent(s), concurrently with the additional therapeutic agent(s), or after the additional therapeutic agent(s).

(46) Co-administration need not refer to administration at the same time in an individual, but rather may include administrations that are spaced by hours or even days, weeks, or longer, as long as the administration of multiple therapeutic agents is the result of a single treatment plan. The co-administration may comprise administering the TCR-T cell population of the present disclosure before, after, or at the same time as the one or more additional therapeutics. The co-administration may comprise administering a TCR T-cell population of the present disclosure before, after, or at the same time as an another TCR T-cell population. In an exemplary treatment schedule, a TCR T-cell population (e.g. A11-003) of the present disclosure may be given as an initial dose in a multi-day protocol, with another TCR T-cell population (e.g. A11-125) given on later administration days; or the TCR T-cells (e.g. A11-125) given as an initial dose in a multi-day protocol, with the TCR T-cells (e.g. A11-003) given on later administration days. On another hand, A11-003 TCR T-cells and A-125 TCR T-cells may be administered on alternate days in a multi-day protocol. This is not meant to be a limiting list of possible administration protocols.

(47) An effective amount of a therapeutic agent is one that will decrease or ameliorate the symptoms of the cancer normally by at least 10%, more normally by at least 20%, most normally by at least 30%, typically by at least 40%, more typically by at least 50%, most typically by at least 60%, often by at least 70%, more often by at least 80%, and most often by at least 90%, conventionally by at least 95%, more conventionally by at least 99%, and most conventionally by at least 99.9%. For example, administration of the population of T-cells comprising an engineered TCR as disclosed herein reduces tumor growth by about 1%, about 5%, about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, or about 100% for about 1, about 2 days, about 3 days, about 4 days, about 5 days, about 6 days, about 1 week, about 2 weeks, about 3 weeks, about 4 weeks, about 1 month, about 2 months, about 3 months, about 4 months, about 5 months, about 6 months, about 1 year, about 2 years, about 5 years, or about 10 years or more compared with controls or patients treated with other cancer treatments, or the same patient before treatment.

(48) Formulations of therapeutic agents may be prepared for storage by mixing with physiologically acceptable carriers, excipients, or stabilizers in the form of, e.g., lyophilized powders, slurries, aqueous solutions or suspensions (see, e.g., Hardman, et al. (2001) Goodman and Gilman's The Pharmacological Basis of Therapeutics, McGraw-Hill, New York, N.Y.; Gennaro (2000) Remington: The Science and Practice of Pharmacy, Lippincott, Williams, and Wilkins, New York, N.Y.; Avis, et al. (eds.) (1993) Pharmaceutical Dosage Forms: Parenteral Medications, Marcel Dekker, NY; Lieberman, et al. (eds.) (1990) Pharmaceutical Dosage Forms: Tablets, Marcel Dekker. NY; Lieberman, et al. (eds.) (1990) Pharmaceutical Dosage Forms: Disperse Systems, Marcel Dekker, NY: Weiner and Kotkoskic (2000) Excipient Toxicity and Safety, Marcel Dekker, Inc., New York, N.Y.).

(49) Methods of Making

(50) The present disclosure provides a method preparing a population of T-cells expressing an engineered T-cell receptor (TCR) as disclosed herein, wherein the method comprises: (1) transfecting or transducing isolated T-cells with a nucleic acid encoding the engineered TCR as disclosed herein; and (2) expanding the engineered TCR-expressing T-cells following transfection or transduction, wherein the T-cells are expanded by culturing in the presence of IL-2 and/or CD3 and CD28 antibodies. In certain embodiments, the T-cells are expanded by culturing in the presence of IL-2. In certain embodiments, the T-cells are expanded by culturing in the presence of anti-CD3 antibodies. In certain embodiments, the T-cells are expanded by culturing in the presence of anti-CD28. In certain embodiments, the method of preparing the population of T-cells comprising the engineered TCR takes about 2 weeks, about 3 weeks or about 4 weeks. In certain embodiments, the method of preparing the population of T-cells comprising the engineered TCR takes less than 2 weeks, less than 3 weeks or less than 4 weeks. In certain embodiments, the T-cells are expanded by culturing in the presence of IL-2, anti-CD3 antibodies, and anti-CD28 antibodies. In certain embodiments, the isolated T-cells are isolated from a mammal. In and embodiment, the mammal is a human. In certain embodiments, the human is a subject suffering from a cancer expressing LMP2 from EBV. In an embodiment of the method, the isolated T-cells comprise HLA-A11.

