MODULATING ALKALOID PROFILES IN NICOTIANA TABACUM

20240368615 ยท 2024-11-07

Assignee

Inventors

Cpc classification

International classification

Abstract

A non-naturally occurring or transgenic Nicotiana tabacum plant cell encompassing a heterologous polynucleotide that encodes arginine decarboxylase (ADC) and a method for producing such a cell are provided. Transgenic Nicotiana tabacum plants, plant parts, and plant tissues including these cells and plant materials and biomass produced by these cells and plants cells forming such a plant are provided. Materials produced by this plant, including plant leaves, flowers, seeds, extracts, and other plant biomass obtained from this plant including materials that have altered alkaloid levels are disclosed. Also provided are smoking articles including various tobacco products containing these materials.

Claims

1.-15. (canceled)

16. A non-naturally occurring Nicotiana tabacum plant cell comprising a heterologous polynucleotide that has at least 96% sequence identity to SEQ ID NO: 1, at least 97% sequence identity to SEQ ID NO: 3, or at least 96.5% sequence identity to SEQ ID NO: 5, wherein the heterologous polynucleotide encodes arginine decarboxylase (ADC).

17. The non-naturally occurring Nicotiana tabacum plant cell of claim 16 that encodes a heterologous polypeptide that has at least 97% sequence identity to SEQ ID NO: 2, at least 97.5% sequence identity to SEQ ID NO: 4, or at least 97.5% sequence identity to SEQ ID NO: 6.

18. The non-naturally occurring Nicotiana tabacum plant cell of claim 16 that is a transgenic plant cell produced by transforming a host Nicotiana tabacum plant cell with the heterologous polynucleotide.

19. The non-naturally occurring Nicotiana tabacum plant cell of claim 16 which expresses an altered level of one or more alkaloids compared to an otherwise identical control Nicotiana tabacum plant cell not comprising the heterologous polynucleotide, wherein the alkaloids are selected from the group consisting of nicotine, nornicotine, anabasine, and anatabine.

20. The non-naturally occurring Nicotiana tabacum plant cell of claim 16, wherein the at least one heterologous polynucleotide encoding the ADC comprises a heterologous polynucleotide from Nicotiana glauca or Nicotiana debneyi.

21. The non-naturally occurring Nicotiana tabacum plant cell of claim 16, wherein levels of nicotine and nornicotine are decreased compared to an otherwise identical control Nicotiana tabacum plant cell not comprising the heterologous polynucleotide, and wherein levels of anabasine and anatabine range from about 90% to about 110% the levels of those in an otherwise identical control Nicotiana tabacum plant cell not comprising the heterologous polynucleotide.

22. The non-naturally occurring Nicotiana tabacum plant cell of claim 16, wherein levels of nicotine, anabasine, and anatabine are increased as compared to an otherwise identical control Nicotiana tabacum plant cell not comprising the heterologous polynucleotide, and wherein a level of nornicotine is the same or increased as compared to an otherwise identical control Nicotiana tabacum plant cell not comprising the heterologous polynucleotide.

23. The non-naturally occurring Nicotiana tabacum plant cell of claim 16, wherein expression of ADC in the plant cell is reduced or the ADC is inactivated compared to an otherwise identical control Nicotiana tabacum plant cell not comprising the heterologous polynucleotide.

24. A Nicotiana tabacum plant, tissue, or part thereof comprising the non-naturally occurring Nicotiana tabacum plant cell according to claim 16.

25. A transgenic Nicotiana tabacum plant propagated from the non-naturally occurring plant cell according to claim 16.

26. A plant material from the Nicotiana tabacum plant, tissue, or part thereof according to claim 24, wherein the plant material is a cured or dried plant material, and wherein the cured or dried plant material is flue-cured, fire-cured, smoke-cured, sun-cured, or air-cured.

27. A tobacco product or smoking article comprising the Nicotiana tabacum plant material according to claim 26.

28. A method for producing the non-naturally occurring Nicotiana tabacum plant cell of claim 16, comprising: (a) providing a host cell from a Nicotiana tabacum plant; and (b) transforming or otherwise modifying the host cell to comprise the heterologous polynucleotide encoding an ADC.

29. A method of altering a level of one or more alkaloids in a Nicotiana tabacum plant, comprising: performing steps (a) and (b) of claim 28; and regenerating the non-naturally occurring or transgenic host Nicotiana tabacum plant cell into a Nicotiana tabacum plant, wherein the one or more alkaloids are selected from nicotine, nornicotine, anabasine, and anatabine.

30. A method for producing Nicotiana tabacum plant material with altered levels of one or more alkaloids, comprising: performing steps (a) and (b) of claim 28; propagating the Nicotiana tabacum plant; and harvesting plant material from the Nicotiana tabacum plant, wherein the one or more alkaloids with altered levels are selected from the group consisting of nicotine, nomnicotine, anabasine, and anatabine.

31. The method of claim 30, further comprising curing or drying the harvested plant material.

32. The method of claim 30, further comprising homogenizing the harvested plant material and extracting one or more alkaloids from the homogenized plant material.

33. The method of claim 30, further comprising separating one or more alkaloids of interest from other alkaloids, wherein the one or more alkaloids of interest comprises anatabine or anabasine.

34. A dried or lyophilized green plant leaf harvested from a mature flowering Nicotiana tabacum plant comprising at least one ratio of alkaloid components selected from the group consisting of: a ratio of anabasine:anatabine of between about 0.19 and about 0.25, a ratio of anabasine:nornicotine of between about 0.09 and about 0.15, a ratio of anabasine:nicotine of between 0 and about 0.01, a ratio of anatabine:nornicotine of between about 0.58 and about 0.73, a ratio of anatabine:nicotine of between about 0.03 and about 0.04, and a ratio of nornicotine:nicotine of between about 0.05 and about 0.06.

35. The non-naturally occurring Nicotiana tabacum plant cell of claim 16 that has substantially a same growth phenotype as an otherwise identical control plant not comprising the heterologous polynucleotide.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

[0035] FIG. 1 is a series of graphs showing the expression of (A) NgADC1, (B) NgADC2 and (C) NdADC1 in TO transgenic overexpressing (OE) single plants.

[0036] FIG. 2 is a series of graphs showing the overexpression of NgADC1 in TN90 (T0) plants. n=5, t-test, *p<0.05, **P<0.01. Significant reduction of nicotine 26%. Significant reduction of nornicotine 24%.

[0037] FIG. 3 is a series of graphs showing the overexpression of NgADC2 in TN90 (T0) plants. n=5, t-test, *p<0.05, **P<0.01. Significant reduction of nicotine 27%. Significant reduction of nornicotine 25%.

[0038] FIG. 4 is a series of graphs showing the overexpression of NdADC1 in TN90 (T0) plants. n=5 (control), n=4 (NdADC1), t-test, *p<0.05, **P<0.01. Significant increase of nicotine 1.3. Significant increase of anabasine 1.6. Significant increase of anatabine 1.4.

DETAILED DESCRIPTION OF THE INVENTION

[0039] Unless otherwise defined below, all technical terms used herein have the same meaning as commonly understood by one of ordinary skill in the art in the field to which this disclosure belongs.

[0040] For the recitation of numeric ranges herein, each intervening number there between with the same degree of precision is explicitly contemplated. For example, for the range 6-9, the numbers 7 and 8 are contemplated in addition to 6 and 9, and for the range 6.0-7.0, the numbers 6.0, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9 and 7.0 are explicitly contemplated. As used herein, the singular forms a, an, and the include both singular and plural referents unless the context clearly dictates otherwise.

[0041] The term about in the context of a given numerate value or range refers to a value or range that is 20%, or 10%, or 5%, or 4%, or 3%, or 2% or 1% of the given value or range.

[0042] The terms total alkaloid content, alkaloid content, total alkaloid levels and alkaloid levels are used interchangeably to refer to the total amount of the most abundant alkaloids found in the plant cell, plant or part thereof, tobacco product or smoking article, that is, the sum of nicotine, nornicotine, anatabine, anabasine. Nicotine, nornicotine, anatabine and anabasine are the most abundant alkaloids in Nicotiana tabacum.

[0043] The terms comprising, comprises and comprised of are synonymous with including, includes, containing, contains, has, having, and can are intended to be open-ended transitional phrases, terms, or words that do not preclude the possibility of additional acts or structures.

[0044] The term consisting of is used to indicate that no further features are present other than those recited.

[0045] The term consisting essentially of indicates that specific further components are present that do not materially affect the essential characteristics of the main component.

[0046] The term construct refers to a double-stranded, recombinant nucleic acid fragment comprising one or more polynucleotides. The construct comprises a template strand base-paired with a complementary sense or coding strand. A given construct can be inserted into a vector in two possible orientations, either in the same (or sense) orientation or in the reverse (or anti-sense) orientation with respect to the orientation of a promoter positioned within a vector-such as an expression vector.

[0047] A control in the context of a plant cell, plant or part thereof refers to a plant cell, plant or part thereof (or the resulting tobacco product or smoking article), into which a heterologous polynucleotide or polypeptide encoding an ADC as disclosed herein has not been introduced, but has been grown or cultured under the same conditions as the host into which the heterologous polynucleotide or polypeptide encoding the ADC has been introduced and is of the same species. For control tobacco products or smoking articles, the resulting tobacco product or smoking article is manufactured in the same way as the tobacco product or smoking article from the host plant cell, plant or part thereof. Thus, a control plant cell, plant or part thereof, tobacco product or smoking article, is equivalent to the host plant cell, plant or part thereof comprising the host plant cell or tobacco product or smoking article comprising the plant or part thereof comprising the host plant cell, including plant material in all parameters with the exception of the test parameters, that is, the introduction of at least one heterologous polynucleotide or polypeptide encoding the ADC.

[0048] The terms endogenous or homologous are used to refer to a polynucleotide or polypeptide which is naturally found in or native to the plant cell.

[0049] As used herein, the term expression denotes the production of an RNA product through transcription of a gene, DNA or polynucleotide sequence, or the production of a polypeptide product encoded by a gene, DNA or polynucleotide sequence. Overexpression is used herein to refer to an increase in expression of a polynucleotide or polypeptide.

[0050] Expression vector or expression cassette are used herein to refer to a polynucleotide vehicle that comprises a combination of polynucleotide components for enabling the expression of the at least one heterologous polynucleotide encoding an ADC as disclosed herein. Expression cassettes or vectors may include episomes capable of extra-chromosomal replication such as circular, double stranded nucleotide plasmids; (circular or linearised) and other functionally equivalent expression vectors of any origin. The expression cassette or vector can be incorporated into a construct suitable for introducing into a plant cell, plant or part thereof.

[0051] The terms genome editing or genetic editing includes changing a polynucleotide such that expression of the polynucleotide is prohibited; or produces a truncated or modified RNA transcript; or a truncated or modified polypeptide.

[0052] The term growth phenotype is used to refer to characteristics of plant growth such as degree of maturity, biomass, plant height, the absence of yellowing or chlorotic leaves, chlorophyll content, growth rate, number of leaves per plant, root length, root branching, stalk height, leaf insertion angle, stress tolerance, leaf size (width and length), internode distance, and lamina-midrib ratio. Growth phenotypic characteristics can be assessed by field observations at any stage of the growth cycle, including during plant development, senescence, or after curing. Changes in phenotype can be measured in plants grown under any conditions. Measurements of growth phenotypes may be performed using techniques standard in the art. The transgenic or non-naturally occurring host plant described herein can have the same growth phenotype as the control plant.

[0053] The term heterologous in the context of a polynucleotide or polypeptide sequence refers to a foreign polynucleotide or polypeptide sequence that is artificially introduced into a host plant cell or inserted into the plant genome in a host plant cell, which does not normally or naturally comprise the artificially introduced or inserted polynucleotide or polypeptide sequence. For example, the host does not normally or naturally comprise the artificially introduced or inserted polynucleotide or polypeptide sequence in any of its material, cells, genome, DNA or RNA. Heterologous nucleic acids or proteins are not endogenous to the cell into which they are introduced but have been obtained from another cell, plant or synthetically or recombinantly produced. The heterologous polynucleotide or polypeptide sequence is from a plant species that is different to the host plant cell. By way of example, a polynucleotide or polypeptide sequence from Nicotiana glauca or Nicotiana debneyi that is not normally or naturally present in Nicotiana tabacum is a heterologous polynucleotide or polypeptide sequence.

[0054] Homogenised plant material is used herein to refer to lyophilised, pulverised, ground or pulped plant material, including cured or dried Nicotiana plant material. In embodiments, the homogenised plant material is from Nicotiana tabacum. Methods of homogenising plant material are standard in the art, and include, but are not limited to, mechanical grinding methods such as a bead beater, mill, blender, or mortar and pestle. As such, the present invention provides homogenised transgenic or non-naturally occurring host plant material comprising at least one heterologous polynucleotide or polypeptide encoding an ADC as disclosed herein.

[0055] The terms homology or similarity refers to the degree of sequence similarity between two polynucleotides or two polypeptides compared by sequence alignment. The degree of homology between two discrete polynucleotides being compared is a function of the number of identical, or matching, nucleotides at comparable positions.

[0056] The term host refers to a plant cell or plant or part thereof comprising the plant cell into which at least one heterologous polynucleotide or polypeptide sequence encoding an ADC as disclosed herein is introduced by genetic engineering techniques such that the host comprising the sequence would not otherwise be found in nature. The host of the present invention is Nicotiana tabacum.

[0057] The terms modulate or alter are used interchangeably to refer to causing or facilitating a qualitative or quantitative change, alteration, modification, modulation or variation in the levels, content, expression, activity or function of a given member. This may be an increase or a decrease. Increased refers to an increase of at least 10%, at least 20%, at least 25%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98%, at least 100%, at least 150%, at least 200% or more. For example, the increase may be in the level of one or more alkaloids in a transgenic or non-naturally occurring host plant cell, plant or part thereof, tobacco product or smoking article as disclosed herein as compared to a control. For example, the increase may be in the level of total alkaloids in the transgenic or non-naturally occurring host plant cell, plant or part thereof, tobacco product or smoking article as disclosed herein as compared to a control. For example, the increase may be in the level of expression of ADC as compared to a control. Decreased refers to a decrease of at least 10%, at least 20%, at least 25%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98%, at least 100%, at least 150%, at least 200% or more. For example, the decrease may be in the level of one or more alkaloids in the host transgenic or non-naturally occurring plant cell, plant or part thereof, tobacco product or smoking article as disclosed herein as compared to a control. For example, the decrease may be in the level of total alkaloids in the transgenic or non-naturally occurring host plant cell, plant or part thereof, tobacco product or smoking article as disclosed herein as compared to a control. For example, the decrease may be in the level of expression of ADC as compared to a control.

[0058] The term non-naturally occurring describes an entity-such as a polynucleotide, polypeptide, plant cell, plant or part thereofthat is not formed by nature or that does not exist in nature.

[0059] The term nucleoside refers to a molecule having a purine or pyrimidine base covalently linked to a ribose or deoxyribose sugar. Exemplary nucleosides include adenosine, guanosine, cytidine, uridine and thymidine. Additional exemplary nucleosides include inosine, 1-methyl inosine, pseudouridine, 5,6-dihydrouridine, ribothymidine, 2N-methylguanosine and 2,2N,N-dimethylguanosine (also referred to as rare nucleosides). Nucleosides include synthetic, naturally occurring, modified nucleosides and nucleoside analogues.

[0060] The term nucleotide or nucleotide residues refers to any nucleoside having one or more phosphate groups joined in ester linkages to the sugar moiety. Exemplary nucleotides include nucleoside monophosphates, diphosphates and triphosphates. The term nucleotide is used generally to refer to nucleotides found in DNA and RNA; adenine (A), guanine (G), cytosine (C), thymine (T) and uracil (U). The term nucleotide includes synthetic, or naturally occurring, nucleotides. In embodiments, the present nucleotide sequences may be modified to replace the intended nucleotide with nucleotide analogues, modified nucleotides or altered nucleotides which are non-standard, non-naturally occurring ribonucleotides or deoxyribonucleotides. Exemplary nucleotide analogues are modified at any position so as to alter certain chemical properties of the nucleotide yet retain the ability of the nucleotide analogue to perform its intended function. In addition, the phosphate group of the nucleotide may be modified by making substitutions which still allow the nucleotide to perform its intended function. Examples of nucleotide modifications include phosphoramidate, phosphorothioate, phosphorodithioate, or O-methylphophoroamidite linkages; and peptide polynucleotide backbones and linkages. Other analogue polynucleotides include those with positive backbones; non-ionic backbones, and non-ribose backbones.

[0061] The term one or more or at least one refers to a list of members, and refers to any one of said members, or any two or more of said members, including 3, 4, 5, 6 or 7 etc. of said members, and up to all said members.

[0062] The term operably linked refers to a functional linkage between two or more elements, such as a regulatory element and the heterologous polynucleotide sequence encoding an ADC. Operably linked elements may be contiguous or non-contiguous.

[0063] As used herein, the term promoter refers to a polynucleotide sequence that serves to control the transcription of heterologous polynucleotide sequence encoding an ADC, located upstream from the heterologous polynucleotide sequence encoding an ADC. In some embodiments, the promoter sequence is expressed in many tissue/cell types, while in other embodiments, the promoter may be tissue specific (that is, that expression is only affected in specific tissues but remains unchanged in others). Different promoters can have different strengths which can result in different amounts of heterologous polypeptide being produced in a host plant cell, plant or part thereof comprising the host plant cell or tobacco product or smoking article comprising the plant or part thereof comprising the host plant cell.

[0064] The terms propagating, propagate or propagated are used to refer to the process of breeding plants and includes both sexual and asexual propagation unless otherwise stated. The term regenerating or regeneration is used to refer to the production of whole new plant organs (including roots and shoots) or plants from plant cells or plant tissue. Methods for regenerating plants or parts thereof from plant cells or plant tissue are standard in the art.

[0065] The term substantially the same is used where entities are highly similar-such as within 5% or less or within 4% or less, or within 3% or less, or within 2% or less or within 1% or less, or within 0.5% or less, or with 0.1% of each other.

[0066] The term plant encompasses whole plants, plant organs (for example, leaves, stems, roots), seeds, differentiated or undifferentiated plant cells, and progeny of the same at any stage of the life cycle.

[0067] Plant cell refers to a structural and physiological unit of a plant. The plant cell may be in the form of a protoplast without a cell wall, an isolated single cell or a cultured cell, or as a part of higher organized unit such as, but not limited to, plant tissues, a plant organ, or a whole plant. The plant cell may be derived or derivable from a plant, or it may be a cultured plant cell that is cultured outside of a plant, that is, in vitro. Methods for deriving a plant cell from a plant, and for culturing plant cells in vitro are standard in the art and are described in Davey and Anthony 2010. Plant cell culture: essential methods. Wiley-Blackwell and Negrutiu 1992. In Linsey (eds). Plant Tissue Culture Manual: 213-223.), and Hsu et al. (2020. Frontiers in Genome Editing, 2:39), for example.

