NOVEL VACCINE FORMULATIONS FOR MYCOBACTERIUM TUBERCULOSIS AND USE OF THEREOF
20240366741 ยท 2024-11-07
Assignee
- Purdue Research Foundation (West Lafayette, IN)
- HOUSTON METHODIST RESEARCH INSTITUTE (Sugar Land, TX, US)
Inventors
Cpc classification
C12N2710/10343
CHEMISTRY; METALLURGY
A61K2039/57
HUMAN NECESSITIES
C12N15/86
CHEMISTRY; METALLURGY
C12N2710/10043
CHEMISTRY; METALLURGY
International classification
Abstract
The present invention discloses a recombinant adenovirus vector of a replication-defective human adenovirus (HAdv.sup.85C5) or a bovine adenovirus (BAdv.sup.85C5) comprising a recombinant adenovirus vector having a heterologous DNA segment encoding mycobacterial Ag85B-p25 epitope (SEQ ID NO: 1), mycobacterial Ag85B-p25 epitope fusion of autophagy-inducing peptide-C5 (SEQ ID NO: 2), or a substantially homologous functional fragment thereof. The vector, having a heterologous DNA segment of SEQ ID NO: 3, SEQ ID NO: 4, or a substantially homologous functional fragment thereof, is an effective vaccine for therapeutically or prophylactically immunizing a subject for protection of infections by various microorganisms, especially Mycobacterium tuberculosis (Mtb), which causes the widespread tuberculosis. Methods of uses and pharmaceutical composition matters are within the scope of this disclosure.
Claims
1. A recombinant adenovirus vector comprising a heterologous DNA segment encoding mycobacterial Ag85B-p25 epitope (SEQ ID NO: 1), mycobacterial Ag85B-p25 epitope fusion of autophagy-inducing peptide-C5 (SEQ ID NO: 2), or a substantially homologous functional fragment thereof.
2. The recombinant adenovirus vector of claim 1, wherein the heterologous DNA segment encoding mycobacterial Ag85B-p25 epitope has a SEQ ID NO: 3.
3. The recombinant adenovirus vector of claim 1, wherein the vector is a replication defective human adenovirus vector or a bovine adenovirus vector.
4. (canceled)
5. (canceled)
6. (canceled)
7. (canceled)
8. (canceled)
9. (canceled)
10. The recombinant adenovirus vector of claim 1, wherein the heterologous DNA segment is operationally fused in an expression cassette with an autophagy-inducing peptide such as AIP-C5.
11. A method of therapeutically or prophylactically immunizing a subject comprising administering to the subject a vaccine formulation of recombinant adenovirus vector having a heterologous DNA segment encoding mycobacterial Ag85B-p25 epitope (SEQ ID NO: 1), mycobacterial Ag85B-p25 epitope fusion of autophagy-inducing peptide-C5 (SEQ ID NO: 2), or a substantially homologous functional fragment thereof.
12. The method of claim 11, wherein the heterologous DNA segment encoding mycobacterial Ag85B-p25 epitope has a SEQ ID NO: 3.
13. The method of claim 11, wherein the recombinant adenovirus vector is a replication-defective human adenovirus vector or a bovine adenovirus vector.
14. The method of claim 11, wherein the vaccine formulation is useful as an effective vaccine for protection from infections by a microorganism.
15. The method of claim 14, wherein the microorganism is a fungus, a virus, or a bacteria.
16. The method of claim 14, wherein the microorganism is Mycobacterium tuberculosis (Mtb).
17. The method of claim 11, wherein the vaccine formulation is useful as an effective mucosal vaccine.
18. The method of claim 11, wherein the vaccine formulation is useful as an effective vaccine delivered nasally.
19. The method of claim 11, wherein the vaccine formulation is an effective vaccine for tuberculosis.
20. The method of claim 11, wherein the vaccine formulation is useful as an effective vaccine by way of infecting dendritic cells (DCs) and thereby upregulating a transcriptome of genes regulating antigen processing.