(51) Methods of introducing nucleic acids into a T-cell include physical, biological and chemical methods. Physical methods for introducing a polynucleotide, such as DNA or RNA into a host cell include calcium phosphate precipitation, lipofection, particle bombardment, microinjection, or electroporation. Nucleic acids can be introduced into target cells using commercially available methods which include electroporation, or cationic liposome mediated transfection using lipofection, or using polymer encapsulation, using peptide mediated transfection, or using biolistic particle delivery systems such as gene guns. Biological methods for introducing nucleic acids into a host cell can include the use of DNA and RNA vectors. Viral vectors, and in particular retroviral vectors, are widely used for inserting nucleic acid into human cells. Other viral vectors can be derived from lentivirus, poxviruses, herpes simplex virus I, adenoviruses and adeno-associated viruses. Examples of vectors are plasmids, autonomously replicating sequences, and transposable elements. Additional exemplary vectors can include, without limitation, plasmids, phagemids, cosmids, artificial chromosomes such as yeast artificial chromosome (YAC), bacterial artificial chromosome (BAC), or P1-derived artificial chromosome (PAC), bacteriophages such as lambda phage or M13 phage, and animal viruses. Examples of animal viruses useful as vectors can include, without limitation, retrovirus (including lentivirus), adenovirus, adeno-associated virus (AAV), herpesvirus (e.g., herpes simplex virus), poxvirus, baculovirus, papillomavirus, and papovavirus (e.g., SV40). In certain embodiments, the vector comprising the TCR can be a retroviral vector.

(52) Yet another aspect of the present disclosure provides a method of preparing a TCR-T cell-derived effector cell population comprising a population of activated T cells expressing a T cell receptor (TCR), the TCR comprising a sequence capable of activating in response to a LMP2 antigen, the method comprising, consisting of, or consisting essentially of: contacting in vitro one or more peripheral blood mononuclear cells (PBMCs) that were used to treat a patient or patients having a cancer of interest (for example, NPC); stimulating the T cells with dendritic cells expressing an antigen of interest (for example LMP2); isolating and characterizing those T cells that respond to said antigen of interest; and expanding the T cell population. In some embodiments, the method further comprises administering a therapeutically effective amount of the isolated T cell population, or a pharmaceutical composition thereof, to a patient suffering from the cancer of interest. In certain embodiments, the TCR comprises TCR-NPC-A11-003 (SEQ ID NO:3). In another embodiment, the TCR comprises TCR-NPC-A11-125 (SEQ ID NO:9). In some embodiments, the cancer of interest is characterized by the expression of LMP2. In some embodiments, the cancer is selected from the group consisting of nasopharyngeal carcinoma (NPC), gastric cancer, lung cancer, melanoma, breast cancer, prostate cancer, colon cancer, renal cell carcinoma, ovarian cancer, neuroblastoma, rhabdomyosarcoma, leukemia and lymphoma. In an embodiment, the cancer comprises NPC. In another embodiment, the cancer comprises lymphoma. In yet another embodiment, the cancer comprises gastric cancer. In certain embodiments, the cancer is an EBV-associated cancer or an EBV-positive caner, for example, EBV-positive Hodgkin's Lymphoma. EBV-positive Burkitt Lymphoma, EBV-positive nasopharyngeal carcinoma, or EBV-positive gastric cancer.

(53) Methods of Using

(54) The TCR-T effector cells according to the present disclosure can be used to treat subject suffering from disease, such as cancer. Accordingly, another aspect of the present disclosure provides a method of inducing a T-cell response in a subject suffering from a LMP2-characterized cancer, the method comprising, consisting of, or consisting essentially of administering to the subject a therapeutically effective amount of a TCR-T cell-derived cell population as described herein such that an anti-tumor response to the LMP2-characterized cancer is induced. Yet another aspect of the present disclosure comprises a method of treating a cancer in a subject comprising, consisting of, or consisting essentially of administering to the subject a therapeutically effective amount of a TCR-T cell-derived population as provided herein such that the cancer is treated.