[0068] Parts thereof in the context of a plant include, but are not limited to, plant cells, plant material, plant organs, plant protoplasts, plant cell tissues cultures, plant calli, plant clumps, embryos, pollen, anthers, ovules, branches, fruit, root tips, roots, stems, leaves, flowers, or seeds. In embodiments, the plant part may be leaves, stems or flowers or a combination thereof. The present disclosure provides parts of a plant, wherein said plant part comprises at least one heterologous polynucleotide or polypeptide encoding an ADC.

[0069] As used herein, the term plant material includes seeds, biomass, flowers or flower parts, zygotes, cuttings, secretions, extracts, cell or tissue cultures, suspension cultures, embryos, meristematic regions, callus tissues, leaves, roots, shoots, stems, fruit, gametophytes, sporophytes, pollen, and microspores.

[0070] The terms polynucleotide, polynucleotide sequence, polynucleotide fragment or nucleic acid molecule are used interchangeably herein to refer to a polymer of nucleotides joined together by a phosphodiester or phosphorothioate linkage between 5 and 3 carbon atoms, including DNA. As used herein, the term DNA or deoxyribonucleic acid is used to specifically refer to a polymer of A, T, C and G nucleotides. A polynucleotide, as referred to herein, may be any length, including at least 2, 3, 4, 5, 10, 15, 20, 25, 30, 50, 100, 1000, 2000 or more nucleotides. The polynucleotide may be heterologous, homologous or artificially synthesised. The polynucleotide may be double stranded or single stranded.

[0071] Polypeptide, polypeptide sequence, or protein refers to a polymer of amino acids. The terms are also inclusive of synthetic and naturally occurring amino acids or modified amino acids. Examples of modifications include, but are not limited to, glycosylation, lipid attachment, sulfation, gamma-carboxylation of glutamic acid residues, hydroxylation and ADP-ribosylation. The term sequence refers to any contiguous string of nucleotides or amino acids. It may be at least 2, 5, 10, 15, 20, 30, 40, 50, 100, 200, 500, 1000, 2000 or more nucleotides or amino acids in length or the length can be defined by the polynucleotides or polypeptides in the sequence listing.

[0072] As used herein, the term sequence identity refers to the similarity between two or more polynucleotide or polypeptide sequences.

[0073] Significant or significance refer to statistical significance, that is, the calculation of the probability that entities do not differ only by chance or random events using standard methods known in the art, such as those detailed in Smith (2018) Statistical analysis handbook. Drumlin Security Ltd.

[0074] Smoking articles and smokable articles are used interchangeably to refer to types of aerosol forming devices. Examples of smoking articles or smokable articles include cigarettes, cigarillos, and cigars. The tobacco in the smoking articles and smokable articles may be combusted or heated.

[0075] Tobacco refers to plant cells, plants or parts thereof, plant material or cured or dried plant material from Nicotiana tabacum.

[0076] Tobacco product refers to a consumer tobacco product comprising material produced by a Nicotiana tabacum plant, including, but not limited to, nicotine gum and patches for smoking cessation, smoking articles (including cigarillos, cigarettes, cigars, cigarette tobacco, pipe tobacco, expanded (puffed), homogenised and reconstituted tobacco, cigar tobacco), aerosol forming materials and devices, and all forms of smokeless tobacco products such as chewing tobacco, snuff, gum, and lozenges, as well as components, materials and ingredients for manufacture of consumer tobacco products. Suitably, these tobacco products are manufactured from tobacco leaves and stems harvested from tobacco and cut, dried, cured, and optionally fermented according to conventional techniques for tobacco preparation.

[0077] Tobacco products may contain tobacco in any form, including as dried particles, shreds, granules, powders, or a slurry, deposited on, mixed in, surrounded by, or otherwise combined with other ingredients in any format, such as flakes, films, tabs, foams, or beads. The tobacco products can be a blended tobacco product which may further comprise unmodified, wild-type tobacco.

[0078] Transgenic refers to any plant cell, plant or part thereof (including the resulting tobacco product or smoking article) where the genome has been altered by the presence of a heterologous polynucleotide, including the initial transgenic events as well as those plant cells, plants or parts thereof created by sexual crosses or asexual propagation from the initial transgenic event which may be stably integrated into the genome. The term does not encompass the alteration of the genome (chromosomal or extra-chromosomal) by conventional plant breeding methods or by naturally occurring events-such as random cross-fertilization, non-recombinant viral infection, non-recombinant bacterial transformation, non-recombinant transposition, or spontaneous mutation. Therefore, a transgenic plant cell, plant or part thereof (including the resulting tobacco product or smoking article) comprises at least one heterologous polynucleotides or polypeptides encoding an ADC as disclosed herein.

[0079] The terms variant or analogue are used interchangeably to refer to a sequence which deviates from the given polynucleotide or polypeptide sequence, such as by the addition, removal or substitution or one or more nucleotides or amino acids.

[0080] The term plant variety refers to a population of plants that share characteristics that separate them from other plants of the same species, and there is very small overall variation between individuals within that variety. Suitable varieties for use in the present invention are disclosed herein.

[0081] The term vector is used to refer to any means capable of delivering or introducing any of the heterologous polynucleotides described herein into the host plant cell, plant or part thereof. Arginine decarboxylase or ADC is used herein to refer to the enzyme that is known to catalyse the formation of agmatine and carbon dioxide from arginine. The ADC can be encoded by a polynucleotide or polypeptide as disclosed herein.

[0082] ADC polynucleotides are disclosed herein. The polynucleotide may comprise, consist or consist essentially of SEQ ID NOs: 1 (NgADC1), 3 (NgADC2), or 5 (NdADC1). In embodiments, the polynucleotide may comprise a sequence with at least 70%, 75%, 80%, 81%, 82%, 83%, 85%, 86%, 90%, 91%, 92%, 93%, 94%, 95%, 95.5%, 96%, 96.5%, 97%, 98%, or 99% sequence identity with SEQ ID NOs: 1, 3 or 5 counted over the full length of the sequence.

[0083] In one embodiment, the polynucleotide may comprise, consist or consist essentially of SEQ ID NO: 1 or a sequence with at least 80%, 81%, 82%, 83%, 85%, 86%, 90%, 91%, 92%, 93%, 94%, 95%, 95.5%, 96%, 96.5%, 97%, 98%, or 99% sequence identity or at least 80% or at least 95% or at least 96% sequence identity counted over the full length of the sequence.

[0084] In another embodiment, the polynucleotide may comprise, consist or consist essentially of SEQ ID NO: 3 or a sequence with at least 80%, 81%, 82%, 83%, 85%, 86%, 90%, 91%, 92%, 93%, 94%, 95%, 95.5%, 96%, 96.5%, 97%, 98%, or 99% sequence identity or at least 80% or at least 81% or at least 95% or at least 97% sequence identity counted over the full length of the sequence.

[0085] In another embodiment, the polynucleotide may comprise, consist or consist essentially of SEQ ID NO: 5 or a sequence with at least 80%, 81%, 82%, 83%, 85%, 86%, 90%, 91%, 92%, 93%, 94%, 95%, 95.5%, 96%, 96.5%, 97%, 98%, or 99% sequence identity or at least 80% or at least 80% or at least 95% or at least 96.5% sequence identity counted over the full length of the sequence.

[0086] ADC polypeptides are also disclosed herein. The polypeptide may comprise, consist or consist essentially of SEQ ID NOs: 2 (NgADC1), 4 (NgADC2), or 6 (NdADC). In embodiments, the polypeptide may comprise a sequence with at least 70%, 75%, 80%, 83%, 84%, 85%, 86%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 96.5%, 97%, 97.5%, 98%, or 99% sequence identity to SEQ ID NOs: 2, 4 or 6 counted over the full length of the sequence.

[0087] In one embodiment, the polypeptide may comprise, consist or consist essentially of SEQ ID NO: 2 or a sequence with at least 80%, 81%, 82%, 83%, 85%, 86%, 90%, 91%, 92%, 93%, 94%, 95%, 95.5%, 96%, 96.5%, 97%, 98%, or 99% sequence identity or at least 83% or at least 97% sequence identity counted over the full length of the sequence.

[0088] In another embodiment, the polypeptide may comprise, consist or consist essentially of SEQ ID NO: 4 or a sequence with at least 80%, 81%, 82%, 83%, 85%, 86%, 90%, 91%, 92%, 93%, 94%, 95%, 95.5%, 96%, 96.5%, 97%, 97.5%, 98%, or 99% sequence identity or at least 83% or at least 96% or at least 97% or at least 97.5% sequence identity counted over the full length of the sequence.

[0089] In another embodiment, the polypeptide may comprise, consist or consist essentially of SEQ ID NO: 6 or a sequence with at least 80%, 81%, 82%, 83%, 85%, 86%, 90%, 91%, 92%, 93%, 94%, 95%, 95.5%, 96%, 96.5%, 97%, 97.5%, 98%, or 99% sequence identity or at least 83% or at least 80% or at least 96% or at least 97% or at least 97.5% sequence identity counted over the full length of the sequence.

[0090] In another embodiment, there is provided a polypeptide encoded by a polynucleotide comprising, consisting or consisting essentially of SEQ ID NOs: 1, 3 or 5.

[0091] In another embodiment, there is provided a polypeptide encoded by a polynucleotide comprising a sequence with at least 70%, 75%, 80%, 81%, 82%, 83%, 85%, 86%, 90%, 91%, 92%, 93%, 94%, 95%, 95.5%, 96%, 96.5%, 97%, 98%, or 99% sequence identity with SEQ ID NOs: 1, 3 or 5 counted over the full length of the sequence.

[0092] In a particular embodiment, there is disclosed a non-naturally occurring or transgenic host Nicotiana tabacum plant cell or plant or part thereof comprising the plant cell (including the resulting tobacco product or smoking article) comprising at least one of: a heterologous polynucleotide comprising, consisting, or consisting essentially of a polynucleotide sequence having at least 96% sequence identity to SEQ ID NO: 1, or at least 97% sequence identity to SEQ ID NO: 3; or a heterologous polypeptide encoded by the polynucleotide set forth in (i); or a heterologous polypeptide comprising, consisting or consisting essentially of a polypeptide sequence having at least 97% sequence identity to SEQ ID NO: 2, at least 97.5% sequence identity to SEQ ID NO: 4; or a heterologous polynucleotide comprising, consisting, or consisting essentially of a polynucleotide sequence having at least 96.5% sequence identity to SEQ ID NO: 5; or a heterologous polypeptide encoded by the polynucleotide set forth in (v); or a heterologous polypeptide comprising, consisting or consisting essentially of a polypeptide sequence having at least 97.5% sequence identity to SEQ ID NO: 6; or wherein said heterologous polynucleotide or polypeptide encodes an arginine decarboxylase (ADC).

[0093] Combinations of the polynucleotides and polypeptides disclosed herein are also contemplated. Such combinations can be contained in the non-naturally occurring or transgenic host Nicotiana tabacum plant cell or plant or part thereof comprising the host plant cell or tobacco product or smoking article comprising the plant or part thereof comprising the host plant cell, or plant material comprising host plant cell and the like as described herein. Such combinations may be contained in a vector or construct and the like.

[0094] By way of example, a Nicotiana tabacum plant cell, plant, plant part or plant material, vector or construct and the like comprising of at least one polynucleotide sequence comprising, consisting or consisting essentially of SEQ ID NOs: 13 (NtADC1-S) or 15 (NtADC1-T) or 17 (NtADC2-S) or 19 (NtADC2-T) may contain more than one heterologous polynucleotide sequence-such as more than one polynucleotide comprising, consisting or consisting essentially of SEQ ID NOs: 1 (NgADC1), 3 (NgADC2) and 5 (NdADC1) or a polynucleotide with at least 70%, 75%, 80%, 81%, 82%, 83%, 85%, 86%, 90%, 91%, 92%, 93%, 94%, 95%, 95.5%, 96%, 96.5%, 97%, 98%, or 99% sequence identity thereto. For example, the combination may be SEQ ID NO: 1 and 3 or SEQ ID NO: 1 and 5 or SEQ ID NO: 3 and 5 or SEQ ID NO: 1 and 3 and 5. Introducing combinations of polynucleotide sequences into a Nicotiana tabacum host may further modulate or alter alkaloid levels.

[0095] By way of example, a Nicotiana tabacum plant cell, plant, plant part or plant material, vector or construct comprising of at least one polypeptide sequence comprising, consisting or consisting essentially of SEQ ID NOs: 14 (NtADC1-S) or 16 (NtADC1-T) or 18 (NtADC2-S) or 20 (NtADC2-T) may contain more than one heterologous polypeptide sequence-such as more than one polypeptide comprising, consisting or consisting essentially of SEQ ID NO: 2 (NgADC1), 4 (NgADC2) and 6 (NdADC) or a polypeptide with at least 70%, 75%, 80%, 81%, 82%, 83%, 85%, 86%, 90%, 91%, 92%, 93%, 94%, 95%, 95.5%, 96%, 96.5%, 97%, 97.5%, 98%, or 99% sequence identity thereto. For example, the combination may be SEQ ID NO: 2 and 4 or SEQ ID NO: 2 and 6 or SEQ ID NO: 4 and 6 or SEQ ID NO: 2, 4 and 6. Introducing combinations of polypeptide sequences into the Nicotiana tabacum host may further modulate or alter alkaloid levels.

[0096] The polynucleotide of the present invention encodes a polypeptide having ADC activity.

[0097] Suitably, the at least one heterologous polynucleotide or heterologous polypeptide encoding the ADC is or is derived from Nicotiana glauca or Nicotiana debneyi.

[0098] Sequence identity is frequently measured in terms of percentage identity (or similarity or homology), so that the higher the percentage, the more similar the two sequences are. Homologs or variants of the nucleotide sequence will possess a relatively high degree of sequence identity when aligned using standard methods known in the art. For example, the percentage may be calculated by aligning the two sequences, comparing the two sequences over the specified region, determining the number of positions at which the identical residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the specified region, and multiplying the result by 100 to yield the percentage of sequence identity. In cases where the two sequences are of different lengths or the alignment produces one or more staggered ends and the specified region of comparison includes only a single sequence, the residues of single sequence are included in the denominator but not the numerator of the calculation. Comparisons may be made over at least 50,100,200, 500, 1000, 1500 or 2000 nucleotides or amino acids but are preferably over the full length of the polynucleotide or polypeptide sequence. Identity may be determined manually or by using a computer sequence algorithm such as ClustalW, ClustalX, BLAST, FASTA, NCBI Blast 2.0 or Smith-Waterman. The popular multiple alignment program ClustalW (Nucleic Acids Research (1994) 22, 4673-4680; Nucleic Acids Research (1997), 24, 4876-4882) is a suitable way for generating multiple alignments of polypeptides or polynucleotides. Suitable parameters for ClustalW maybe as follows: For polynucleotide alignments: Gap Open Penalty=15.0, Gap Extension Penalty=6.66, and Matrix=Identity. For polypeptide alignments: Gap Open Penalty=10.0, Gap Extension Penalty=0.2, and Matrix=Gonnet. For DNA and Protein alignments: ENDGAP=1, and GAPDIST=4. Those skilled in the art will be aware that it may be necessary to vary these and other parameters for optimal sequence alignment. Suitably, calculation of percentage identities is then calculated from such an alignment as (N/T), where N is the number of positions at which the sequences share an identical residue, and T is the total number of positions compared including gaps but excluding overhangs.

[0099] Variants of the polynucleotide or polypeptide sequences described herein are also contemplated. When percentage of sequence identity is used in reference to polypeptides, it is recognized that amino acids may be substituted for another amino acid with similar chemical properties, such as charge and hydrophobicity, and therefore do not change the functional properties of the molecule. These are referred to as conservative substitutions. Determining which amino acids may be substituted, inserted or deleted can be achieved using computer programs-such as Vector NTI Suite (InforMax, MD) software. Conservative substitutions may be made, for example according to the Table below. Amino acids in the same block in the second column and preferably in the same line in the third column may be substituted for each other (see Table 1).

[0100] Where sequences differ in conservative substitutions, the percentage sequence identity may be adjusted upwards to correct for the conservative nature of the substitution. Sequences which differ by such conservative substitutions are said to have sequence similarity or similarity. Means for making this adjustment are well-known to those of skill in the art. Typically this involves scoring a conservative substitution as a partial rather than a full mismatch, thereby increasing the percentage sequence identity. Thus, for example, where an identical amino acid is given a score of 1 and a non-conservative substitution is given a score of zero, a conservative substitution is given a score between zero and 1. The scoring of conservative substitutions is calculated, for example, according to the algorithm of Meyers & Miller, Computer Applic. Biol. Sci. 4:11-17 (1988), as implemented in the program PC/GENE (Intelligenetics, Mountain View, California, USA). Scale-invariant feature transform (SIFT) scores may also be used to predict whether an amino acid substitution affects protein function based on sequence homology and the physical properties of the amino acids. SIFT scores may be calculated based on methods known in the art, such as those described in Kumar et al. (2009) Nature Protocols, 4 (8): 1073-1082.

[0101] Use in this description of a percentage of sequence identity denotes a value determined by comparing two optimally aligned sequences over a comparison window, wherein the portion of the polynucleotide sequence in the comparison window may comprise additions or deletions (gaps) as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the two sequences. The percentage is calculated by determining the number of positions at which the identical nucleic acid base or amino acid residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison, and multiplying the result by 100 to yield the percentage of sequence identity.

[0102] The present disclosure provides a transgenic or non-naturally occurring host Nicotiana tabacum plant cell, plant or part thereof, tobacco product or smoking article, comprising at least one heterologous polynucleotide or polypeptide encoding an ADC from Nicotiana glauca or Nicotiana debneyi as described herein. In one embodiment, the endogenous ADC of the host Nicotiana tabacum plant cell or plant or part thereof comprising the host plant cell or tobacco product or smoking article comprising the plant or part thereof comprising the host plant cell comprises of at least one polynucleotide sequence comprising, consisting or consisting essentially of SEQ ID NOs: 13 (NtADC1-S), 15 (NtADC1-T), 17 (NtADC2-S) or 19 (NtADC2-T). In another embodiment, the endogenous ADC of the host Nicotiana tabacum plant cell or plant or part thereof comprising the host plant cell or tobacco product or smoking article comprising the plant or part thereof comprising the host plant cell comprises at least one polypeptide sequence comprising, consisting or consisting essentially of SEQ ID NOs: 14 (NtADC1-S), 16 (NtADC1-T), 18 (NtADC2-S) or 20 (NtADC2-T).