21. The method of claim 11, wherein the heterologous DNA segment is operationally fused in an expression cassette with an autophagy-inducing peptide such as AIP-C5.
22. The method according to claim 11, wherein the subject is a human being or an animal.
23. A pharmaceutical composition for therapeutically or prophylactically immunizing a subject comprising a recombinant adenovirus vector having a heterologous DNA segment encoding mycobacterial Ag85B-p25 epitope (SEQ ID NO: 1), mycobacterial Ag85B-p25 epitope fusion of autophagy-inducing peptide-C5 (SEQ ID NO: 2), or a substantially homologous functional fragment thereof, together with one or more pharmaceutically acceptable carriers, diluents, or excipients.
24. The pharmaceutical composition for therapeutically or prophylactically immunizing a subject of claim 23, wherein the heterologous DNA segment encoding mycobacterial Ag85B-p25 epitope having has a SEQ ID NO: 3.
25. The pharmaceutical composition according to claim 23, wherein the recombinant adenovirus vector is a replication-defective human adenovirus vector, a bovine adenovirus vector or any other adenovirus vector.
26. The pharmaceutical composition according to claim 23, wherein the recombinant adenovirus vector is useful as an effective vaccine for protection from infections by a microorganism.
27. The pharmaceutical composition according to claim 26, wherein the microorganism is a fungus, a virus, or a bacteria.
28. The pharmaceutical composition according to claim 26, wherein the microorganism is Mycobacterium tuberculosis (Mtb).
29. The pharmaceutical composition according to claim 23, wherein the recombinant adenovirus vector is useful as an effective mucosal vaccine.
30. The pharmaceutical composition according to claim 23, wherein the recombinant adenovirus vector is useful as an effective vaccine delivered nasally.
31. The pharmaceutical composition according to claim 23, wherein the recombinant adenovirus vector is an effective vaccine for tuberculosis.
32. The pharmaceutical composition according to claim 23, wherein said vector is useful as an effective vaccine by way of infecting dendritic cells (DCs) and thereby upregulating a transcriptome of genes regulating antigen processing.
33. The pharmaceutical composition according to claim 23, wherein the heterologous DNA segment is operationally fused in an expression cassette with an autophagy-inducing peptide such as AIP-C5.
34. The pharmaceutical composition according to claim 23, wherein the subject is a human being or an animal.
35. The recombinant adenovirus vector of claim 1, wherein the heterologous DNA segment encoding mycobacterial Ag85B-p25 epitope fusion of autophagy-inducing peptide-C5 has a SEQ ID NO: 4.
36. The method of claim 11, wherein the heterologous DNA segment encoding mycobacterial Ag85B-p25 epitope fusion of autophagy-inducing peptide-C5 has a SEQ ID NO: 4.
37. The method of claim 20, wherein the transcriptome of genes comprises CTSA, CTSB, CTSK, CTSL, CTSS, CTSZ, Gabarap, Lgals-3, Lgals-8, LAMP1, Rab7, and SQSTM1.
38. The method of claim 20, wherein the transcriptome of genes comprises B2M, CD53, CD63, CD68, Clec4e, H2D1, Hsp9a, LILRB4, and LAMP2.
39. The pharmaceutical composition for therapeutically or prophylactically immunizing a subject of claim 23, wherein the heterologous DNA segment encoding mycobacterial Ag85B-p25 epitope fusion of autophagy-inducing peptide-C5 has a SEQ ID NO: 4.
40. The method of claim 32, wherein the transcriptome of genes comprises CTSA, CTSB, CTSK, CTSL, CTSS, CTSZ, Gabarap, Lgals-3, Lgals-8, LNAM1, Rab7, and SQSMTM1.
41. The method of claim 32, wherein the transcriptome of genes comprises B2M, CD53, CD63, CD68, zvlrv4e, H2D1, Hsp9a, LILRB4, and LAMP2.