(55) Yet another aspect of the present disclosure provides all that is disclosed and illustrated herein.

(56) The following Examples are provided by way of illustration and not by way of limitation.

EXAMPLES

Example 1. Two Novel TCR Sequences Activate in Response to LMP2 Antigen

(57) Peripheral blood mononuclear cells (PBMCs) were obtained that were previously used to treat NPC patients and stimulated with dendritic cells presenting the EBV antigen latent membrane protein 2 (LMP2). This led to the discovery of two novel T cell receptor (TCR) sequences capable of activating in response to the LMP2 antigen (1) TCR-NPC-A11-003 (AA SEQ ID NO:03; DNA SEQ ID NO:08) (see FIGS. 1A-1B), and (2) TCR-NPC-A11-125 (AA SEQ ID NO:09; DNA SEQ ID NO:14) (see FIGS. 2A-2B).

Example 2. Novel TCR Sequences TCR-NPC-A11-003 and TCR-NPC-A11-125 Kill Cells Expressing LMP2 Antigen

(58) Consistent with the CD69 activation results of Example 1, both TCR-NPC-A11-003 and TCR-NPC-A11-125 can specifically kill lymphoma cells engineered to express the LMP2 peptide linked to HLA-A11, but not HLA-A24 (see FIG. 3A-3B).

Example 3. Novel TCR Sequences TCR-NPC-A11-003 and TCR-NPC-A1-125 Have In-Vivo Antitumor Activity in Mice

(59) Mouse xenograft studies demonstrate that both TCRs have in vivo antitumor efficacy against LMP2-A11-positive lymphoma. A11-positive Ramos lymphoma cells (510.sup.6) were subcutaneously inoculated in NSG (NOD SCID gamma mouse mice). After 13 days, 110.sup.7 TCR-positive TCR-NPC-A11-003 or TCR-NPC-A11-125 TCR-T cells were injected via tail vein. Tumor volume was significantly reduced in mice injected with TCR-NPC-A11-003 or TCR-NPC-A11-125 TCR-T cells, and these mice also had a significant increase in overall survival compared to untreated mice (see FIG. 4A-4C).

(60) Together, these findings characterize LMP2-A11 TCR-T cells as capable of selectively killing cells harboring the LMP2 EBV viral antigen. It is important to note that both of these TCRs (TCR-NPC-A11-003 and TCR-NPC-A11-125) were identified from patient cells with the HLA-A11 serotype. HLA-A11 is particularly common in East Asia and therefore these TCRs have utility for engineered TCR-T cell therapy against EBV-associated NPC as well as lymphomas including Hodgkin and Burkitt's. This therapeutic approach also significantly lessens the time window needed to establish EBV-CTL therapies, as patient-specific TCR-T cell products can now be generated in only 3 weeks. Because no other TCR sequences capable of recognizing the LMP2 antigen presented by HLA-A11 have been previously identified, these results uncover two novel viral antigen-specific TCRs as promising agents for the treatment of at least EBV-positive NPC, gastric cancer, and lymphoma.

Example 4. Systematic T Cell Receptor Repertoire Profiling and Cloning to Improve Therapeutic Outcomes in Advanced EBV-Specific Nasopharyngeal Carcinoma

(61) Nasopharyngeal carcinoma (NPC) is highly prevalent in South China and Southeast Asia with few treatment options for late stage disease. While the current standard therapies are limited by non-specific toxicity, NPC is often associated with Epstein-Barr virus (EBV) infection, making it an excellent target for adoptive immunotherapy. For Stage IV EBV-associated NPC, a recent phase 2 clinical trial reported impressive response rates using in vitro expanded EBV-specific cytotoxic T lymphocytes (EBV-CTLs; see FIG. 5A). Although this study was successful and a phase 3 trial using the same protocol is currently underway, approximately half of the patients enrolled did not respond to the CTL treatment regimen, suggesting the involvement of unknown resistance mechanisms conferring immune evasion. Moreover, the time to generate the EBV-CTL cells used for immunotherapy ranged from 8 to 22 weeks, which is prohibitive for many patients with advanced NPC and can be significantly shortened using next-generation immune cell therapy with antigen specificity-redirected T cells.