[0103] Non-naturally occurring or artificial host plants or parts thereof may be made by methods described herein or that are well known in the art. Such entities may be made by man. Non-naturally occurring or artificial host plants or parts thereof contain one or more heterologous polynucleotides or polypeptides that from a different plant species to the non-naturally occurring or artificial host plant or parts thereof. The host plant cell, plant or part thereof is Nicotiana tabacum.

[0104] In embodiments, the heterologous polynucleotide or polypeptide is from Nicotiana glauca or Nicotiana debneyi. More than one heterologous polynucleotide or polypeptide from Nicotiana glauca and Nicotiana debneyi may be present in the Nicotiana tabacum host.

[0105] Wild type Nicotiana tabacum, Nicotiana glauca and Nicotiana debneyi are publicly available. For example, these species are available from the United States Department of Agriculture, Agricultural Research Service, North Carolina State University, Department of Crop Science, Box 7620, 4309 Williams Hall, Raleigh, North Carolina 27695. For example, Nicotiana glauca is available as cultivar TW53, TW55, TW56 and TW57 and Nicotiana debneyi (named as forsteri) is available as cultivar TW37, TW38, TW39 and TW40. Nicotiana tabacum, Nicotiana glauca and Nicotiana debneyi seeds are available from NiCoTa GmbH, Kutschenweg 20, 76287 Rheinstetten, Germany as registration number 16 (Nicotiana tabacum), registration number 1 (Nicotiana glauca) and registration number 49 (Nicotiana debneyi). Bergerac Seed & Breeding, La Tour, 24100 Bergerac, France also supplies Nicotiana tabacum, Nicotiana glauca (accession numbers 486, 487 and 488) and Nicotiana debneyi (accession numbers 584 to 588, idem USDA-GRIN (NCSU)).

[0106] Wild type Nicotiana glauca accumulates predominantly anabasine rather than nicotine and nornicotine as the main component of its leaf pyridine alkaloid fraction. As shown in Sisson and Severson (1990) supra and in Table 2 herein, wild type Nicotiana glauca has a very low level of nicotine, thereby suggesting that there is a possible pathway shift preventing the formation of putrescine and stimulating the formation of cadaverine, both being precursors of nicotine and anabasine, respectively. Wild type Nicotiana debneyi is not as altered in the production of nicotine as wild type Nicotiana glauca and balanced in nicotine and anabasine production (Sisson and Severson (1990) supra and Table 2). As described herein, expression of Nicotiana glauca ADC or Nicotiana debneyi ADC in a Nicotiana tabacum host can result in altered levels of alkaloids therein.

[0107] Also provided is a tissue culture of regenerable plant cells, which is capable of being regenerated into a plant. The regenerable cells may include cells from leaves, pollen, embryos, cotyledons, hypocotyls, roots, root tips, anthers, flowers and a part thereof, ovules, shoots, stems, stalks, pith and capsules or callus or protoplasts derived therefrom. The present disclosure therefore provides tissue cultures of transgenic or non-naturally occurring Nicotiana tabacum host plant cells comprising at least one heterologous polynucleotide or polypeptide encoding an ADC as disclosed herein.

[0108] Plant parts, including seeds, of the plant described herein can be conditioned and bagged in packaging material by means known in the art to form an article of manufacture. Packaging material are well known in the art. A package of seeds can have a label, for example, a tag or label secured to the packaging material or a label printed on the package that describes the nature of the seeds therein.

[0109] In one embodiment, the plant material is a leaf or stem or a combination thereof. Suitably, the plant material is cured or dried. Processes of curing green tobacco leaves are known by those skilled in the art and include, without limitation, air-curing, fire-curing, flue-curing and sun-curing. Examples of drying process include fast drying, for example, in an oven, and lyophilisation. The process of curing green tobacco leaves depends on the type of tobacco harvested. For example, Virginia flue (bright) tobacco is typically flue-cured, Burley and certain dark strains are usually air-cured, and pipe tobacco, chewing tobacco, and snuff are usually fire-cured. The present disclosure therefore provides transgenic or non-naturally occurring Nicotiana tabacum plant material, including cured or dried plant material, comprising at least one heterologous polynucleotide or polypeptide encoding an ADC from Nicotiana glauca or Nicotiana debneyi or a combination thereof as disclosed herein.

[0110] In a further embodiment, the Nicotiana tabacum host plant cell, plant or part thereof (including the tobacco product or smoking article thereof) is a Nicotiana tabacum variety, cultivar or elite Nicotiana tabacum cultivar. Nicotiana tabacum varieties include Burley type, dark type, flue-cured type, and Oriental type tobaccos. Non-limiting examples of varieties or cultivars are: AA37, BO 64, CC 101, CC 200, CC 27, CC 301, CC 400, CC 500, CC 600, CC 700, CC 800, CC 900, Coker 176, Coker 319, Coker 371 Gold, Coker 48, CD 263, DF911, OT 538 LC Galpao tobacco, GL 26H, GL 350, GL 600, GL 737, GL 939, GL 973, HB 04P, HB 04P LC, HB3307PLC, Hybrid 403LC, Hybrid 404LC, Hybrid 501 LC, K 149, K 326, K 346, K 358, K394, K 399, K 730, KOH 959, KT 200, KT204LC, KY10, KY14, KY 160, KY 17, KY 171, KY 907, KY907LC, KY14xL8 LC, Little Crittenden, McNair 373, McNair 944, msKY 14xL8, Narrow Leaf Madole, Narrow Leaf Madole LC, NBH 98, N-126, N-777LC, N-7371LC, NC 100, NC 102, NC 2000, NC 291, NC 297, NC 299, NC 3, NC 4, NC 5, NC 6, NC 606, NC 71, NC 72, NC 810, NC BH 129, NC 2002, Neal Smith Madole, OXFORD 207, PD 7302 LC, PD 7309 LC, PD 7312 LC, Perique tobacco, PVH03, PVH09, PVH19, PVH50, PVH51, R 610, R 630, R 7-11, R 7-12, RG 17, RG 81, RG H51, RGH 4, RGH 51, RS 1410, Speight 168, Speight 172, Speight 179, Speight 210, Speight 220, Speight 225, Speight 227, Speight 234, Speight G-28, Speight G-70, Speight H-6, Speight H20, Speight NF3, TI 1406, TI 1269, TN 86, TN86LC, TN 90, TN97, TN97LC, TN D94, TN D950, TR (Tom Rosson) Madole, VA 309, VA359, AA 37-1, B13P, Xanthi (Mitchell-Mor), Bel-W3, 79-615, Samsun Holmes NN, KTRDC number 2 Hybrid 49, Burley 21, KY8959, KY9, MD 609, PG01, PG04, PO1, PO2, PO3, RG11, RG 8, VA509, AS44, Banket A 1, Basma Drama B84/31, Basma | Zichna ZP4/B, Basma Xanthi BX 2A, Batek, Besuki Jember, C104, Coker 347, Criollo Misionero, Delcrest, Djebel 81, DVH 405, Galpao Comum, HB04P, Hicks Broadleaf, Kabakulak Elassona, Kutsage E1, LA BU 21, NC 2326, NC 297, PVH 2110, Red Russian, Samsun, Saplak, Simmaba, Talgar 28, Wislica, Yayaldag, Prilep HC-72, Prilep P23, Prilep PB 156/1, Prilep P12-2/1, Yaka JK-48, Yaka JB 125/3, TI-1068, KDH-960, TI-1070, TW136, Basma, TKF 4028, LS, TKF 2002, GR141, Basma xanthi, GR149, GR153, or Petit Havana. Low converter subvarieties of the above, even if not specifically identified herein, are also contemplated.

[0111] The Nicotiana tabacum host plant may be grown under any suitable conditions, including hydroponically, in a greenhouse or in a field using standard techniques in the art.

[0112] Alkaloids are complex organic molecules comprising or containing a heterocyclic nitrogen ring. Approximately 10% of all plant species are thought to produce alkaloids as secondary metabolites from amino acids, and in plants, alkaloids are thought to function as a defence against herbivores and pathogens. A pyrrolidine alkaloid is an alkaloid containing a pyrrolidine ring as part of its molecular structure. Nicotine, nornicotine, anatabine and anabasine are pyrrolidine alkaloids. Nicotine, nornicotine, anatabine and anabasine are also referred to as pyridine alkaloids in the published literature. A pyridine alkaloid is an alkaloid containing a pyridine ring as part of its molecular structure. A nicotinic alkaloid refers to nicotine, or an alkaloid that is structurally related to nicotine and is synthesized from a compound produced in the nicotine biosynthesis pathway. Nicotinic alkaloids include, but are not limited to nicotine, nornicotine, anatabine, anabasine, anatalline, N-methylanatabine, N-methylanabasine, myosmine, anabaseine, formylnornicotine, nicotyrine, and cotinine. Other minor nicotinic alkaloids in N. tabacum are reported, for example, in Hecht et al. 1979. Accounts of Chemical Research 12:92-98. In embodiments, the term alkaloids refers preferentially to nicotine (C.sub.10H.sub.14N.sub.2), nornicotine (C.sub.9H.sub.12N.sub.2), anatabine (C.sub.10H.sub.12N.sub.2) or anabasine (C.sub.10H.sub.14N.sub.2). Structures for alkaloids are shown in Hecht et al. (1979) supra.

[0113] The levels of total or individual alkaloids may be measured as g/g or mg/g dry weight (DW) or fresh weight (FW) of plant material. References to total or individual alkaloids includes reference to all enantiomers of the relevant alkaloid(s) unless otherwise specified. References to total or individual alkaloids refers to the naturally occurring enantiomer found in the host Nicotiana tabacum plant cell, plant or part thereof, tobacco product or smoking article as disclosed herein.

[0114] As described herein, the levels of total or individual alkaloids may be increased or decreased in the non-naturally occurring or transgenic Nicotiana tabacum host plant cell, plant or part thereof, tobacco product or smoking article as disclosed herein, as compared to a control. The levels or amounts of total or individual alkaloids can be measured as g/g, mg/g or percent per dry weight (DW) or fresh weight (FW) compared to a control. Levels reported herein are in g/g or mg/g.

[0115] The levels of total or individual alkaloids (nicotine or nornicotine or anabasine or anatabine) are modulated in accordance with the present disclosure. The levels of total or individual alkaloids may be increased or decreased as compared to a control in accordance with the present disclosure. In one embodiment, the levels of nicotine and nornicotine are decreased in the host Nicotiana tabacum plant cell as compared to a control Nicotiana tabacum plant cell and the levels of anabasine and anatabine are between about 90% and about 110% in the host Nicotiana tabacum plant cell as compared to the amount in the control Nicotiana tabacum plant cell. Suitably the levels of anabasine and anatabine are between about 95% and about 105%, or between about 98% and about 102%, or between about 99% and about 101% in the host Nicotiana tabacum plant cell as compared to the amount in the control Nicotiana tabacum plant cell. Suitably the levels of anabasine and anatabine are the same in the host Nicotiana tabacum plant cell as compared to the amount in the control Nicotiana tabacum plant cell. In another embodiment, the levels of nicotine, anabasine and anatabine are increased and the level of nornicotine in the host Nicotiana tabacum plant cell is the same or increased as compared to a control Nicotiana tabacum plant cell. Suitably, the levels are modulated, increased or decreased in leaf-such as dried or lyophilised green plant leaf harvested from a mature flowering plant. Suitably, the levels or amounts or percentages or ratios indicated below are in leaf-such as dried or lyophilised green plant leaf harvested from a mature flowering plant.

[0116] In embodiments, the levels of total alkaloids may be increased by at least 1000, 2000, 3000, or 4000 g/g as compared to a control. In embodiments, the level of total alkaloids may be increased to between 11000 to 19000, 11000 to 17000, 12000 to 16000, or 13000 to 16000 g/g.

[0117] In embodiments, the levels of total alkaloids may be decreased by at least 1000, 1500, 2000, or 2500 g/g as compared to a control. In embodiments, the level of total alkaloids may be decreased to between 5000 to 10000, 6000 to 10000, or 7000 to 9000 g/g.

[0118] In embodiments, the level of total alkaloids in the control plant cell, plant or part thereof, tobacco product or smoking article may be between 10100 to 15000, 11000 to 15000, 10000 to 14000, or 11000 to 13000 g/g.

[0119] In embodiments, the level of nicotine may be increased by at least 500, 1000, 2000, 2500, 3000 or 3500 g/g as compared to a control. In embodiments, the level of nicotine may be increased to between 11000 to 18000, 11000 to 17000, 11000 to 16000, 12000 to 18000, 12000 to 17000, 12000 to 16000, 13000 to 16000, 13000 to 15000, or 13500 to 14500 g/g. In embodiments, the level of nicotine may be decreased by at least 500, 1000, 1500, 2000, or 2500 g/g as compared to a control. In embodiments, the level of nicotine may be decreased to between 4500 to 9500, 5000 to 9500, 6000 to 9500, 6000 to 9000, 6500 to 9500, 6500 to 9000, 7000 to 9500, 7000 to 9000, or 7500 to 8500 g/g.

[0120] In embodiments, the level of nicotine in the control plant cell, plant or part thereof, tobacco product or smoking article may be between 9000 to 13000, 9000 to 13000, 9500 to 13000, 9500 to 12500, 9000 to 12000, 9500 to 12000, 9000 to 11150, 9500 to 11150, or 9000 to 11000 g/g.

[0121] In embodiments, the level of nornicotine may be increased by at least 20, 40, 50, 60, 80, 100, 110, 120, 130, or 140 g/g as compared to a control. In embodiments, the level of nornicotine may be increased to between 590 to 900, 600 to 900, 600 to 850, or 600 to 800 g/g.

[0122] In embodiments, the level of nornicotine may be decreased by at least 20, 40, 50, 60, 80, 100, 110, 120, 125, or 130 g/g as compared to a control. In embodiments, the level of nornicotine may be decreased to between 200 to 520, 200 to 500, 250 to 520, 250 to 500, 300 to 520, 300 to 500, 350 to 520, 350 to 500, or 400 to 500 g/g.

[0123] In embodiments, the level of nornicotine may not be significantly different from the level of nornicotine in a control as determined by standard statistical tests. In embodiments, the level of nornicotine may be substantially the same as a control. In embodiments, the level of nornicotine in the control plant cell or plant or part thereof comprising the host plant cell or tobacco product or smoking article comprising the plant or part thereof comprising the host plant cell may be between 400 to 660, 450 to 610, 450 to 600, 500 to 600, 510 to 610 g/g. In embodiments, the level of anabasine may not be significantly different from a control as determined by standard statistical tests. In embodiments, the level of anabasine may be substantially the same as a control. In embodiments, the level of anabasine may be increased by at least 5, 10, 15, 17, 18, 19, 20, 21 or 23 g/g as compared to a control. In embodiments, the level of anabasine may be increased to between 50 to 75, 55 to 75, 55 to 70, or 60 to 70 g/g. In embodiments, the level of anabasine in the control plant cell, plant or part thereof, tobacco product or smoking article may be between 30 to 50 or 35 to 45 g/g.

[0124] In embodiments, the level of anatabine may not be significantly different from a control as determined by standard statistical tests. In embodiments, the level of anatabine may be substantially the same as a control. In embodiments, the level of anatabine may be increased by at least 10, 15, 20, 25, 50, 60, 65, 70, 100, 110, 120, 130, 140, 150, or 160 g/g as compared to a control. In embodiments, the level of anatabine may be increased to between 280 to 600, 300 to 500, 300 to 450, 350 to 450, 280 to 360, 290 to 350, 300 to 340, 310 to 330, 305 to 330 or 305 to 330 g/g. In embodiments, the level of anatabine in the control plant cell, plant or part thereof, tobacco product or smoking article may be between 210 to 270, 220 to 260, 230 to 250, or 237 to 2457 g/g.

[0125] In one embodiment, the present disclosure provides a transgenic or non-naturally occurring host Nicotiana tabacum plant cell, plant or part thereof, tobacco product or smoking article, comprising (i) a total alkaloid content of between 5.0 and 10.0 mg/g; and (ii) a nicotine content of between 6.0 and 9.5 mg/g; and (ill) a nornicotine content of between 0.2 and 0.49 mg/g; and (iv) an anabasine content of between 0.050 and 0.080 mg/g; and (v) an anatabine content of between 0.255 and 0.60 mg/g.

[0126] In another embodiment, the transgenic or non-naturally occurring host Nicotiana tabacum plant cell, plant or part thereof, tobacco product or smoking article comprises (i) a total alkaloid content of between 7.0 and 10.0 mg/g: (ii) a nicotine content of between 6.0 and 9.0 mg/g; (iii) a nornicotine content of between 0.35 and 0.5 mg/g; (iv) an anabasine content of between 0.055 and 0.070 mg/g; and (v) an anatabine content of between 0.255 and 0.4 mg/g.

[0127] In another embodiment, the present invention provides a transgenic or non-naturally occurring host Nicotiana tabacum plant cell, plant or part thereof, tobacco product or smoking article, comprising: (i) a total alkaloid content of between 12.5 and 17.0 mg/g; (ii) a nicotine content of between 11.5 and 17.0 mg/g; (iii) a nornicotine content of between 0.60 and 0.80 mg/g; (iv) an anabasine content of between 0.050 and 0.080 mg/g; and (v) an anatabine content of between 0.30 and 0.60 mg/g.

[0128] In another embodiment, the transgenic or non-naturally occurring host Nicotiana tabacum plant cell, plant or part thereof, tobacco product or smoking article, comprises: (i) a total alkaloid content of between 13.0 and 17.0 mg/g; (ii) a nicotine content of between 12.0 and 16.0 mg/g; (iii) a nornicotine content of between 0.60 and 0.80 mg/g; (Iv) an anabasine content of between 0.055 and 0.070 mg/g; and (v) an anatabine content of between 0.3 and 0.5 mg/g. In embodiments, the control Nicotiana tabacum plant cell, plant or part thereof, tobacco product or smoking article comprises: (i) a total alkaloid content of between 10.1 and 12.9 mg/g; (ii) a nicotine content of between 9.1 and 11.9 mg/g; (iii) a nornicotine content of between 0.50 to 0.59 mg/g; (iv) an anabasine content of 0.030 to 0.049 mg/g; and (v) an anatabine content of between 0.20 to 0.270 mg/g.

[0129] In another embodiment, the transgenic or non-naturally occurring host Nicotiana tabacum plant cell, plant or part thereof, tobacco product or smoking article, comprises: (i) a nicotine content of 8.1 mg/g2.2 mg/g; (ii) a nornicotine content of 0.43 mg/g+0.09 mg/g; (iii) an anabasine content 0.06 mg/g0.03 mg/g; and (iv) an anatabine content of 0.31 mg/g0.11 mg/g.

[0130] In another embodiment, the transgenic or non-naturally occurring host Nicotiana tabacum plant cell, plant or part thereof, tobacco product or smoking article, comprises: (i) a nicotine content of 7.8 mg/g2.1 mg/g; (ii) a nornicotine content of 0.43 mg/g0.10 mg/g; (iii) an anabasine content 0.06 mg/g0.05 mg/g; and (iv) an anatabine content of 0.27 mg/g0.24 mg/g.