Description
BRIEF DESCRIPTION OF DRAWINGS
[0009]
[0010]
[0011]
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
BRIEF DESCRIPTION OF SEQUENCE LISTINGS
[0019] Protein/Peptide sequence 85B: (Met+AG85B CD4 EPITOPE+GSG linker+P2A (self-cleavage peptide):
TABLE-US-00001 (SEQIDNO:1) MFQDAYNAAGGHNAVFGSGATNFSLLKQAGDVEENPG.
[0020] Protein/Peptide 85B-C5: (Met+AG85B CD4 EPITOPE+GSG linker+P2A (self-cleavage peptide)+AIP-C5 peptide):
TABLE-US-00002 (SEQIDNO:2) MFQDAYNAAGGHNAVFGSGATNFSLLKQAGDVEENPGPAAQAAVVRFQE AANKQKQELD.
[0021] DNA sequences of the CMV promoter, 85B epitope, peptide 2A, and BGH polyadenylation signal. This gene cassette was used for generating HAdv.sup.85 or BAdv.sup.85:
TABLE-US-00003 (SEQIDNO:3) GACATTGATTATTGACTAGTTATTAATAGTAATCAATTACGGGGTCATT AGTTCATAGCCCATATATGGAGTTCCGCGTTACATAACTTACGGTAAAT GGCCCGCCTGGCTGACCGCCCAACGACCCCCGCCCATTGACGTCAATAA TGACGTATGTTCCCATAGTAACGCCAATAGGGACTTTCCATTGACGTCA ATGGGTGGACTATTTACGGTAAACTGCCCACTTGGCAGTACATCAAGTG TATCATATGCCAAGTACGCCCCCTATTGACGTCAATGACGGTAAATGGC CCGCCTGGCATTATGCCCAGTACATGACCTTATGGGACTTTCCTACTTG GCAGTACATCTACGTATTAGTCATCGCTATTACCATGGTGATGCGGTTT TGGCAGTACATCAATGGGCGTGGATAGCGGTTTGACTCACGGGGATTTC CAAGTCTCCACCCCATTGACGTCAATGGGAGTTTGTTTTGGCACCAAAA TCAACGGGACTTTCCAAAATGTCGTAACAACTCCGCCCCATTGACGCAA ATGGGCGGTAGGCGTGTACGGTGGGAGGTCTATATAAGCAGAGCTCTCT GGCTAACTAGAGAACCCACTGCTTACTGGCTTATCGAAATTAATACGAC TCACTATAGGGAGACCCAAGCTTGGTACCGAGCTCGGATCCGCCACCAT GTTCCAGGACGCCTACAACGCTGCTGGAGGACACAACGCCGTGTTCGGC AGCGGAGCTACCAACTTTTCCCTGCTGAAGCAGGCTGGCGATGTGGAGG AGAACCCCGGATAAGCGGCCGCTCGAGCATGCATCTAGAGGGCCCTATT CTATAGTGTCACCTAAATGCTAGAGCTCGCTGATCAGCCTCGACTGTGC CTTCTAGTTGCCAGCCATCTGTTGTTTGCCCCTCCCCCGTGCCTTCCTT GACCCTGGAAGGTGCCACTCCCACTGTCCTTTCCTAATAAAATGAGGAA ATTGCATCGCATTGTCTGAGTAGGTGTCATTCTATTCTGGGGGGTGGGG TGGGGCAGGACAGCAAGGGGGAGGATTGGGAAGACAATAGCAGGCATGC TGGGGATGCGGTGGGCTCTATGG
[0022] DNA sequences of the CMV promoter, 85B epitope, peptide 2A, AIP-C5 peptide, and BGH polyadenylation signal. This gene cassette was used for generating HAdv.sup.85C5 or BAdv.sup.85C5:
TABLE-US-00004 (SEQIDNO:4) GACATTGATTATTGACTAGTTATTAATAGTAATCAATTACGGGGTCATT AGTTCATAGCCCATATATGGAGTTCCGCGTTACATAACTTACGGTAAAT GGCCCGCCTGGCTGACCGCCCAACGACCCCCGCCCATTGACGTCAATAA TGACGTATGTTCCCATAGTAACGCCAATAGGGACTTTCCATTGACGTCA ATGGGTGGACTATTTACGGTAAACTGCCCACTTGGCAGTACATCAAGTG TATCATATGCCAAGTACGCCCCCTATTGACGTCAATGACGGTAAATGGC CCGCCTGGCATTATGCCCAGTACATGACCTTATGGGACTTTCCTACTTG GCAGTACATCTACGTATTAGTCATCGCTATTACCATGGTGATGCGGTTT TGGCAGTACATCAATGGGCGTGGATAGCGGTTTGACTCACGGGGATTTC CAAGTCTCCACCCCATTGACGTCAATGGGAGTTTGTTTTGGCACCAAAA TCAACGGGACTTTCCAAAATGTCGTAACAACTCCGCCCCATTGACGCAA ATGGGCGGTAGGCGTGTACGGTGGGAGGTCTATATAAGCAGAGCTCTCT GGCTAACTAGAGAACCCACTGCTTACTGGCTTATCGAAATTAATACGAC