(62) Dendritic cell (DC) vaccination is a type of cancer immunotherapy that employs DCs' intrinsic ability to present antigen to T cells. While generally faster and cheaper in production than T cell therapy, DC vaccines have also been less reliably efficacious, although the molecular basis underlying clinical responsiveness to DC vaccination is elusive. In a 2007 clinical trial, among the 16 advanced NPC patients treated, a first-inhuman Ad5f35-LMP1-2 adenoviral vector-transduced DC vaccine led to disease stabilization for >18 weeks in two patients (12.5%) and partial response in one patient (see FIG. 5B).

(63) T cell receptor (TCR) repertoire sequencing is performed to dissect TRC diversity in responders and non-responders, which provides additional insight into resistance mechanisms and guide the development of improved immunotherapy approaches for the treatment of NPC.

(64) I. Identification of Molecular Determinants Underlying Response to Immunotherapy

(65) a. Discovery of MPC Prognostic Factors Via Unbiased Profiling

(66) To discover molecules governing responsiveness to EBV-specific DC vaccination, systematic cytokine/chemokine/growth factor arrays is utilized. Briefly, peripheral blood mononuclear cells (PBMCs) harvested from advanced NPC patients are sorted by flow cytometry into discreet immune cell populations including monocytes, macrophages, B cells, NK cells, and T cell subpopulations including cytotoxic, helper, memory, and regulatory T cells. After sorting, mRNA and cDNA is generated and subjected to comprehensive qPCR gene expression analysis using a panel of >100 secreted proteins. This procedure enables the identification of specific proteins regulating resistance to DC-based immunotherapy, which might be rationally targeted or otherwise exploited to improve future patient outcomes in this therapeutic context. Validation of the role of the uncovered molecules in EBV-driven cancer can be performed ex vivo and in mice using the EBV-positive lymphoma models described herein.

(67) ii. Analyze the TCR Repertoire of Responders and Non-Responders in DC Vaccine-Treated Advanced NPC

(68) The inventors have developed a platform/system to profile the TCR repertoire within various human and mouse tissues with high reproducibility. The system comprises, consists of, or consists essentially of a multiplex PCR system that allows for the preferential read out of TCR sequences on an Illumina MiSeq platform. The system further comprises a novel bioinformatics strategy, termed Motif Analysis, that identifies minimal structural determinants enabling antigen recognition and thereby reliably dissecting out antigen specific T cell responses from global repertoire changes during immunotherapies. This is critical to optimize the chance of TCR cloning when their targeted epitope has weak affinity or low abundance.

(69) The inventors utilized this novel system, to assess the TCR repertoire in PBMC samples from advanced NPC patients who either responded (n=3) or did not respond (n=13) to EBV-specific DC vaccination. For this analysis, the following will be compared: i) global TCR diversity; ii) EBV-specific T cell responses; and iii) tumor-associated antigen (TAA) specific T cell responses longitudinally for each individual patient.

(70) Also, inter-patient repertoire similarity to identify dominant antigen (e.g., anti-PV clonotypes) responses is compared. Further, the method includes the following steps: i) Global TCR diversity analyses is performed as previously published, and will provide a comprehensive view of the dynamic changes of T cell clones within individual patients, ii) For EBV-specific T cell responses, LMP1-2 adenoviral vector transduced DCs is cocultured with autologous T cells. Antigen-expanded T cells are sorted for TCR repertoire sequencing to determine the breadth and strength of the anti-EBV T cell repertoire. iii) To assess TAA-specific T cell responses, patient DCs (from PBMCs) are exposed to peptides/peptide pools representing TAAs investigated in this study (e.g. EGFR, survivin). With antigen expanded CD4+ and CD8+ TCR sequences (from ii and iii) as a training data set, TAA motifs and motif combinations can be identified. Through Jaccard similarity (distance)=analysis, a network is constructed and TCRs are assembled into clusters based on Jaccard distances calculated for each pair of TCRs (see FIG. 6). In this way, novel clonotypes (breadth) and frequency (depth) of TCRs in the original unstimulated sample (from i) are discovered. By quantifying the collective frequency of TAA-specific TCRs, treatment-elicited antitumor T cell responses are monitored.
II. Molecular Biology Platform DevelopmentCost-Efficient TCR Cloning Enabling a TCR-T strategy for NPC
a: FBV-Specific TCR Cloning