[0131] In another embodiment, the transgenic or non-naturally occurring host Nicotiana tabacum plant cell, plant or part thereof, tobacco product or smoking article, comprises: (i) a nicotine content of 14.0 mg/g3.2 mg/g; (ii) a nornicotine content of 0.70 mg/g0.15 mg/g; (iii) an anabasine content 0.06 mg/g0.01 mg/g; and (iv) an anatabine content of 0.41 mg/g0.09 mg/g.

[0132] In another embodiment, the control Nicotiana tabacum plant cell, plant or part thereof, tobacco product or smoking article comprises: (i) a nicotine content of 10.4 mg/g1.0 mg/g; (ii) a nornicotine content of 0.56 mg/g0.06 mg/g; (iii) an anabasine content of 0.043 mg/g #0.007 mg/g; and (iv) an anatabine content of 0.24 mg/g0.04 mg/g.

[0133] The levels of total or individual alkaloids in the non-naturally occurring or transgenic host plant cell, plant or part thereof, tobacco product or smoking article may be measured as a percentage of the levels of total or individual alkaloids in a control plant cell, plant or part thereof, tobacco product or smoking article.

[0134] In one embodiment, the level of total alkaloids in the transgenic or non-naturally occurring host plant cell, plant or part thereof, tobacco product or smoking article may be increased by at least 10%, 15%, 20%, 25%, 30%, 35%, 40%, 50%, 60%, 70%, 80%, 90% as compared to a control. In another embodiment, the level of total alkaloids in the transgenic or non-naturally occurring host plant cell, plant or part thereof, tobacco product or smoking article may be increased by between 10% to 100%, 10% to 90%, 10% to 80%, 10% to 70%, 10% to 60%, 10% to 50%, 15% to 50%, 20% to 45%, or 30% to 40% as compared to a control. In another embodiment, the level of total alkaloids in the transgenic or non-naturally occurring host plant cell, plant or part thereof, tobacco product or smoking article may be increased by over 100% as compared to a control. In another embodiment, the level of total alkaloids in the transgenic or non-naturally occurring host plant cell, plant or part thereof, tobacco product or smoking article may be decreased by at least 5%, 10%, 15%, 20% or 25% as compared to a control. In embodiments, the level of total alkaloids in the transgenic or non-naturally occurring host plant cell, plant or part thereof, tobacco product or smoking article may be decreased by between 5% to 100%, 10% to 100%, 15% to 100%, 20% to 100%, 10% to 90%, 15% to 90%, 10% to 80%, 15% to 80%, 10% to 70%, 15% to 70%, 10% to 60%, 15% to 60%, 10% to 50%, 15% to 50%, 10% to 40%, 15% to 40%, 10% to 30%, 15% to 30%, or 20% to 30% as compared to a control.

[0135] In another embodiment, the level of nicotine in the transgenic or non-naturally occurring host plant cell, plant or part thereof, tobacco product or smoking article may be increased by at least 10%, 15%, 20%, 25%, 30%, or 35%, as compared to a control. In another embodiment, the level of nicotine in the transgenic or non-naturally occurring host plant cell, plant or part thereof, tobacco product or smoking article may be increased by over 100% as compared to a control. In another embodiment, the level of nicotine in the transgenic or non-naturally occurring host plant cell, plant or part thereof, tobacco product or smoking article may be increased by between 10% to 100%, 10% to 90%, 10% to 80%, 10% to 70%, 10% to 60%, 10% to 50%, 15% to 50%, 20% to 45%, or 30% to 40% as compared to a control.

[0136] In another embodiment, the level of nicotine in the transgenic or non-naturally occurring host plant cell, plant or part thereof, tobacco product or smoking article may be decreased by at least 5%, 10%, 15%, 20% or 25% as compared to a control. In another embodiment, the level of nicotine in the transgenic or non-naturally occurring host plant cell, plant or part thereof, tobacco product or smoking article may be decreased by between 5% to 100%, 10% to 100%, 15% to 100%, 20% to 100%, 10% to 90%, 15% to 90%, 10% to 80%, 15% to 80%, 10% to 70%, 15% to 70%, 10% to 60%, 15% to 60%, 10% to 50%, 15% to 50%, 10% to 40%, 15% to 40%, 10% to 35%, 15% to 35%, 10% to 30%, 15% to 30%, or 20% to 30% as compared to a control.

[0137] In another embodiment, the level of nornicotine may be increased by at least 5%, 10%, 15%, 20%, 21%, 22%, 23%, or 24% as compared to a control. In another embodiment, the level of nornicotine may be increased by over 100% as compared to a control. In another embodiment, the level of nornicotine may be increased by between 10% to 100%, 10% to 90%, 10% to 80%, 10% to 70%, 10% to 60%, 10% to 50%, 10% to 40%, 15% to 35% or 20% to 30% as compared to a control.

[0138] In another embodiment, the level of may be decreased by at least 5%, 10%, 15%, 20%, 21%, 22%, 23%, 24% or 25% as compared to a control. In another embodiment, the level may be decreased by between 5% to 100%, 10% to 100%, 15% to 100%, 20% to 100%, 10% to 90%, 15% to 90%, 10% to 80%, 15% to 80%, 10% to 70%, 15% to 70%, 10% to 60%, 15% to 60%, 10% to 50%, 10% to 40%, 15% to 35%, or 20% to 30% as compared to a control.

[0139] In another embodiment, the levels of nornicotine may not be significantly different from the level of nornicotine in a control as determined by standard statistical tests. In embodiments, the level of nornicotine may be substantially the same as a control-such as within 5% or less or within 4% or less, or within 3% or less, or within 2% or less or within 1% or less, or within 0.5% or less or within 0.1% of the control.

[0140] In another embodiment, the level of anabasine may be increased by at least 10%, 20%, 30%, 35%, 40%, 41%, 42%, 43%, 45%, 50%, 51%, 52% or 53% as compared to a control. In another embodiment, the level of anabasine may be increased by over 100% as compared to a control. In embodiments, the level of anabasine may be increased by between 10% to 100%, 10% to 90%, 10% to 80%, 10% to 70%, 10% to 65%, 10% to 60%, 15% to 60%, 20% to 70%, 20% to 60%, 25% to 75%, 30% to 65%, 30% to 60%, 35% to 60%, or 40% to 60% as compared to a control.

[0141] In another embodiment, the level of anabasine may not be significantly different from a control as determined by standard statistical tests. In embodiments, the level of anabasine may be substantially the same as a control-such as within 5% or less or within 4% or less, or within 3% or less, or within 2% or less or within 1% or less, or within 0.5% or less or within 0.1% of the control.

[0142] In another embodiment, the level of anatabine may be increased by at least 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 28%, 29%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65% or 67% as compared to a control. In another embodiment, the level of anatabine may be increased by over 100% as compared to a control. In another embodiment, the level of anatabine may be increased by between 5% to 20%, 5% to 15%, 10% to 100%, 10% to 90%, 10% to 80%, 10% to 70%, 20% to 100%, 20% to 90%, 20% to 80%, 20% to 70%, 15% to 45%, 20% to 40%, 30% to 100%, 40% to 100%, 50% to 100%, 50% to 90%, 55% to 85%, 60% to 80%, or 60% to 90% as compared to a control. In another embodiment, the level of anatabine may not be significantly different from a control as determined by standard statistical tests. In embodiments, the level of anatabine may be substantially the same as a control-such as within 5% or less or within 4% or less, or within 3% or less, or within 2% or less or within 1% or less, or within 0.5% or less or within 0.1% of the control.

[0143] In another embodiment, the transgenic or non-naturally occurring host Nicotiana tabacum plant cell, plant or part thereof, tobacco product or smoking article, comprises: (i) 91% nicotine; (ii) 5% nornicotine; (iii) 0.5% anabasine; and (iv) 3.5% anatabine.

[0144] In another embodiment, the transgenic or non-naturally occurring host Nicotiana tabacum plant cell, plant or part thereof, tobacco product or smoking article, comprises: (i) 91% nicotine; (ii) 5% nornicotine; (iii) 1% anabasine; and (iv) 3% anatabine.

[0145] In another embodiment, the transgenic or non-naturally occurring host Nicotiana tabacum plant cell, plant or part thereof, tobacco product or smoking article, comprises: (i) 92% nicotine; (ii) 4.6% nornicotine: (iii) 0.6% anabasine; and (v) 2.8% anatabine.

[0146] In another embodiment, the control Nicotiana tabacum plant cell, plant or part thereof, tobacco product or smoking article comprises: (i) 92% nicotine; (ii) 5.3% nornicotine; (iii) 0.4% anabasine; and (iv) 2.3% anatabine.

[0147] The amounts of anabasine, anatabine, nornicotine and nicotine can also be expressed as ratios. All ratios described herein are calculated by dividing the amount of the first named alkaloid into the amount of the second named alkaloid, for example, to calculate the ratio of anabasine:anatabine the amount of anabasine is divided into the amount of anatabine. In one aspect, there is disclosed a dried or lyophilised green plant leaf harvested from a mature flowering Nicotiana tabacum plant comprising a ratio of anabasine:anatabine of about 0.19; or a ratio of anabasine:nornicotine of about 0.14; or a ratio of anabasine:nicotine of about 0.007; or a ratio of anatabine:nornicotine of about 0.73; or a ratio of anatabine:nicotine is about 0.04; or a ratio of nornicotine:nicotine of about 0.05; or a ratio of anabasine:anatabine of about 0.19; or a ratio of anabasine:anatabine of abut 0.19; and a ratio of anabasine:nornicotine of about 0.14 and a ratio of anabasine:nicotine of about 0.007; and a ratio of nornicotine:nicotine of about 0.05; or a ratio of anabasine:anatabine of about 0.19; and a ratio of anatabine:nornicotine of about 0.73; and a ratio of anatabine:nicotine of about 0.04; and a ratio of nornicotine:nicotine of about 0.05. Suitably, the Nicotiana tabacum plant is a non-naturally occurring or transgenic host Nicotiana tabacum plant comprising a heterologous ADC from Nicotiana glauca (NgADC1).

[0148] In another aspect, there is disclosed a dried or lyophilised green plant leaf harvested from a mature flowering Nicotiana tabacum plant comprising a ratio of anabasine:anatabine of about 0.25; or a ratio of anabasine:nornicotine of about 0.15; or a ratio of anabasine:nicotine of about 0.008; or a ratio of anatabine:nornicotine of about 0.62; or a ratio of anatabine:nicotine is about 0.03; or a ratio of nornicotine:nicotine of about 0.05; or a ratio of anabasine:anatabine of about 0.25; and a ratio of anabasine:nornicotine of about 0.15 and a ratio of anabasine:nicotine of about 0.008; and a ratio of nornicotine:nicotine of about 0.03; or a ratio of anabasine:anatabine of about 0.25; and a ratio of anatabine:nornicotine of about 0.62; and a ratio of anatabine:nicotine of about 0.03; and a ratio of nornicotine:nicotine of about 0.03. Suitably, the Nicotiana tabacum plant is a non-naturally occurring or transgenic host Nicotiana tabacum plant comprising a heterologous ADC from Nicotiana glauca (NgADC2).

[0149] In another aspect, there is disclosed a dried or lyophilised green plant leaf harvested from a mature flowering Nicotiana tabacum plant comprising a ratio of anabasine:anatabine of about 0.15; or a ratio of anabasine:nornicotine of about 0.08; or a ratio of anabasine:nicotine of about 0.004; or a ratio of anatabine:nornicotine of about 0.58; or a ratio of anatabine:nicotine is about 0.03; or a ratio of nornicotine:nicotine of about 0.05; or a ratio of anabasine:anatabine of about 0.15; or a ratio of anabasine:anatabine of about 0.15; and a ratio of anabasine:nornicotine of about 0.08 and a ratio of anabasine:nicotine of about 0.004; and a ratio of nornicotine:nicotine of about 0.05; or a ratio of anabasine:anatabine of about 0.15; and a ratio of anatabine:nornicotine of about 0.58; and a ratio of anatabine:nicotine of about 0.03; and a ratio of nornicotine:nicotine of about 0.05. Suitably, the Nicotiana tabacum plant is a non-naturally occurring or transgenic host Nicotiana tabacum plant comprising a heterologous ADC from Nicotiana debneyi (NdADC1).

[0150] The alkaloids can be extracted from Nicotiana tabacum host plants using methods described in the art (for example, see Jones, Bernado-Gil and Lourenco (2001) Journal of AOAC International, 84 (2): 309-316). Alkaloids are typically extracted by harvesting the plant material, extracting the alkaloids from the plant using a solvent, and filtering the solvent. The amount of solvent added is typically about 1:1 with the plant matter. The plant material may first be cured or dried and then homogenised or lyophilised into a powder. A typically example of a solvent is water mixed with lime (Ca(OH) 2) and extraction is carried out with organic solvents (such as ether or petroleum spirit), shaken with aqueous acid and allowed to separate. Alkaloid salts are then in the aqueous liquid, while impurities remain in the organic liquid. In a specific example, the solvent can be water or aqueous alcohol combined with a weak or dilute acid, such as water/methanol and shaken. The water/methanol can be in a 3:7 ratio. 1 quinolone may be added to the water/methanol as an internal standard. The mixture may then be filtered. The mixture is then shaken with chloroform or other organic solvents and the alkaloids precipitated by the addition of excess sodium bicarbonate or ammonia before filtration or by extraction with organic solvents. In an alternative, the alkaloids may be extracted using supercritical fluid extraction as described in Kim, Choi and Yoo (2001) Alkaloids: Chemical and Biological Perspectives, Edited by S. William Pelletier, Volume 15, pages 415-431 (2001).

[0151] Supercritical fluid extraction (SFE) possesses several advantages over traditional methods of extracting alkaloids, such as good selectivity, environmental safety, less or no use of organic solvents, and higher speed of extraction. The alkaloids may also be extracted using other methods that are known in the art-such as microwave, soxhlet, steam distillation or ultrasonic extraction as described in Jones et al., (2001) supra. Removal of the solvent from the desired alkaloids may be carried out by known processes, including, but not limited to, distillation, open-dish evaporation, reduced-pressure evaporation, rotary evaporation, vacuum, lyophilization, or a combination of methods thereof.

[0152] Isolation of specific alkaloids from the total alkaloid extraction may be achieved using methods known in the art-such as liquid chromatography, column chromatography comprising a reverse stationary phase, a normal stationary phase or combination thereof, high-performance liquid chromatography, ion-exchange chromatography, gel-permeation (molecular sieve) chromatography, affinity chromatography, paper chromatography, thin-layer chromatography, gas chromatography, dye-ligand chromatography, hydrophobic interaction chromatography, pseudoaffinity chromatography, or high-pressure liquid chromatography. The eluents containing the target alkaloids may then be collected for further processing, such as washing, filtering and drying.

[0153] Methods for determining the levels of each alkaloid or total alkaloids are known in the art. Such methods include, gas-liquid chromatography, high performance liquid chromatography, mass-spectrometry, ultra-high performance liquid chromatography (UHPLC), high-performance thin layer chromatography, gas chromatography/thermal energy analysis, liquid chromatography/mass spectrometry, ion chromatography, radio-immunoassays, and enzyme-linked immunosorbent assays. Methods for determining the levels of alkaloids are described in Sisson and Severson, 1990 supra, DeBoer et al., 2011 supra, Jones et al., 2001 supra, and Zhang et al. 2007. J Am Soc Mass Spectrom, 18:1774-1782). In a preferred example, measurement of each alkaloid or total alkaloids is performed using ultra high-performance liquid chromatography coupled to a mass spectrometer. In a preferred embodiment, UHPLC-MS analysis is used as described in Example 3 herein.

[0154] According to the present invention, a vector or expression vector comprising one or more heterologous ADC polynucleotides is disclosed that can be used to express the heterologous ADC in the Nicotiana tabacum host cell or plant or part thereof comprising the host cell and the like.

[0155] Various forms of expression are contemplated, including nuclear, chloroplast and transient expression.

[0156] Nuclear expression involves transcription in the nucleus and translation in the cytoplasm. It involves the expression of a heterologous polypeptide from the nuclear genome, typically introduced into the plant using either Agrobacterium tumefaciens-mediated transformation or biolistic gene gun-mediated transformation. A popular promoter is the CaMV 35S promoter from the cauliflower mosaic virus which is a strong constitutive promoter. A variety of polyadenylation sequences can be used-such as the Agrobacterium tumefaciens nos gene, the pea ssu gene and the cauliflower mosaic virus 35S transcript. Polyadenylation is one of the major factors determining expression levels and is important for export of mRNA from the nucleus and subsequent translation, as well as being a key element of mRNA stability.

[0157] Chloroplast expression is also contemplated, which involves the introduction of a transgene into the chloroplast genome using a particle gun. A transgene cassette can be created to insert a heterologous ADC gene into a spacer region between functional chloroplast genes, using two known flanking sequences in the chloroplast genome, via homologous recombination. This precise targeting can avoid placing the gene into a part of the genome which is poorly transcribed, ensuring a high level of expression. Transgenes are commonly integrated between the trnl-trnA genes in the rmn operon, as this is a transcriptionally active region that offers very high levels of gene expression. Commonly used sequences in plasmid gene vectors include the bacteriophage T7 gene 10 as a 5 untranslated region to enhance ribosome binding, the use of a 3 untranslated region to ensure transcript stability, and the use of a chloroplast promoter such as psbA.

[0158] Transient expression also allows the production of recombinant protein. In a first transient expression system, plant viruses such at the tobacco mosaic virus are used to introduce the transgene into an infected plant. In another transient expression method, Agrobacterium mediated transient gene expression introducing T-DNA into plant cells is used for high level expression.

[0159] The vector can be complexed with a delivery vehicle-such as a liposome, peptide or poloxamer, a viral vector (including adenoviruses, lentiviruses, retroviruses, Geminiviridae, bean yellow dwarf virus, cabbage leaf curl virus, tomato golden mosaic virus, wheat dwarf virus, sun hemp mosaic virus, potato virus X, tomato bushy stunt virus, tobacco mosaic virus, tobacco rattle virus, tobamovirus, Virgaviridae, and vectors derived therefrom), yeast artificial chromosome, episomes capable of extra-chromosomal replication, or phage (bacterial vectors). The vector may be single or double stranded, linearised or circular. The polynucleotide sequence in a vector can be in one of two possible orientations-sense (same) orientation or reverse (anti-sense) orientationwith respect to the orientation of a regulatory element positioned within the vector.

[0160] The at least one heterologous polynucleotide sequence encoding an ADC is operably linked to one or more regulatory elements. The regulatory element is typically located upstream (that is, 5) to the heterologous polynucleotide sequence and helps to regulate the expression thereof. The regulatory element may be an enhancer, a transcriptional regulatory region, a termination region, or a promoter.