TCACTATAGGGAGACCCAAGCTTGGTACCGAGCTCGATATCGGATCCGC CACCATGTTCCAGGACGCCTACAACGCTGCTGGAGGACACAACGCCGTG TTCGGCAGCGGAGCTACCAACTTTTCCCTGCTGAAGCAGGCTGGCGATG TGGAGGAGAACCCAGGACCTGCTGCTCAGGCTGCTGTGGTGAGGTTTCA GGAGGCCGCTAACAAGCAGAAGCAGGAGCTGGACTAAGCGGCCGCGATA TCTCGAGCATGCATCTAGAGGGCCCTATTCTATAGTGTCACCTAAATGC TAGAGCTCGCTGATCAGCCTCGACTGTGCCTTCTAGTTGCCAGCCATCT GTTGTTTGCCCCTCCCCCGTGCCTTCCTTGACCCTGGAAGGTGCCACTC CCACTGTCCTTTCCTAATAAAATGAGGAAATTGCATCGCATTGTCTGAG TAGGTGTCATTCTATTCTGGGGGGTGGGGTGGGGCAGGACAGCAAGGGG GAGGATTGGGAAGACAATAGCAGGCATGCTGGGGATGCGGTGGGCTCTA TGG
DETAILED DESCRIPTION
[0023] For the purposes of promoting an understanding of the principles of the present disclosure, reference will now be made to the embodiments illustrated in the drawings, and specific language will be used to describe the same. It will nevertheless be understood that no limitation of the scope of this disclosure is thereby intended.
[0024] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood to one of ordinary skill in the art. As defined herein, the following terms and phrases shall have the meanings set forth below.
[0025] In the present disclosure the term about can allow for a degree of variability in a value or range, for example, within 10%, within 5%, or within 1% of a stated value or of a stated limit of a range. In the present disclosure the term substantially can allow for a degree of variability in a value or range, for example, within 90%, within 95%, 99%, 99.5%, 99.9%, 99.99%, or at least about 99.999% or more of a stated value or of a stated limit of a range.
[0026] In this document, the terms a, an, or the are used to include one or more than one unless the context clearly dictates otherwise. The term or is used to refer to a nonexclusive or unless otherwise indicated. In addition, it is to be understood that the phraseology or terminology employed herein, and not otherwise defined, is for the purpose of description only and not of limitation. Any use of section headings is intended to aid reading of the document and is not to be interpreted as limiting. Further, information that is relevant to a section heading may occur within or outside of that particular section. Furthermore, all publications, patents, and patent documents referred to in this document are incorporated by reference herein in their entirety, as though individually incorporated by reference. In the event of inconsistent usages between this document and those documents so incorporated by reference, the usage in the incorporated references should be considered supplementary to that of this document; for irreconcilable inconsistencies, the usage in this document controls.