(71) As a proof-of-principle study using single T cell RNA-Seq technology, the inventors have successfully performed high-throughput cloning of cytomegalovirus (CMV)-specific TCRs. These TCRs were expressed in PBMCs through retroviral transduction, and their specificity and cytotoxicity was validated in vitro (see FIG. 7). Using the same technology, the inventors assembled a small library (up to 20) of TCR-expressing viruses and employ the TCR production procedure described herein to generate EBV-specific TCR-T cells. Since EBV-positive NPC cell lines have not been established, EBV-positive lymphoma cells are used to assess the killing capacity of TCR-T cells. Each TCR-T cell line is tested in vitro for its specificity to kill the EBV-positive Raji lymphoma cells but not EBV-negative Ramos cells. Any TCR that fails this functional test is replaced with a new one with similar characteristics as identified by RNA-Seq.

(72) b: Establish the Safety of TCR-T Cell Therapy in Mice Bearing EBV-Positive Lymphoma

(73) MHC-humanized mice are treated with a mixed TCR-T population consisting of 5 CD4+ and 5 CD8+ TCRs against the EBV epitope. In this design, rapid EBV specific T-cell expansion and cytolytic activity against tumors using CD8+ T cells are delivered; and CD4+ T cells are utilized to enforce efficient CD8+ memory T-cell differentiation to achieve long-term protection. The clinical value of this strategy is formally examined for its toxicity and efficacy. To exclude potential toxicities, animal toxicity assays are conducted. In accordance with FDA guidelines, acute and chronic toxicity studies are performed at 3 dose levels for assessment of histopathologic toxicity, carcinogenicity, dermal toxicity, and neurotoxicity in a single rodent species. Acute studies comprise intravenous (IV) infusion followed by a 2-week observation period. Chronic studies consist of IV infusion followed by a 6-month observation period. Dose levels translate to doses that are similar to perfusion procedures in human trials, which allows for direct translation into future human studies. Whole blood counts, chemistries, enzymes, and autoimmune serology are monitored weekly, and mice are assessed daily by weight and neurological examination. Mice are autopsied at death or when they show defined signs of toxicity or neurological deficit. The safety of EBV TCR-T cells is monitored in all experiments outlined below as well using the same clinical, chemical, immunological, histopathological, and statistical evaluations.

(74) c: Establish the Efficacy of TCR-T Cell Therapy in Mice Bearing EBV-Positive Lymphoma

(75) The efficacy of the generated EBV TCR-T strategy is evaluated using a tumor xenograft model in NOD/SCID mice. 110.sup.6 EBV+Raji cells are subcutaneously transplanted, and tumor sizes are measured daily. Three weeks after inoculation, EBV TCR-T cells (CD4+ TCR-T cells, CD8+ TCR-T cells, or the combination) are intravenously infused into tumor-bearing mice. Mice with established tumor display prolonged survival after IV delivery of the MTD or the maximum feasible dose of 210.sup.7 EBV-specific TCR-T cells are assessed. Two additional tumor-bearing cohorts will receive dose-matched T cells with control GFP-transduced T cells or tumor alone. Success in treating these tumors with EBV-specific TCR-T guides the development of future clinical trials for EBV-positive cancers based on the same TCR cloning principles.

(76) One skilled in the art will readily appreciate that the present invention is well adapted to carry out the objects and obtain the ends and advantages mentioned, as well as those inherent therein. The present disclosure described herein are presently representative of preferred embodiments, are exemplary, and are not intended as limitations on the scope of the invention. Changes therein and other uses will occur to those skilled in the art which are encompassed within the spirit of the invention as defined by the scope of the claims.

(77) No admission is made that any reference, including any non-patent or patent document cited in this specification, constitutes prior art. In particular, it will be understood that, unless otherwise stated, reference to any document herein does not constitute an admission that any of these documents forms part of the common general knowledge in the art in the United States or in any other country. Any discussion of the references states what their authors assert, and the applicant reserves the right to challenge the accuracy and pertinence of any of the documents cited herein. All references cited herein are fully incorporated by reference, unless explicitly indicated otherwise. The present disclosure shall control in the event there are any disparities between any definitions and/or description found in the cited references.