[0161] The promoter sequence can be constitutive, that is, a promoter that is continuously expressed throughout the life of the plant, and therefore allows continual transcription of the downstream heterologous polynucleotide sequence. The promoter can be inducible in that it only allows transcription of the at least one heterologous polynucleotide sequence in certain circumstances. The promoter can be tissue specific, in which case the at least one heterologous polynucleotide sequence is expressed in a particular tissue.

[0162] Examples of constitutive promoters include carnation etched ring virus (CERV), Mirabilis Mosaic Virus (MMV), cauliflower mosaic virus (CaMV) 35S, SSU, OCS, lib4, usp, STLS1, B33, nos, ubiquitin-promoters, phaseolin-promoters, Actin 7 (from Arabidopsis thalania), double enhanced cauliflower mosaic virus promoter, AtSCPL30 (from Arabidopsis thalania), CAMV 19s, double 35S, MMV, and elF4A-10 (from N. tabacum) promoters. In embodiments the promoter may be a constitutive tobacco promoter-such as those described in European patent EP0938572. In embodiments, the promoter may be leaf specific, such as pyruvate, orthophosphate dikinase (PPDK) from the C4 plant (maize), cab-m1Ca+2 promoter from maize, the Arabidopsis thaliana myb-related gene promoter (Atmyb5), the ribulose biphosphate carboxylase (RBCS) promoters (such as RBCS1, RBCS2 and RBCS3A genes from tomato). In embodiments, the promoter may be root-specific such as NIREL1 from tobacco (Zhang et al. 2016. Plant Cell Reports, 35, 757-769), the tobacco RB7 promoter (U.S. Pat. No. 5,459,252), maize promoter CRWAQ81 (US published patent application Ser. No. 20/050,097633); the Arabidopsis ARSKI promoter (Hwang and Goodman (1995) Plant J. 8:37-43), the maize MR7 promoter (U.S. Pat. No. 5,837,848), the maize ZRP2 promoter (U.S. Pat. No. 5,633,363), the maize MTL promoter (U.S. Pat. Nos. 5,466,785 and 6,018,099) the maize MRSI, MRS2, MRS3, and MRS4 promoters (U.S. patent application No. 20050010974), or an Arabidopsis cryptic promoter (U.S. Pat. No. 7,674,893).

[0163] In one embodiment, the promoter is the constitutive MMV promoter.

[0164] Examples of termination regions include Agrobacterium tumefaciens nopaline synthase terminator (nos), Agrobacterium tumefaciens mannopine synthase terminator (Tmas), CaMV 35S terminator (T35S), pea ribulose bisphosphate carboxylase small subunit termination region (TrbcS) or the Tnos termination region.

[0165] The vector may additionally comprise or contain a selection marker or detectable agent that permits the selection of, or screening for a plant cell, plant or part thereof containing the selection marker or detectable agent. The selection marker or detectable agent may be a sequence encoding antibiotic or herbicide resistance. The selection marker or detectable agent may be one or more of adenosine deaminase, dihydrofolate reductase, hygromycin-B-phosphotransferase, thymidine kinase, xanthine-guanine phospho-ribosyltransferase, chlorsulfuron, phosphinothricin, glyphosate and glufosinate resistance, and amino-glycoside 3-O-phosphotransferase. Selection markers may confer resistance to G418, hygromycin, tetracyclin, bleomycin, kanamycin, neomycin, or gentamicin. The construct may also contain a selection marker or detection agent comprising a gene that confers resistance to herbicidal phosphinothricin analogs like ammonium gluphosinate (Thompson et al, EMBO J 9:2519-23 (1987)). In embodiments the selection marker or detectable agent may be a green fluorescent protein (GFP), luciferase, beta-glucuronidase, glutathione S-transferase, polyhistidine, c-myc, hemaglutinin.

[0166] Other nucleic acid sequences encoding additional functional elements may also be present as known in the art. These may include replication sequences, or T-DNA sequences, for example.

[0167] An exemplary vector for use in the present invention is a GATEWAY vector (Karimi M, Inz D, Depicker A. GATEWAY vectors for Agrobacterium-mediated plant transformation. Trends Plant Sci. (2002) May; 7 (5): 193-5) containing the MMV promoter and a 3 nos terminator sequence of the nopaline synthase gene of Agrobacterium tumefaciens. The heterologous sequences are flanked between MMV and the 3 nos terminator sequence.

[0168] The use of promoters having different strengths is also contemplated herein as the amount of heterologous polypeptide that is expressed may alter the levels of one or more alkaloids. MMV promoter is a very strong promoter, like the 35S promoter. The MMV promoter is described in Plant Mol Biol. (1999) July; 40 (5): 771-82. The 35S promoter is described in Current Plant Biology (2020), Volume 24. As known in the art, there are a number of methods of introducing polynucleotides or polypeptides or vectors or constructs and the like into a plant cell, plant or part thereof. Such methods may include infiltration with bacteria (such as Agrobacterium, Rhizobium, Sinorhizobium, or Mesorhizobium), freeze-thaw method, leaf-disc transformation, viral-vector mediated transformation, sonication, microinjection, plant virus-mediated transfer, wound inoculation, particle bombardment, electroporation, direct gene transfer (also referred to as direct DNA uptake), genome editing (including CRISPR (Plant Methods (2016) 12:8; and Front Plant Sci. 20 (2016) 7:506), TALENS, zinc finger nucleases), biolistic methods, cationic lipid-mediated transfection or polyethylene glycol-assisted protoplast transformation. Such methods are well known in the art and are described in Davey and Anthony (2010) Plant cell culture: essential methods. Wiley-Blackwell, Gallois and Marinho (1995) Leaf disc transformation using Agrobacterium tumefaciens. In: Jones (eds). Plant Gene Transfer and Expression Protocols. Methods in Molecular Biology, 49. Springer, and Smith (2013) Plant tissue culture: techniques and experiments. 3rd edition. Elsevier Inc. The host plant can be transformed as a whole plant, for example, by submersion in a medium comprising Agrobacterium tumafaciens and placed under a vacuum. The vacuum can be between 40-400 mbar and for between 30 to 60 seconds. The vacuum can be at 50,100,150, 200, 250, 300, 350 or 400 mbar. The vacuum can be applied for 30, 40, 50 or 60 seconds. The host plant is then produced by transforming a plant cell or leaf disc using standard techniques in the art, and then regenerating the plant cell or leaf disc into a plant.

[0169] Successful insertion of a heterologous polynucleotide into the host may be detected using methods standard in the art, and include, but are not limited to, methods such as sequencing (such as Sanger sequencing or next-generation sequencing), or microarrays. Expression of a heterologous polynucleotide may be detected by methods standard in the art, and include, but are not limited to, PCR (including RT-PCR, and real time PCR), Northern blotting, in-situ hybridisation, nuclease protection assays, RNA microarrays, Western blotting, enzyme-based immunosorbent assays, dot blotting, immunocytochemistry, immunohistochemistry, mass spectrometry, high-performance liquid chromatography, affinity chromatography, gel-filtration chromatography, ion-exchange chromatography, liquid chromatography, liquid chromatography-mass spectrometry, or immunoprecipitation. PCR may be carried out using one or more primers. Exemplary primers comprise, consist or consist essentially of SEQ ID NOs: 7-12, preferably pairing SEQ ID NOs: 7 and 8, 9 and 10 or 11 and 12. Alternatively, primers or probes may comprise a sequence complementary to at least 10, 15, 17, 18, 19, 20, 21, 22, 25, 30, 50, or 100 nucleotides of SEQ ID NOs: 1, 3 or 5.

[0170] In a further aspect, there is also provided a method of detecting a heterologous polynucleotide(s) as described herein in a sample, said method comprising (a) providing a sample comprising, or suspected of comprising, the polynucleotide of interest; (b) contacting said sample with one or more primers or one or more probes for specifically detecting at least a portion of the polynucleotide(s); and (c) detecting the presence of an amplification product, wherein the presence of an amplification product is indicative of the presence of the polynucleotide(s) in the sample.

[0171] In a further aspect, there is also provided the use of one or more primers or probes for specifically detecting at least a portion of the polynucleotide(s) described herein.

[0172] Kits for detecting at least a portion of the polynucleotide(s) described herein are also provided which comprise one or more primers or probes for specifically detecting at least a portion of the polynucleotide(s). The kit may comprise reagents for polynucleotide amplification-such as PCRor reagents for probe hybridization-detection technologysuch as Southern Blots, Northern Blots, in-situ hybridization, or microarray. The kit may comprise reagents for antibody binding-detection technology such as Western Blot, ELISA, SELDI mass spectrometry or test strips. The kit may comprise reagents for DNA sequencing. The kit may comprise reagents and instructions for using the kit. To facilitate detection of amplification products, the one or more primers or probes may be labelled using any conventional labelling method. The presence of the heterologous polypeptide may be determined by methods including, but not limited to, Western blotting, enzyme-based immunosorbent assays, dot blotting, immunocytochemistry, immunohistochemistry, mass spectrometry, high-performance liquid chromatography, affinity chromatography, gel-filtration chromatography, ion-exchange chromatography, liquid chromatography, liquid chromatography-mass spectrometry, or immunoprecipitation.

[0173] Modified alkaloid content, effected in accordance with the present invention, can be combined with other traits of interest-such as disease resistance, pest resistance, high yield or other desirable commercially acceptable genetic background. Accordingly, the presently described host plant cells, plants or parts thereof may also be transformed or transfected with polynucleotides or polypeptides conferring other traits of interest to obtain host cells with more than one desirable characteristic. Alternatively, a stable non-naturally occurring or transgenic plant comprising the transgenic or non-naturally occurring host cell as disclosed herein may be crossed or introgressed with another cultivar, variety or species with a desirable trait to obtain progeny (plants) with more than one desirable characteristic.

[0174] One or more of the following further genetic modifications (for example, mutations) can be present in the plants and parts thereofincluding modification in one or more genes that are involved in the conversion of nitrogenous metabolic intermediates resulting in lower levels of at least one tobacco-specific nitrosamine (TSNA); modification of one or more genes that are involved in heavy metal uptake or heavy metal transport resulting in lower heavy metal content; modification of isopropylmalate synthase which results in a change in sucrose ester composition which can be used to alter flavour profile (see WO2013029799); modification of threonine synthase in which levels of methional can be modulated (see WO2013029800); modification of neoxanthin synthase, lycopene beta cyclase or 9-cis-epoxycarotenoid dioxygenase to modulate beta-damascenone content to alter flavour profile (see WO2013064499); modification of the CLC family of chloride channels to modulate nitrate levels therein (see WO2014096283 and WO2015197727); modification of asparagine synthetase to modulate levels of asparagine in leaf and modulated levels of acrylamide in aerosol produced upon heating or combusting the leaf (see WO2017042162). Other traits of interest may include alternative means of altering alkaloid levels. For example, the plant cell, plant or part thereof, tobacco product or smoking article may also comprise a modification in one or more N-demethylases to further alter the levels of nornicotine and metabolites of nornicotine during curing or drying (WO2015/169927). In embodiments, the expression or function of one or more genes involved in synthesising nicotine may also be altered, such as A622, BBLa, BBLb, JRESL 1, JRE5L2, MATE1, MATE 2, MPO1, MPO2, MYC2a, MYC2b, NBB1, nic1, nic2, NUP1, NUP2, PMT1, PMT2, PMT3, PMT4 or QPT. In embodiments, the expression or function of one or more genes involved in modulating the levels of alkaloids may also be altered, such as BBLa, BBLb, JRESL 1, JRE5L2, MATE1, MATE 2, MYC2a, ODC, MYC2b, nic1, nic2, NUP1 or NUP2.

[0175] The present disclosure also relates to methods of producing the non-naturally occurring or transgenic host plant cell described herein. The method may comprise (a) providing a host plant cell; and (b) modifying said host plant cell to comprise at least one heterologous polynucleotide or polypeptide as described herein or a construct, vector or expression vector comprising a heterologous ADC polynucleotide as described herein. In embodiments, the method of modifying the plant cell (b) may include but are not limited to bacterial infiltration (such as Agrobacterium, Rhizobium, Sinorhizobium, or Mesorhizobium), particle bombardment, electroporation, direct gene transfer, freeze-thaw, viral-vector mediated transformation, sonication, microinjection, plant virus-mediated transfer, wound inoculation, biolistic methods, cationic lipid-mediated transfection or polyethylene glycol-assisted protoplast transformation. In embodiments, the plant cell may then be regenerated into a host plant. In embodiments the plant is then propagated and optionally plant material is harvested from the plant. In embodiments, the plant material is cured or dried. In embodiments, the plant material is air cured, fire cured, smoke cured, flue cured or sun cured. In embodiments, the plant material, including the cured or dried plant material, is incorporated into a tobacco product or smoking article. Therefore, the present disclosure describes methods for producing a host plant cell, plant or part thereof (including plant material and cured or dried plant material), tobacco products and smoking articles with altered levels of one or more alkaloids, or total alkaloids. The present disclosure also describes methods for altering the levels of one or more alkaloids, or total alkaloids in Nicotiana tabacum plants using the method described herein.

[0176] The present disclosure also relates to alternative methods of producing the non-naturally occurring or transgenic host plant described herein. The alternative method may comprise (a) providing a host plant; (b) transforming the plant with bacteria comprising at least one heterologous polynucleotide disclosed herein; and (c) propagating the plant. In embodiments, the method of transforming (b) involves submerging the plant in a medium comprising bacteria comprising the heterologous polynucleotide. In embodiments the method of transforming (b) involves syringe, wound transfer or vacuum infiltration. The bacteria may include, but are not limited to, Agrobacterium, Rhizobium, Sinorhizobium, or Mesorhizobium. The method may further comprise (d) harvesting plant material from the plant. In embodiments, the plant material is cured or dried. In embodiments, the plant material is air cured, fire cured, smoke cured, flue cured or sun cured. In embodiments, the plant material, including the cured or dried plant material, may be incorporated into a tobacco product or smoking article. Therefore, the present disclosure describes methods for producing a host plant or part thereof (including plant material and cured or dried plant material), tobacco products and smoking articles with altered levels of one or more alkaloids or total alkaloids. The present disclosure also describes methods for altering the levels of one or more alkaloids, or total alkaloids in Nicotiana tabacum plants using the method described herein.

[0177] In a particular aspect, there is disclosed a method for producing the non-naturally occurring or transgenic host Nicotiana tabacum plant cell described herein, said method comprising: (a) providing a host plant cell from a Nicotiana tabacum plant; (b) modifying said host Nicotiana tabacum plant cell to comprise at least one of: (i) a heterologous polynucleotide comprising, consisting, or consisting essentially of a polynucleotide sequence having at least 96% sequence identity to SEQ ID NO: 1, or at least 97% sequence identity to SEQ ID NO: 3; or (ii) a heterologous polypeptide encoded by the polynucleotide set forth in (i); or (iii) a heterologous polypeptide comprising, consisting or consisting essentially of a polypeptide sequence having at least 97% sequence identity to SEQ ID NO: 2, at least 97.5% sequence identity to SEQ ID NO: 4; or (iv) a construct, vector or expression vector comprising the heterologous polynucleotide of (i), suitably wherein the heterologous polynucleotide is operably linked in the construct, vector or expression construct to a regulatory element, more suitably wherein the regulatory element is a promoter; or (v) a heterologous polynucleotide comprising, consisting, or consisting essentially of a polynucleotide sequence having at least 96.5% sequence identity to SEQ ID NO: 5; or (vi) a heterologous polypeptide encoded by the polynucleotide set forth in (v); or (vii) a heterologous polypeptide comprising, consisting or consisting essentially of a polypeptide sequence having at least 97.5% sequence identity to SEQ ID NO: 6; or (viii) a construct, vector or expression vector comprising the heterologous polynucleotide of (v), suitably wherein the heterologous polynucleotide is operably linked in the construct, vector or expression construct to a regulatory element, more suitably wherein the regulatory element is a promoter; wherein said heterologous polynucleotide or polypeptide encodes an arginine decarboxylase (ADC).

[0178] Steps of each method disclosed herein may be performed in any order. In preferred embodiments, the steps of the methods disclosed herein may be performed in the order in which they appear, that is, (a), then (b) then (c) etc.

[0179] Any suitable method for regenerating or growing a plant from a plant cell or plant tissue may be used, such as, tissue culture or regeneration from protoplasts. Suitably, plants may be regenerated by growing transformed plant cells on callus induction media, shoot induction media or root induction media. See, for example, Negrutiu (1992) In Linsey (eds). Plant Tissue Culture Manual: 213-223; Hsu et al. 2020. Frontiers in Genome Editing, 2:39, and Shoyeb et al. 2020. Current Journal of Applied Science and Technology, 39 (32): 1-9. The plants may then be grown, and either pollinated with the same transformed strain or different strains, and the resulting hybrid having expression of the desired characteristic identified. Two or more generations may be grown to ensure that expression of the desired characteristic is stably maintained and inherited and then seeds harvested and analysed using methods for detecting polynucleotide insertion/expression or alkaloid levels as described herein to ensure expression of the desired characteristic has been achieved.

[0180] Methods of asexually propagating plants are well known in the art, and include, but are not limited to stem, leaf, and tip cuttings, layering, division, budding and grafting. Methods of sexual propagation include seed propagation. Such sexual propagation methods may comprise (a) crossing the transgenic or non-naturally occurring plant with a second plant to yield progeny tobacco seed; and (b) growing the progeny seed under plant growth conditions to yield the transgenic or non-naturally occurring plant. In embodiments the progeny may be crossed with itself, the parent plant or another plant, and this process repeated to generate further generations of the transgenic or non-naturally occurring plants.

[0181] In another embodiment, the expression or activity of the endogenous ADC in the host Nicotiana tabacum plant cell is reduced or inactivated. This may reduce or eliminate interference from the endogenous ADC in the host Nicotiana tabacum plant cell. An adverse phenotype which is associated with completely silencing ADC would be avoided since ADC activity would still be provided by the heterologous ADC. The expression or activity of the endogenous ADC can be reduced or inactivated using various methods that are well known in the art-such as by breeding genome modified lines via techniques-such as CRISPR, TALENS, ZFN, silencing (RNAi, miRNA), or mutagenesis and the like. A preferred method involves the use of the bacterial CRISPR/Cas system. CRISPR/Cas technology was implemented in plants in the method of WO 2015/189693, which discloses a viral-mediated genome editing platform that is broadly applicable across plant species. In the context of the present disclosure, a guide RNA may be derived from any of the sequences disclosed herein and the teaching of WO2015/189693 applied to edit the genome of a plant cell. The fast pace of the development of the technology has generated a great variety of protocols with broad applicability in plantae, which have been well catalogued in a number of recent scientific review articles (for example, Plant Methods (2016) 12:8; and Front Plant Sci. (2016) 7:506). A review of CRISPR/Cas systems with a particular focus on its application is described in Biotechnology Advances (2015) 33, 1, 41-52. More recent developments in the use of CRISPR/Cas for manipulating plant genomes are discussed in Acta Pharmaceutica Sinica B (2017) 7, 3, 292-302 and Curr. Op. in Plant Biol. (2017) 36, 1-8. Another preferred method involves the use of mutagenesis, including site-directed mutagenesis, oligonucleotide-directed mutagenesis, chemically-induced mutagenesis, irradiation-induced mutagenesis, mutagenesis utilizing modified bases, mutagenesis utilizing gapped duplex DNA, double-strand break mutagenesis, mutagenesis utilizing repair-deficient host strains, mutagenesis by total gene synthesis, DNA shuffling and the like. Methods that introduce mutations randomly in a polynucleotide can include chemical mutagenesis and radiation mutagenesis. Chemical mutagenesis involves the use of exogenously added chemicals-such as mutagenic, teratogenic, or carcinogenic organic compoundsto induce mutations. Mutagens that create primarily point mutations and short deletions, insertions, missense mutations, simple sequence repeats, transversions or transitions, including chemical mutagens or radiation, may be used to create the mutations. Mutagens include ethyl methanesulfonate, methylmethane sulfonate, N-ethyl-N-nitrosurea, triethylmelamine, N-methyl-N-nitrosourea, procarbazine, chlorambucil, cyclophosphamide, diethyl sulfate, acrylamide monomer, melphalan, nitrogen mustard, vincristine, dimethylnitrosamine, N-methyl-N-nitro-Nitrosoguanidine, nitrosoguanidine, 2-aminopurine, 7,12 dimethyl-benz (a) anthracene, ethylene oxide, hexamethylphosphoramide, bisulfan, diepoxyalkanes (diepoxyoctane, diepoxybutane, and the like), 2-methoxy-6-chloro-9 [3-(ethyl-2-chloro-ethyl) aminopropylamino]acridine dihydrochloride and formaldehyde. Methods that introduce one or more targeted mutations into a polynucleotide sequence include but are not limited to genome editing technology, particularly zinc finger nuclease-mediated mutagenesis, tilling (targeting induced local lesions in genomes), homologous recombination, oligonucleotide-directed mutagenesis, and meganuclease-mediated mutagenesis.

[0182] The present invention also relates to methods of producing one or more alkaloids of interestsuch as one or more of nicotine, nornicotine, anabasine and anatabine-said method comprising: (a) providing a host plant cell; (b) modifying said host plant cell to comprise at least one heterologous ADC polynucleotide or polypeptide as described herein or a construct, vector or expression vector comprising the at least one heterologous ADC polynucleotide or polypeptide as described herein; (c) regenerating the host plant cell into a plant; (d) propagating the plant; (e) harvesting the plant material; (f) homogenising the plant material; and (g) extracting one or more alkaloids of interest from the homogenised plant material.

[0183] The method of modifying the plant cell may include but are not limited to bacterial infiltration (such as Agrobacterium, Rhizobium, Sinorhizobium, or Mesorhizobium), particle bombardment, electroporation, direct gene transfer, freeze-thaw, viral-vector mediated transformation, sonication, microinjection, plant virus-mediated transfer, wound inoculation, biolistic methods, cationic lipid-mediated transfection or polyethylene glycol-assisted protoplast transformation.

[0184] The plant material may be cured or dried, suitably air cured, fire cured, smoke cured, flue cured or sun cured.

[0185] In embodiments, the method of homogenising the plant material includes, but is not limited to, mechanical grinding methods-such as a bead beater, mill, blender, or mortar and pestle. Methods for the extraction of the alkaloids as already described herein may be used. In embodiments the method further comprises: (h) separating or purifying one or more alkaloids. Methods for achieving such separation or purification are described herein.

[0186] The present invention also relates to alternative methods of producing one or more alkaloidssuch as one or more of nicotine, nornicotine, anabasine and anatabine-said method comprising (a) providing a host plant; (b) transforming the plant with bacteria comprising at least one heterologous polynucleotide disclosed herein; (c) propagating the plant; (d) harvesting the plant material; (e) homogenising the plant material; and (f) extracting alkaloids from the homogenised plant material. In embodiments, the method of transforming (b) involves submerging the plant in a medium comprising bacteria comprising at least one heterologous polynucleotide as disclosed herein. In embodiments the method further comprises: (g) separating or purifying one or more alkaloids from the others.

[0187] A tobacco product or smoking article comprising a part of the Nicotiana tabacum plant or the Nicotiana tabacum plant material as described herein is also disclosed. Parts of the plants and plant material as described herein and more particularly the leaf lamina and midrib of Nicotiana tabacum plants, can be incorporated into or used in making various consumable products including but not limited to aerosol forming materials, aerosol forming devices, smoking articles, smokable articles, smokeless products, and tobacco products. Examples of aerosol forming materials include but are not limited to tobacco compositions, tobaccos, tobacco extract, cut tobacco, cut filler, cured or dried tobacco, expanded tobacco, homogenized tobacco, reconstituted tobacco, and pipe tobaccos. Smoking articles and smokable articles are types of aerosol forming devices. Examples of smoking articles or smokable articles include but are not limited to cigarettes, cigarillos, and cigars. Examples of smokeless products comprise chewing tobaccos, and snuffs. In certain aerosol forming devices, rather than combustion (or burning), a tobacco composition or another aerosol forming material is heated, for example, by one or more electrical heating elements or a carbon heat source to produce an aerosol. Typically, in such heated smoking articles, an aerosol is generated by the transfer of heat from a heat source to a physically separate aerosol-forming substrate or material, which may be located within, around or downstream of the heat source. During smoking, volatile compounds are released from the aerosol-forming substrate by heat transfer from the heat source and entrained in air drawn through the smoking article. As the released compounds cool, they condense to form an aerosol that is inhaled by the user. Such devices include, for example, electrically heated aerosol-generating devices in which an aerosol is generated by the transfer of heat from of the aerosol-generating device to the aerosol-forming substrate of a heated smoking article. Suitably, during heating of the aerosol-forming substrate, combustion or burning of the tobacco does not occur. A suitable aerosol forming article is described in WO2013/098405 and comprises an aerosol-forming substrate for generating an inhalable aerosol when heated by an internal heating element of an aerosol-generating device. It can comprise an electrically heated aerosol-generating device comprising an internal heating element. It can further comprise, in a linear sequential arrangement, an aerosol-forming substrate, a support element located immediately downstream of the aerosol-forming substrate, an aerosol-cooling element located downstream of the support element, and an outer wrapper circumscribing the aerosol-forming substrate, the support element and the aerosol-cooling element. The support element can abut the aerosol-forming substrate. The aerosol-forming substrate is penetrable by the heating element of the aerosol-generating device. In another type of heated aerosol forming device, an aerosol is produced by the transfer of heat from a combustible fuel element or heat source to a physically separate aerosol forming material, which may be located within, around or downstream of the heat source. Smokeless tobacco products and various tobacco-containing aerosol forming materials may contain tobacco in any form, including as dried particles, shreds, granules, powders, or slurry, deposited on, mixed in, surrounded by, or otherwise combined with other ingredients in any format, such as flakes, films, tabs, foams, or beads. Smoke is used to describe a type of aerosol that is produced by smoking articles, such as combustible cigarettes, or by combusting an aerosol forming material.

[0188] The invention is further described in the Examples below, which are provided to describe the invention in further detail. These examples, which set forth a preferred mode presently contemplated for carrying out the invention, are intended to illustrate and not to limit the invention.

EXAMPLES

Example 1-Identifying ADC Genes in N. glauca and N. debneyi

Methods

[0189] RNA was extracted from N. debneyi and N. glauca roots using RNeasy Qiagen Plant Mini Kit following manufacturer instructions. The transcriptome was then partially sequenced using the Illumina short-reads sequencing technology. The sequences of the ADC genes in N. glauca and N. debneyi were identified by aligning the N debneyi and N. glauca sequencing data to sequences of NtADC1-S(SEQ ID NO: 13), NtADC1-T (SEQ ID NO: 15), NtADC2-S(SEQ ID NO: 17) and NtADC2-T (SEQ ID NO: 19) from N. tabacum using Burrows-Wheeler Aligner (BWA; see Li H. and Durbin R. (2009) Bioinformatics, 25:1754-60).

[0190] The protein sequences were deduced by converting the codons from the coding regions of the identified ADC genes to amino acids using the standard genetic code. The deduced protein sequences were then aligned with the amino acid ADC sequences of N. tabacum (SEQ ID NOs: 14, 16, 18 and 20), tomato (Solyc10g054440) and Arabidopsis (AtADC1 and AtADC2) using MUSCLE alignment as described in Edgar (2004) BMC Bioinformatics, 5:113. SIFT, Scale-Invariant Feature Transform, was performed using methods previously described in the art (Kumar et al. (2009) supra). SIFT predicts whether an amino acid substitution affects protein function based on sequence homology and the physical properties of amino acids. SIFT can be applied to naturally occurring nonsynonymous polymorphisms and laboratory-induced missense mutations.

Results

[0191] Alignment resulted in the identification of two ADC genes in N. glauca; one in the ADC1 cluster (referred to herein as NgADC1) and one in the ADC2 cluster (referred to herein as NgADC2). Only one ADC gene was identified in N. debneyi which aligned with the ADC1 cluster (referred to herein as NdADC1). The sequence alignment indicated that all ADC sequences, including the ones of Tomato and Arabidopsis, started with the amino acids MPAL. In the middle of the sequences, at position 254, another consensus signature sequence of 29 amino acids was found to be present IGLRAKLRTKHSGHFGSTSGEKGKFGLTT, and was identified as also being common to ADC proteins from Brassica napus, Spinacia oleracea, Solanum tuberosum, Nicotiana attenuate, Capsicum annuum, Datura stramonium, Cannabis sativa, Gossypium hirsutum.

[0192] However, the alignment identified differing amino acids in the protein sequences of ADCs from N. tabacum (including the two sequences originating from the ancestors N. sylvestris and N. tomentosiformis), N. glauca or N. debneyi. There were 14 amino acid changes in NgADC1, 10 amino acid changes for NgADC2 and 13 amino acid changes for NdACD1 compared to the N. tabacum gene products.

[0193] These amino acid changes are not expected to change the three-dimensional structure or core of the ADC as the SIFT scores remained in all cases high (not below 0.1). Nevertheless, the amino acid changes suggested that there may be altered functions between the proteins, particularly with regard to the interactions of the protein with the substrate, and may explain the differences in alkaloid levels between N. debneyi, N. glauca and N. tabacum (see Table 2).

Example 2-Producing N. tabacum Overexpressing Heterologous ADCs

Methods

[0194] The coding sequence (CDS) of NgADC1 (SEQ ID NO: 1), NgADC2 (SEQ ID NO: 3) or NdADC1 (SEQ ID NO:5) was cloned with the constitutive Mirabilis Mosaic Virus (MMV) promoter into a GATEWAY pENTR221 vector (ThermoFisher Scientific, 168 Third Avenue, Waltham, MA, USA). The NgADC1, NgADC2 or NdADC1 gene sequences were flanked between MMV and the 3 nos terminator sequence of the nopaline synthase gene of Agrobacterium tumefaciens in the GATEWAY pENTR221 vector. The constructs were then transformed into A. tumefaciens using heat shock and cultured overnight on LB medium supplemented with antibiotics.

[0195] N. tabacum TN90 (Burley) cultivars were then transformed using standard Agrobacterium-mediated transformation protocols. Briefly, N. tabacum plant tissues were submerged in the transformed A. tumefaciens suspended in distilled water and a 100 mbar vacuum applied for 60 seconds. Plants were then grown for 5-7 days under normal growth conditions.

[0196] To measure the expression of the MMV-NgADC1, MMV-NgADC2 and MMV-NdADC1 constructs, random leaf samples were collected from the TO plants around 5 to 7 days after transformation and lyophilised in liquid nitrogen to form a fine powder. RNA extraction was then performed using the RNeasy mini kit (Qiagen) according to the manufacturer instructions. Reverse transcription was performed to convert RNA into complementary DNA (cDNA) using Superscript IV reverse transcriptase (Thermo Fisher Scientific) following manufacturer instructions. Quantitative real-time PCR was then performed using primer pairs corresponding to SEQ ID NOs: 7 and 8 for NgADC1, SEQ ID NOs: 9 and 10 for NgADC2, and SEQ ID NOs: 11 and 12 for NdADC1. The PCRs were performed under the following reaction conditions: 95 C. for 15 minutes, followed by 50 cycles of 95 C. for 15 seconds (denaturation), 60 C. for 15 seconds (annealing) and 72 C. for 25 seconds (elongation).

Results

[0197] After transformation, expression of NgADC1, NgADC2 and NdADC1 constructs were measured in the flowers of single TO MMV::NgADC1, MMV::NgADC2 and MMV::NdADC1 plants (see FIG. 1). The level of expression of the inserts shown in FIG. 1 demonstrates that these TO plants were correctly transformed. Controls were N. tabacum plants transformed with empty vectors (that is, not expressing an ADC). No changes to visual phenotype were observed in TO plants, nor the T1 growing plants, as compared to the control.

Example 3-Levels of Alkaloids in N. tabacum Overexpressing Heterologous ADCs

Methods

[0198] Green leaves of mature, flowering TO plants (about 3 months after transplantation in pots) were picked at the B-T position on the stalk (upper stalk position) and lyophilised in liquid nitrogen to form a fine powder. To measure the alkaloids, UHPLC-MS analysis was performed. First, alkaloids were extracted from 25 mg of the fine powder using an extraction mixture of water/methanol (3:7 ratio, with 500 ng mL-1 quinoline as internal standard; 5 mL) and agitating on a rotary shaker for 48 hours. The mixture was then filtered (Fisherbrand Sterile PES Syringe Filter with pore size of 0.2 m) and diluted 1:50 with the extraction mixture. A simultaneous determination of alkaloids was performed on an Ultimate 3000 UHPLC system coupled to a Q-Exactive mass spectrometer (Thermo Fisher Scientific, Waltham, MA USA). Chromatographic separation was performed on an Acquity HSS T3 column (1.7 m; 1002.1 mm; Waters, Milford, MA USA) with the column temperature set to 45 C. Eluents were ammonium acetate in water (10 mM; pH=8.9; eluent A) and ammonium acetate in methanol (10 mM; eluent B) applied as a gradient (0 min, 10% B; 0.25 min, 10% B; 4.25 min, 98% B; 5.25 min, 98% B; flow: 0.5 mL.Math.min-1). The injection volume was 5 L. Nicotine, anabasine, myosmine, nornicotine, cotinine, anatabine, and quinoline eluted after 3.89, 3.27, 3.47, 2.76, 2.62, 3.36, and 4.04 min, respectively, and were detected as [M+H]+pseudomolecular ions after positive electrospray ionization.

Results

[0199] The levels of nicotine, nornicotine, anabasine and anatabine were measured in lyophilized green leaves of mature, flowering TO N. tabacum overexpressing NgADC1 (OE-NgADC1), NgADC2 (OE-NgADC2) or NdADC1 (OE-NADC1) and their respective controls. The results are shown in Table 3.

[0200] As demonstrated in FIG. 2, overexpressing NgADC1 in N. tabacum resulted in a significant (P<0.01) reduction of nicotine (reduced by 26%) and nornicotine (reduced by 24%) in the TO plants as compared to the control. A slight, but non-significant increase of anabasine and anatabine was also observed as compared to the control.

[0201] As demonstrated in FIG. 3, overexpressing NgADC2 in N. tabacum also resulted in a significant (P<0.05) reduction of nicotine (reduced by 27%) and nornicotine (reduced by 25%) in the TO plants as compared to the control. No impact on anabasine and anatabine was observed.

[0202] Taken together, these data suggest that NgADC1 and NgADC2 have a similar function regarding the production of alkaloids and indicate that their heterologous expression can be used to decrease the level of nicotine and nornicotine in N. tabacum.

[0203] As demonstrated in FIG. 4, overexpressing NdADC1 in N. tabacum resulted in a significant (P<0.01) increase of nicotine (1.3, 136%), anabasine (1.4, 143% and anatabine (1.6, 167%) in the TO plants as compared to the controls. Nornicotine was also increased (125%). The impact on the alkaloids is the opposite to what was observed in N. tabacum overexpressing NgADC1 (see FIG. 2).

Example 4-Statistical Analysis

[0204] Statistical analysis of the results was performed using the software package Past3.20 (yvind Hammer, April 2018). All experimental results were expressed as meantstandard deviation (SD). Analysis of variance (ANOVA) and mean comparison were performed using Tukey's multiple-range test. A P value of <0.05 was considered to be statistically significant.

[0205] Any publication cited or described herein provides relevant information disclosed prior to the filing date of the present application. Statements herein are not to be construed as an admission that the inventors are not entitled to antedate such disclosures. All publications mentioned in the above specification are herein incorporated by reference. Various modifications and variations of the invention will be apparent to those skilled in the art without departing from the scope and spirit of the invention. Although the invention has been described in connection with specific preferred embodiments, it should be understood that the invention as claimed should not be unduly limited to such specific embodiments. Indeed, various modifications of the described modes for carrying out the invention which are obvious to those skilled in cellular, molecular and plant biology or related fields are intended to be within the scope of the following claims.

TABLE-US-00001 TABLE 1 Table of amino acid substitutions Aliphatic Non-polar Gly Ala Pro Ile Leu Val Polar-uncharged Cys Ser Thr Met Asn Gly Polar-charged Asp Glu Lys Arg Aromatic His Phe Trp Tyr

TABLE-US-00002 TABLE 2 Levels of alkaloids in wild type Nicotiana species Total alkaloids Nicotine Nornicotine Anabasine Anatabine Species (mg/g) (%) (%) (%) (%) N. tabacum 6.1 95.1 1.1 0.4 3.4 N. glauca 4.2 1.8 0.3 97.6 0.3 N. debneyi 5.6 40.8 5.2 48.6 5.4
Data from Sisson and Severson (1990) Supra

TABLE-US-00003 TABLE 3 Alkaloid measurements in Control, OE-NgADC1, OE-NgADC2 and OE-NADC1 Average SD Control NICOTINE 10388.99 954.52 NORNICOTINE 561.56 62.99 ANABASINE 42.66 6.54 ANATABINE 243.29 44.90 OE-NgADC1 NICOTINE 8157.17 2286.28 NORNICOTINE 433.20 92.84 ANABASINE 61.76 26.33 ANATABINE 316.98 111.46 OE-NgADC2 NICOTINE 7759.15 2088.38 NORNICOTINE 430.22 107.39 ANABASINE 66.03 56.86 ANATABINE 267.68 244.46 OE-NdADC1 NICOTINE 14152.89 3248.47 NORNICOTINE 702.13 153.70 ANABASINE 61.18 10.75 ANATABINE 406.21 93.48

[0206] Alkaloid measurements (average and SD in g/g of leaf dry weight) in leaves of control plants TN90 (n=5), MMV::NgADC1 (n=5), MMV::NgADC2 (n=5) and MMV::NdADC1 (n=4). The control is wild-type N. tabacum.

TABLE-US-00004 TABLE 4 Ratios of alkaloids in Control, OE-NgADC1, OE-NgADC2 and OE-NADC1 OE- OE- OE- Control NgADC1 NgADC2 NdADC1 Anabasine:anatabine 0.18 0.19 0.25 0.15 Anabasine:nornicotine 0.08 0.14 0.15 0.09 Anabasine:nicotine 0.00 0.01 0.01 0.00 Anatabine:nornicotine 0.43 0.73 0.62 0.58 Anatabine:nicotine 0.02 0.04 0.03 0.03 Nornicotine:nicotine 0.05 0.05 0.06 0.05

[0207] Alkaloid measurements (average and SD in g/g of leaf dry weight) were determined in leaves of control plants TN90 (n=5), MMV::NgADC1 (n=5), MMV::NgADC2 (n=5) and MMV::NdADC1 (n=4). The control is wild-type N. tabacum. All ratios described are calculated by dividing the amount for the first named alkaloid into the amount for the second named alkaloid, for example, to calculate the ratio of anabasine:anatabine the amount of anabasine is divided into the amount of anatabine.

TABLE-US-00005 SEQUENCES SEQIDNO:1NgADC1(CDS) atgcctgccttaggttgttgtgtagacgctgctgtttctcctcctcccggctattccttcctttgggatagttct cttcccgcgccggggatttttccctccggcgtacctccgttgacaaacaccgccgctgctgccaccaccaccacc cattggtctccggctcactcatccgctctttattgtattgacggatggggagctccgtatttcaccgttaattcc tccggtgatatctccgttaagccacatggtacggaaactctgcctcaccaggaaatcgatctccttaaggtcgtg aaaaaggcctccgacccgaaaaatttgggcggactcgggttgcagtttccgctcgttgttcggttccctgatatt ctgaaaaaccggttggagtctcttcaatcggtttttgattatgctgttcagtcacaaggttatgaggctcactac caaggtgtttatcctgttaaatgcaatcaggacaggttcgttgttgaagatattgtcaaatttgggtcgggtttc cggttcggtctcgaagctgggtctaaacctgagcttctcctagctatgagctgtctctgcaagggcagtcgtgag ggtcttcttgtatgcaacgggttcaaggatgctgagtacatttcgcttgctttggttgcaaggaagctaatgttg aatacagtaattgtgcttgaacaagaagaggagcttgatttggtgattgacatcagcaagaaaatggcggtccgg cctgtgatagggcttcgggctaagctcaggaccaagcattcgggccatttcggatccacttctggagagaaaggt aaatttgggcttacaacaacacagatcgttcgtgtggtgaagaagctagaagaatctgaaatgttggattgtctt cagttgctgcattttcatattggatctcagatcccttcgacagctttgcttgctgatggcgttggtgaggctgcc cagatttactgtgaattagtccgcctcggagctggcatgaaatacatcgattgtggtggtggccttggaattgac tatgatggatcaaaatcgtgtgattcagattgttctgttggatatggccttcaggagtatgcatctacggttgtt caagctgttcgatttgtttgtgatcggaagaatgtgaaacatccggtgatctgtagcgagagtgggagagcaatt gtatctcatcactctgttctgatatttgaggctgtgtcttcaactagtacacgctcacaagagttgtcttccttt tatctccagtcatttgtggagaagcttagtgatgatgctcgtgctgattatcggaatttatctgctgctgctatt cgtggagagtacgatacatgtgtactttatgccgatcagttgaagcagagatgtgtggagcagttcaaagatggt gatttggacattgaacaacttgctgccgtggacggcatttgtgacttcgtgtcgaaggctattggggcttctgat cctgtccgcacataccatgtgaatctttcgatcttcacttcaattcctgatttttgggcaattgaccaactattc ccaattgttcccatccataagctagatgaaaggcctggagtcagaggaattttatcggacttgacctgtgatagt gatgggaagattgataagttcataggaggagagtcaagcttgccgctccatgaattaggaagtaatggtggtggt agtggtgatggtgggaaatactatctaggaatgtttttgggtggggcttatgaggaggcgctcgggggactccat aacctatttggcggacctagcgttttgcgtgtgtcgcagagtgatagcccacacagcttcgctgtgacatgcgct gttcctggtccatcttgtgctgacgttctccgggcgatgcagcacgagcctgaactcatgttcgagatgctcaag caccgtgctgatgaattcatgcacaacgacgacgaacaagaagaggataaggggcttgcatttgcatctttggcg agtagcttagctcagtcattcaacaatatgccttaccttgttactgattcatcttgctgcattactgctgccaat aacggtggctattactattgcaatgatgagaacattgttggggttgtcgcagaatctgctgcagctgaagaagag ctttggccttactgtgttgcttga SEQIDNO:2NgADC1geneproduct MPALGCCVDAAVSPPPGYSFLWDSSLPAPGIFPSGVPPLINTAAAATTTTHWSPAHSSALYCIDGWGAPYFTVNS SGDISVKPHGTETLPHQEIDLLKVVKKASDPKNLGGLGLQFPLVVRFPDILKNRLESLQSVFDYAVQSQGYEAHY QGVYPVKCNQDRFVVEDIVKFGSGFRFGLEAGSKPELLLAMSCLCKGSREGLLVCNGFKDAEYISLALVARKLML NTVIVLEQEEELDLVIDISKKMAVRPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQIVRVVKKLEESEMLDCL QLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGAGMKYIDCGGGLGIDYDGSKSCDSDCSVGYGLQEYASTVV QAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEAVSSTSTRSQELSSFYLQSFVEKLSDDARADYRNLSAAAI RGEYDTCVLYADQLKQRCVEQFKDGDLDIEQLAAVDGICDFVSKAIGASDPVRTYHVNLSIFTSIPDFWAIDQLF PIVPIHKLDERPGVRGILSDLTCDSDGKIDKFIGGESSLPLHELGSNGGGSGDGGKYYLGMFLGGAYEEALGGLH NLFGGPSVLRVSQSDSPHSFAVTCAVPGPSCADVLRAMQHEPELMFEMLKHRADEFMHNDDEQEEDKGLAFASLA SSLAQSFNNMPYLVTDSSCCITAANNGGYYYCNDENIVGVVAESAAAEEELWPYCVA SEQIDNO:3NgADC2(CDS): atgccggccctaggttgttgtgtagacgctgctgctgtttctcctcctcttggctatgccttctctcgggatagc tctcttcccgcgccggagttctttacctccggcatacctccgacaaattccgccgccgcttcccattggtctccg gatttgtcctctgctttgtacggggtcgatgggtggggggctccttatttctctgttaactctaacggagatatc tccgtccgaccacatggtatggacactctccctcaccaggaaattgaccttctcaaggtcgtgaaaaaggcctcc gacccgaaaaattcaggtgggcttggtcttcagctacctcttgttgttcgcttccctgatgtgctaaaaaaccgg ttggaatctctgcagtcggcttttgatctcgcggttcattcccagggctatggggcccacttccaaggtgtttat cccgtgaaatgcaatcaagaccggttcgtggtggaagatattgtcaaattcgggtcgtcattccggttcgggttg gaagccgggtctaaacccgagctcctgttagccatgagctgtctctgcaagggtagtgctgagggccttctcgtt tgcaatggtttcaaggacgctgagtacatttcgcttgctttggttgcaagaaagctcatgttgaacactgtaatt gtgcttgaacaagaggaggagcttgaccttgtgattgatataagccgtaagatggctgttcggcctgtaattgga cttcgggctaagctcaggaccaagcattcaggccattttggatccacttctggagaaaaaggtaagtttgggctt acaactacccaaattgttcgtgtagtgaagaagctggaagaatcaggaatgctggattgccttcagttgctgcat tttcacattggatctcaaatcccttcaacagcggtgcttgctgacggtgttggtgaggctgctcagatttattgt gaattagtccgtcttggtgcgggtatgaagttcattgatactggaggtgggcttggaattgattatgatggtact aaatcatgcgattctgacgtctctgttggctatggcattcaagaatatgcctccacagttgtccaggaggttcaa tatgtatgcgaccgtaagggcgtgaagcacccagtgatttgcagcgaaagtggcagggcaattgtttctcatcac tcaattctgattttcgaagccgtgtcttcttctagtactcatgtttcttcttcacatctgtcttctggtgtcctc caatccatggcggagacgctcaatgaagatgcccttgccgattaccgcaatttatctgctgctgcagttcgtgga gagtacgagacatgtgtactttactctgatcagttgaaacagagatgtgtggatcagtttaaagaagggtccttg ggtattgaacatcttgctgctgttgatagcatctgtgactttgtatcaaaggctatgggggctgctgatcctgtc cgcacttaccatgtgaatctgtcaattttcacttcaattcctgatttttgggcctttggtcaattgtttcctgtt gttccaatacaccgtttagatgaaaagcctgcagtaaggggaatattatcggacttgacttgtgacagtgatggg aaggttgataagttcattggtggcgaatcaagcttgccgctacatgaattgggaagtaacggcgatggtggtggg tactatctggggatgtttttgggcggggcttatgaggaggcgctcggaggactccacaacttgtttggtggacca agtgtcgtgcgcgtggtgcagagcgatagcgctcacagcttcgccatgactcgctccgtccctggcccgtcctgt gcagacgtgctccgagcgatgcagcacgagcccgagctcatgttcgagacactcaagcaccgtgcagaggaattc ttggaacaggaagatgacaaagggctggccgttgcatctttggccagcagcttagctcagtccttccataacatg ccttaccttgtggcgcctgcatcttgctgcttcactgcagcggctgctaacaatggtggctataattactattac agtgatgagaatgcagcagattctgctacaggggaggatgagatttggtcctattgcactgcttga SEQIDNO:4NgADC2geneproduct MPALGCCVDAAAVSPPLGYAFSRDSSLPAPEFFTSGIPPTNSAAASHWSPDLSSALYGVDGWGAPYFSVNSNGDI SVRPHGMDTLPHQEIDLLKVVKKASDPKNSGGLGLQLPLVVRFPDVLKNRLESLQSAFDLAVHSQGYGAHFQGVY PVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCKGSAEGLLVCNGFKDAEYISLALVARKLMLNTVI VLEQEEELDLVIDISRKMAVRPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQIVRVVKKLEESGMLDCLQLLH FHIGSQIPSTAVLADGVGEAAQIYCELVRLGAGMKFIDTGGGLGIDYDGTKSCDSDVSVGYGIQEYASTVVQEVQ YVCDRKGVKHPVICSESGRAIVSHHSILIFEAVSSSSTHVSSSHLSSGVLQSMAETLNEDALADYRNLSAAAVRG EYETCVLYSDQLKQRCVDQFKEGSLGIEHLAAVDSICDFVSKAMGAADPVRTYHVNLSIFTSIPDFWAFGQLFPV VPIHRLDEKPAVRGILSDLTCDSDGKVDKFIGGESSLPLHELGSNGDGGGYYLGMFLGGAYEEALGGLHNLFGGP SVVRVVQSDSAHSFAMTRSVPGPSCADVLRAMQHEPELMFETLKHRAEEFLEQEDDKGLAVASLASSLAQSFHNM PYLVAPASCCFTAAAANNGGYNYYYSDENAADSATGEDEIWSYCTA SEQIDNO:5NdADC1(CDS) atgcctgccttaggttgttgtgtagacgctgctgtttctcctcctcccggctattccttcctttgggatagctct cttcctgcgccggagatttttccctccggcgtacctccgtcgacaaacaccgccgctgccaccaccaccaccacc cactggtctccggcgcactcatccgctctttattctattgacggatggggtgctccgtatttcaccgttaattcc tccggtgatatctccgttaagccacatggcacggaaactatgcctcaccaggaaatcgatctccttaaggtcgtg aaaaaggcctccgatccgaaaaatttgggcggactcgggttgcagtttccgctcgttgttcggttccctgatatt ctgaaaaatcggttggagtctcttcaatcagtttttgattatgcggttcagtcacaaggttatgaagctcactac caaggtgtttatcctgtgaaatgcaatcaggacaggttcgttgtagaagatattgtcaaattcgggtcgggtttc cgcttcggtcttgaagccgggtctaaacctgagctcctcctagctatgagctgtctctgcaaaggcagccgtgag ggttttcttgtatgcaacgggttcaaggatgcggagtacatttcgcttgctttggttgcaaggaagctcatgttg aatacagtaattgtgcttgaacaagaggaggagcttgatttggtgattgacatcagcagaaaaatggcggtccga cctgtgatcgggcttcgggctaagctcaggaccaaacattcaggacatttcggatccacttcgggagagaaaggt aagtttggacttacgactacacagatagttcgtgtggtgaagaagctagaagaatccgaaatgctggattgtctt cagttgctgcattttcatattggatctcagataccttcgaccgctttgcttgctgatggcgttggtgaggctgcc cagatttactgtgaattagtccgcctcggtgctggcatgaaatacgtcgattgtggtggtggccttggaattgac tatgatggtacaaaatcttgtgattccgattgttctgttggatatggccttcaggagtatgcatctacggttgtt caagctgttcaatttgtttgtgaccggaagaatgtgaaacatccggtgatctgtagcgagagtggtagagcaatt gtatctcatcactctgttctaatatttgaggctgtttcttcaactacaacacgctcacaagagttatcttctgtt gatctccagtcatttgtggagaagcttaatgatgatggtcgtgctgattatcggaatttatctgctgctgctatt cgtggagagtacgatacatgtgtactttatgccgatcagttgaaacagagatgtgtggagcagttcaaagatggt gatttggacattgaacaacttgctgccgtggatggcatttgtgacttcgtgtcgaaggctattggggcttctgat cctgtccgcacataccatgttaatctttcgatcttcacttcaattcctgatttttgggcaattgaccaactattc ccaattgttcccatccataagctagatgaacggcctggtgtccgaggaattttatcggacttgacctgtgatagt gatgggaagattgataagttcattggaggggagtcaagtttgccgctccatgaattaggaagcaatggtggtggt agtggtgatggtgggaaatactatctgggaatgtttttgggtggggcttatgaggaggcgctcgggggactccat aacctatttggcggacccagcgttttgcgtgtgtcacagagcaatagcccgcacagcttcgctgtgacatccgct gttcctggtccgtcttgtgctgatgttctccgggcgatgcagcacgagcctgaactcatgttcgagacactcaag caccgcgctgaagaattcgtgcacgaccacgacgaacaagaagaagataaggggcttgcacttgcctctttggcc agcagcttagctcagtcattcaacaatatgccttacctttctactaattcatcttgctgccttactgctgccaat aacagtggctattactattgcaatgatgagaacattgttggagttggcgcagaatctgctgcagctgaagaagag ctttggccttactgtgttgcttga SEQIDNO:6NdADC1geneproduct MPALGCCVDAAVSPPPGYSFLWDSSLPAPEIFPSGVPPSTNTAAATTTTTHWSPAHSSALYSIDGWGAPYFTVNS SGDISVKPHGTETMPHQEIDLLKVVKKASDPKNLGGLGLQFPLVVRFPDILKNRLESLQSVFDYAVQSQGYEAHY QGVYPVKCNQDRFVVEDIVKFGSGFRFGLEAGSKPELLLAMSCLCKGSREGFLVCNGFKDAEYISLALVARKLML NTVIVLEQEEELDLVIDISRKMAVRPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQIVRVVKKLEESEMLDCL QLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGAGMKYVDCGGGLGIDYDGTKSCDSDCSVGYGLQEYASTVV QAVQFVCDRKNVKHPVICSESGRAIVSHHSVLIFEAVSSTTTRSQELSSVDLQSFVEKLNDDGRADYRNLSAAAI RGEYDTCVLYADQLKQRCVEQFKDGDLDIEQLAAVDGICDFVSKAIGASDPVRTYHVNLSIFTSIPDFWAIDQLF PIVPIHKLDERPGVRGILSDLTCDSDGKIDKFIGGESSLPLHELGSNGGGSGDGGKYYLGMFLGGAYEEALGGLH NLFGGPSVLRVSQSNSPHSFAVTSAVPGPSCADVLRAMQHEPELMFETLKHRAEEFVHDHDEQEEDKGLALASLA SSLAQSFNNMPYLSTNSSCCLTAANNSGYYYCNDENIVGVGAESAAAEEELWPYCVA SEQIDNO:7NgADC1forwardprimer-OENgADC1-F agaatctgaaatgttggattgtcttca SEQIDNO:8NgADC1reverseprimer-OENgADC1-R tgaatcacacgattttgatccatcata SEQIDNO:9NgADC2forwardprimer-OENgADC2-F gggctccttatttctctgttaactct SEQIDNO:10NgADC2reverseprimer-OENgADC2-R gatcaaaagccgactgcagagattc SEQIDNO:11NdADC1forwardprimer-OENdADC1-F tgtgtcacagagcaatagcccg SEQIDNO:12NdADC1reverseprimer-OENdADC1-R gcaagtgcaagccccttatcttc SEQIDNO:13NADC1-S(CDS) atgcctgccttaggttgttgtgtagacgctgctgtttctcctcctcccggctattccttcctttgggatagttct cttcccgcgccggagatttttccctccggcgtacctccgtcgacaaacaccgccgttgccaccaccaccaccacc cattggtctccggcgcactcatccgctctttattctattgacggatggggcgctccgtatttcaccgttaattcc tccggtgatatctccgttaagccacatggtacggatactctgcctcaccaggaaatcgatctccttaaggtcgtg aaaaaggcctccgacccgaaaaatttgggcggactcgggttgcagtttccgctcgttgttcggttccctgatatt ctgaaaaaccggttggagtctcttcaatccgtttttgattatgcggttcagtcacaaggttatgaagctcactac caaggtgtttatcctgtgaaatgcaaccaggacaggttcgttgttgaagatattgtcaaattcggatcgggtttc cggttcggtctcgaagctgggtctaaacctgagctcctcctagctatgagctgtctctgcaaaggcagtcatgag ggtcttcttgtgtgcaacgggttcaaggatgctgagtacatttcgcttgctttggttgcaaggaagctcatgttg aatacagtaattgtccttgaacaagaggaggagcttgatttggtgattgacatcagcaagaaaatggcggtccgg cctgtgatcgggcttcgggctaagctcaggaccaaacattcgggtcatttcggatccacttctggagagaaaggt aaatttgggctcacgacaacacagattgttcgtgtggtgaagaagctagaagaatccggaatgctggattgtctt cagttgctgcattttcatatcggatctcaaatcccttcgacggctttgcttgctgatggcgttggtgaggctgcc cagatttactgtgaattagtccgcctcggtgctggcatgaaatacattgattgtggtggtggccttggaattgac tatgatggtacaaaatcatgtgattccgattgttctgttggatatggccttcaggaatatgcatctacggttgtt caagctgttcgatttgtttgtgaccggaagaacgtgaaacatccggtgatctgtagcgagagtgggagagcaatt gtatctcatcactctgttctgatatttgaggctgtgtcttcaactacaacacgctcacaagagttatcttctgtt gatctccagtcatttgtggagaagctcaatgatgatgctcgtgctgattatcggaatttatctgctgctgctatt cgtggagagtacgatacgtgtgtactttatgctgatcagttgaaacagagatgtgtggagcagttcaaagatggt gatttggacattgaacaacttgctgcagtagatggcatttgtgatttcgtgtcgaaggctattggggcttctgat cctgtccgcacataccatgtgaatctttcgatcttcacttcagttcctgatttttgggcaattgaccaactattc ccaattgttcccatccataagctagatgaacggcctgtagttcgaggaattttatcggacttgacctgtgatagt gatgggaagattgataagttcattggaggagagtcaagcttgccgctccatgaattaggaagtaatggtggtggt ggtggtgatggtggaaaatattatctaggaatgtttttgggtggggcttatgaggaggcgcttgggggactccat aacctatttggcggacccagcgttttgcgtgtgtcacagagcgatagcccacacagcttcgccgtgacatgtgct gttcctggtccgtcctgtgctgacgttctccgggcgatgcagcacgagcctgaactcatgttcgagacgctcaag caccgcgctgaagaattcgtgcacaatgacgacgaacaagaagaagataaagggcttgcatttgcatctttggcc agcagcttagctcagtcattcaacaatatgccttaccttgttactaattcatcttgctgccttactgctgctgcc aataacggtggctattactattgcaatgatgagaacattgttggagttggcgcagaatctgctgcagctgaagaa gagctttggccttactgtgttgcttga SEQIDNO:14NtADC1-Sgeneproduct MPALGCCVDAAVSPPPGYSFLWDSSLPAPEIFPSGVPPSTNTAVATTTTTHWSPAHSSALYSIDGWGAPYFTVNS SGDISVKPHGTDTLPHQEIDLLKVVKKASDPKNLGGLGLQFPLVVRFPDILKNRLESLQSVFDYAVQSQGYEAHY QGVYPVKCNQDRFVVEDIVKFGSGFRFGLEAGSKPELLLAMSCLCKGSHEGLLVCNGFKDAEYISLALVARKLML NTVIVLEQEEELDLVIDISKKMAVRPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQIVRVVKKLEESGMLDCL QLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGAGMKYIDCGGGLGIDYDGTKSCDSDCSVGYGLQEYASTVV QAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEAVSSTTTRSQELSSVDLQSFVEKLNDDARADYRNLSAAAI RGEYDTCVLYADQLKQRCVEQFKDGDLDIEQLAAVDGICDFVSKAIGASDPVRTYHVNLSIFTSVPDFWAIDQLF PIVPIHKLDERPVVRGILSDLTCDSDGKIDKFIGGESSLPLHELGSNGGGGGDGGKYYLGMFLGGAYEEALGGLH NLFGGPSVLRVSQSDSPHSFAVTCAVPGPSCADVLRAMQHEPELMFETLKHRAEEFVHNDDEQEEDKGLAFASLA SSLAQSFNNMPYLVINSSCCLTAAANNGGYYYCNDENIVGVGAESAAAEEELWPYCVA SEQIDNO:15NtADC1-T(CDS) atgcctgccttaggttgttgtgtagacgctgctgtttctcctcctcccggctattccttcctttgggatagctct cttcccgcgccggagatttttccctccggcgtacctctgtcgacaaacaccgccgccactaccacgaccaccacc cattggtctccggcgcactcatccgctctttattctattgacggatggggtgctccgtatttcaccgttaattcc tccggtgatatctccgttaagccacatggtacggaaactctgcctcaccaggaaattgatctccttaaggtcgtg aaaaaagcatccgacccgaaaaattcgggtggactcgggttgcagtttccgctcgttgttcggttccctgatatt ctgaaaaaccggttggagtctctacaatcggcttttgattatgcggttcagtcacaaggttatgaggctcactac caaggtgtttatcctgttaaatgcaatcaggacaggttcgttgttgaagatattgtcaaattcgggtcgggtttc cgattcggtctcgaagccggctcgaaacccgagctcctcctagctatgagctgtctctgcaagggcagtcgcgag ggtcttcttgtatgcaacgggttcaaagatgctgactacatttcgcttgctttggttgcaaggaagctcatgttg aatacagtaattgtgcttgaacaagaggaggagcttgatttggtgattgacatcagcagaaaaatggctgtccgg cctttgatcgggcttcgggctaagctcaggaccaaacattccggccatttcggatccacttcaggagagaaaggt aagtttgggcttacgacaacacagatcgttcgtgtggtgaagaagctagaagaatccggaatgttggattgtctt cagctgctgcattttcatattggatctcagatcccttcgacggctttgcttgctgatggcgtgggtgaggccgct cagatttactgtgaattagtccgccttggtgctggcatgaaatacattgattgtggtggtggccttggaattgac tatgatggtacaaaatcgtgtgattccgattgttcagttggatatggccttcaggagtatgcatctacagttgtt caagctgttcgatttgtttgtgatcggaagaatgtgaaacatccggtgatttgtagcgagagtgggagagcaatt gtatctcatcactctgttttgatatttgaggctgtttcttcaactacaacacgctcacaagagttatcttctgtt gatctccagtcatttgtggagaagcttaatgatgatgctcgtgctgattatcggaatttatctgctgctgctatt cgtggagagtacgatacgtgtgtactttatgccgatcagttgaaacagagatgtgtggagcagttcaaagatggt aatttggacattgaacagcttgctgccgtagatggtatttgtgacttcgtgtcgaaggctattggggcttctgat cctgtccgcacatatcatgtgaatctttcgatcttcacttcaattcccgatttttgggcaattgaccaactattc ccaattgttcccatccataagctagatgaacggcctggagtccgaggaatattatcggacttgacctgtgatagt gatgggaagattgataagttcattggaggagagtcaagcttgccgctccatgaattaggaagtaatggtggtggt gatggtgggaaatattatctgggaatgtttttgggtggggcttatgaggaggcgctcgggggcctccataaccta tttggcggacccagtgttttgcgcgtgtcacagagcgatagcccacacagcttcgctgtgacatgcgctgttcct ggtccgtcttgtgctgacgttctccgggcgatgcagcacgagcctgaactcatgttcgagacgctcaagcaccgt gctgaagaattcgtgcataatgacgacgaacaagaagaagataaagggcttgcatttgcatctttagccagcagc ttagctcagtcattcaacaatatgccttaccttgttaccaattcatcttgctgccttactgctaccaataacggt ggctattactattgcaatgatgagaacattgttggggttggcgcagaatctgctgcagctgaggaagagctttgg ccttactgtgttgcttga SEQIDNO:16NtADC1-Tgeneproduct MPALGCCVDAAVSPPPGYSFLWDSSLPAPEIFPSGVPLSTNTAATTTTTTHWSPAHSSALYSIDGWGAPYFTVNS SGDISVKPHGTETLPHQEIDLLKVVKKASDPKNSGGLGLQFPLVVRFPDILKNRLESLQSAFDYAVQSQGYEAHY QGVYPVKCNQDRFVVEDIVKFGSGFRFGLEAGSKPELLLAMSCLCKGSREGLLVCNGFKDADYISLALVARKLML NTVIVLEQEEELDLVIDISRKMAVRPLIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQIVRVVKKLEESGMLDCL QLLHFHIGSQIPSTALLADGVGEAAQIYCELVRLGAGMKYIDCGGGLGIDYDGTKSCDSDCSVGYGLQEYASTVV QAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEAVSSTTTRSQELSSVDLQSFVEKLNDDARADYRNLSAAAI RGEYDTCVLYADQLKQRCVEQFKDGNLDIEQLAAVDGICDFVSKAIGASDPVRTYHVNLSIFTSIPDFWAIDQLF PIVPIHKLDERPGVRGILSDLTCDSDGKIDKFIGGESSLPLHELGSNGGGDGGKYYLGMFLGGAYEEALGGLHNL FGGPSVLRVSQSDSPHSFAVTCAVPGPSCADVLRAMQHEPELMFETLKHRAEEFVHNDDEQEEDKGLAFASLASS LAQSFNNMPYLVINSSCCLTATNNGGYYYCNDENIVGVGAESAAAEEELWPYCVA SEQIDNO:17NtADC2-S(CDS) atgccggccctaggttgttgtgtagatgctgctgttgtttcccctcctctcagctatgccttctctcgggatagc tctcttcccgcgccggagttctttgcctccggcgtacctccgacaaattctgccgctgcttcccattggtctccg gatttgtcgtctgctttatacggggtcgatgggtggggagctccttatttctctgttaactctaatggagatatc tccgtccgaccacacggtacggacactctccctcaccaggaaattgaccttctcaaggtcgtgaaaaaggcctcc gacccgaaaaattcaggtgggcttgggcttcagctgcctcttgttgttcgcttccctgatgtgttgaaaaaccgg ttggaatctctgcaatcggcttttgatctcgcggttcattcccagggctatggggcccactaccaaggtgtttat cccgtgaaatgcaatcaagacaggttcgtggtggaagatatcgtgaaattcgggtcgccattccggttcgggttg gaagccgggtctaaacccgagctcctgttagccatgagctgtctctgcaagggcagtgctgagggccttctcgtt tgcaatggtttcaaggacgctgagtacatttcgcttgctttggttgcaagaaagctcatgttaaacactgtaatt gtgcttgaacaagaggaggagcttgaccttgtgattgatataagccataagatggctgttcggcctgtaattgga cttcgggctaagctcaggaccaagcattcaggccattttggatccacttctggagaaaaaggtaagtttgggctt acaacgacccaaattgttcgtgtggtgaagaagctagaagaatccggaatgctggattgccttcagttgctgcat tttcacattggatctcagatcccttctacggggttgctagctgatggagttggtgaggccgctcagatttattgt gaattagtccgtcttggagcgggtatgaagttcattgatattggaggtgggcttggaattgattatgatggtact aaatcatgcgattctgatgtctctgttggctatggcattcaagaatatgcctccgcagttgttcaggcggttcaa tatgtatgcgaccgtaagggtgtgaaacacccagtgatctgcagcgaaagtggcagggcaattgtttctcatcac tcaattctgattttcgaagccgtgtctgcttctagtactcatgtttcttcttcacatctgtcttctggtggcctc caatccatggcggagacgctcaacgaagatgcccttgctgattaccgcaatttatctgctgctgcagttcgtgga gagtatgagacatgtgtactttactctgatcagttgaaacagagatgtgtggagcagtttaaagaagggtccttg ggtattgaacatcttgctgctgttgatagcatctgtgactttgtatcaaaggctatgggggctgctgatcctgtc cgcacttaccatgtgaatctgtcaattttcacttcaattcctgatttttgggcctttggtcaattgtttccgatt gttccaattcaccgcttagatgaaaagcctgcagtgaggggaatattatcggacttaacttgtgacagtgatggg aaggttgataagttcattggtggcgaatcaagcttgccgctacatgaattgggaagtaatggcgatggtggtggt tattatctggggatgtttttgggtggggcttatgaggaggcgctcggaggactccacaacctgtttggtggacca agtgtcgtgcgcgtggtgcagagcgatagcgctcacagctttgccatgactcgctccgtccctggcccgtcttgc gctgatgtgctccgagcgatgcagcacgagcccgagctcatgttcgagactctcaagcaccgtgcggaggaattc ttggaacaagaagatgacaaagggctggctgttgaatctttggccagcagcgtagctcagtccttccataacatg ccttaccttgtggcgccttcatcttgccgcttcactgctgctactgataacaatggtggctataattactattac agtgatgagaatgcagcagattctgctacaggggaggatgagatttggtcctattgcactgcttga SEQIDNO:18NtADC2-Sgeneproduct MPALGCCVDAAVVSPPLSYAFSRDSSLPAPEFFASGVPPTNSAAASHWSPDLSSALYGVDGWGAPYFSVNSNGDI SVRPHGTDTLPHQEIDLLKVVKKASDPKNSGGLGLQLPLVVRFPDVLKNRLESLQSAFDLAVHSQGYGAHYQGVY PVKCNQDRFVVEDIVKFGSPFRFGLEAGSKPELLLAMSCLCKGSAEGLLVCNGFKDAEYISLALVARKLMLNTVI VLEQEEELDLVIDISHKMAVRPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQIVRVVKKLEESGMLDCLQLLH FHIGSQIPSTGLLADGVGEAAQIYCELVRLGAGMKFIDIGGGLGIDYDGTKSCDSDVSVGYGIQEYASAVVQAVQ YVCDRKGVKHPVICSESGRAIVSHHSILIFEAVSASSTHVSSSHLSSGGLQSMAETLNEDALADYRNLSAAAVRG EYETCVLYSDQLKQRCVEQFKEGSLGIEHLAAVDSICDFVSKAMGAADPVRTYHVNLSIFTSIPDFWAFGQLFPI VPIHRLDEKPAVRGILSDLTCDSDGKVDKFIGGESSLPLHELGSNGDGGGYYLGMFLGGAYEEALGGLHNLFGGP SVVRVVQSDSAHSFAMTRSVPGPSCADVLRAMQHEPELMFETLKHRAEEFLEQEDDKGLAVESLASSVAQSFHNM PYLVAPSSCRFTAATDNNGGYNYYYSDENAADSATGEDEIWSYCTA SEQIDNO:19NtADC2-T(CDS) atgccggccctaggttgttgcgtagacgctactgtttcccctcctctcggctatgccttctctcgggatagctct cttcccgcgccggagttctttacctccggcgtacctcctacaaactccgccgccggttcccattggtctccggat ctgtcctctgctttgtacggggtcgatgggtggggagctccttatttctccgttaactctaacggagatatctcc gtccgaccacatggtacggacacactcccccaccaggaaattgaccttctcaaggtcgtgaaaaaggcctccgac ccgaaaaattcaggggggctcgggcttcagctgcctcttgttgttcgcttccctgatgtgctaaaaaaccggttg gaatctctgcaatcggcttttgatctcgctgttcattcccagggctatggggcccactaccaaggtgtttatccc gtgaaatgcaatcaagacaggttcgtggtggaagatattgtcaaattcgggtcgtcattccggttcgggttggaa gctgggtctaaacccgagctcctgttagccatgagctgtctctgcaggggcagtgctgagggccttctcgtttgc aatggtttcaaggacgctgagtacatttcgcttgctttggttgcaagaaagctcatgttaaacactgtaattgtt cttgaacaagaggaggagcttgaccttgtgattgatataagccgtaagatggctgttcggcccgtaattggactt cgggctaagctcaggaccaagcattcaggccattttggatccacttctggagaaaaaggtaagtttgggcttaca acgacccaaattgttcgtgtagtgaagaagctggaagaatccggaatgctggattgccttcagttgctgcatttt cacattggatctcagatcccttcaacggcgttgcttgctgatggtgttggtgaggctgctcagatttattgtgaa ttaatccgtcttggtgcgggtatgaagttcattgatactggaggtgggctcggaattgattatgatggtactaaa tcatgtgattcagatgtctctgttggctatggcattcaagaatacgcctccacagttgtccaggcggttcaatat gtttgcgaccgtaagggcgtgaagcacccagtgatttgcagcgaaagtggcagggcaattgtttctcatcactca attctgattttcgaagccgtgtctgcttctagcactcatgtttcttcttcacatctgtcttctggtggcctccaa tccatggcggagacgctcaatgaagatgcccttgctgattaccgcaatttatctgctgctgcagttcgtggagag tacgagacgtgtgtactttactctgatcagttgaaacagagatgtgtggatcagtttaaagaagggtccttgggt attgaacatcttgctgctgttgatagcatctgtgactttgtatcaaaggctatgggggctgctgatcctatccgc acttaccatgtgaatctgtcaattttcacttcaattcctgatttttgggcctttggtcaattgtttccgattgtt ccaatacaccgtttagatgaaaagcctgcagtaaggggaatattatcggacttgacttgtgacagtgatgggaag gttgataagttcattggtggcgaatcaagcttgcagctgcatgaattgggaagtaatggcgatggtggtgggtat tatctggggatgtttttgggtggggcttatgaggaggcgctcggaggactccacaacctgtttggtggaccaagc gtggtgcgcgtggtgcagagcgatagcgctcacagcttcgccatgtctcgctccgtccctggcccgtcctgcgcg gacgtgctccgagcgatgcagcacgagcccgagctcatgttcgagactctcaagcaccgtgcggaggaattcttg gaacaagaagaagacaaagggctggccattgcatctttggccagcagcttagctcagtccttccataacatgcct taccttgtggcgcctgcatcttgctgcttcactgcagttactgctaacaacggtggctataactactattacagt gatgagaatgcagcagattctgctacaggggaggatgagatttggtcctattgcactgcttga SEQIDNO:20NtADC2-Tgeneproduct MPALGCCVDATVSPPLGYAFSRDSSLPAPEFFTSGVPPINSAAGSHWSPDLSSALYGVDGWGAPYFSVNSNGDIS VRPHGTDTLPHQEIDLLKVVKKASDPKNSGGLGLQLPLVVRFPDVLKNRLESLQSAFDLAVHSQGYGAHYQGVYP VKCNQDRFVVEDIVKFGSSFRFGLEAGSKPELLLAMSCLCRGSAEGLLVCNGFKDAEYISLALVARKLMLNTVIV LEQEEELDLVIDISRKMAVRPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQIVRVVKKLEESGMLDCLQLLHF HIGSQIPSTALLADGVGEAAQIYCELIRLGAGMKFIDTGGGLGIDYDGTKSCDSDVSVGYGIQEYASTVVQAVQY VCDRKGVKHPVICSESGRAIVSHHSILIFEAVSASSTHVSSSHLSSGGLQSMAETLNEDALADYRNLSAAAVRGE YETCVLYSDQLKQRCVDQFKEGSLGIEHLAAVDSICDFVSKAMGAADPIRTYHVNLSIFTSIPDFWAFGQLFPIV PIHRLDEKPAVRGILSDLTCDSDGKVDKFIGGESSLQLHELGSNGDGGGYYLGMFLGGAYEEALGGLHNLFGGPS VVRVVQSDSAHSFAMSRSVPGPSCADVLRAMQHEPELMFETLKHRAEEFLEQEEDKGLAIASLASSLAQSFHNMP YLVAPASCCFTAVTANNGGYNYYYSDENAADSATGEDEIWSYCTA