[0027] The term pharmaceutically acceptable carrier is art-recognized and refers to a pharmaceutically-acceptable material, composition or vehicle, such as a liquid or solid filler, diluent, excipient, solvent or encapsulating material, involved in carrying or transporting any subject composition or component thereof. Each carrier must be acceptable in the sense of being compatible with the subject composition and its components and not injurious to the patient. Some examples of materials which may serve as pharmaceutically acceptable carriers include: (1) sugars, such as lactose, glucose and sucrose; (2) starches, such as corn starch and potato starch; (3) cellulose, and its derivatives, such as sodium carboxymethyl cellulose, ethyl cellulose and cellulose acetate; (4) powdered tragacanth; (5) malt; (6) gelatin; (7) talc; (8) excipients, such as cocoa butter and suppository waxes; (9) oils, such as peanut oil, cottonseed oil, safflower oil, sesame oil, olive oil, corn oil and soybean oil; (10) glycols, such as propylene glycol; (11) polyols, such as glycerin, sorbitol, mannitol and polyethylene glycol; (12) esters, such as ethyl oleate and ethyl laurate; (13) agar; (14) buffering agents, such as magnesium hydroxide and aluminum hydroxide; (15) alginic acid; (16) pyrogen-free water; (17) isotonic saline; (18) Ringer's solution; (19) ethyl alcohol; (20) phosphate buffer solutions; and (21) other non-toxic compatible substances employed in pharmaceutical formulations.
[0028] As used herein, the term administering includes all means of introducing the compounds and compositions described herein to the patient, including, but are not limited to, oral (po), intravenous (iv), intramuscular (im), intranasal (in), subcutaneous (sc), transdermal, inhalation, buccal, ocular, sublingual, vaginal, rectal, and the like. The compounds and compositions described herein may be administered in unit dosage forms and/or formulations containing conventional nontoxic pharmaceutically acceptable carriers, adjuvants, and vehicles.
[0029] Illustrative formats for oral administration include tablets, capsules, elixirs, syrups, and the like. Illustrative routes for parenteral administration include intravenous, intraarterial, intraperitoneal, epidural, intraurethral, intrasternal, intramuscular, intranasal and subcutaneous, as well as any other art recognized route of parenteral administration.
[0030] Illustrative means of parenteral administration include needle (including microneedle) injectors, needle-free injectors and infusion techniques, as well as any other means of parenteral administration recognized in the art. Parenteral formulations are typically aqueous solutions which may contain excipients such as salts, carbohydrates and buffering agents (preferably at a pH in the range from about 3 to about 9), but, for some applications, they may be more suitably formulated as a sterile non-aqueous solution or as a dried form to be used in conjunction with a suitable vehicle such as sterile, pyrogen-free water. The preparation of parenteral formulations under sterile conditions, for example, by lyophilization, may readily be accomplished using standard pharmaceutical techniques well known to those skilled in the art. Parenteral administration of a compound is illustratively performed in the form of saline solutions or with the compound incorporated into liposomes. In cases where the compound in itself is not sufficiently soluble to be dissolved, a solubilizer such as ethanol can be applied.
[0031] The dosage of each compound of the claimed combinations depends on several factors, including: the administration method, the condition to be treated, the severity of the condition, whether the condition is to be treated or prevented, and the age, weight, and health of the person to be treated. Additionally, pharmacogenomic (the effect of genotype on the pharmacokinetic, pharmacodynamic or efficacy profile of a therapeutic) information about a particular patient may affect the dosage used.
[0032] It is to be understood that in the methods described herein, the individual components of a co-administration, or combination can be administered by any suitable means, contemporaneously, simultaneously, sequentially, separately or in a single pharmaceutical formulation. Where the co-administered compounds or compositions are administered in separate dosage forms, the number of dosages administered per day for each compound may be the same or different. The compounds or compositions may be administered via the same or different routes of administration. The compounds or compositions may be administered according to simultaneous or alternating regimens, at the same or different times during the course of the therapy, concurrently in divided or single forms.
[0033] The term therapeutically effective amount as used herein, refers to that amount of active compound or pharmaceutical agent that elicits the biological or medicinal response in a tissue system, animal or human that is being sought by a researcher, veterinarian, medical doctor or other clinician, which includes alleviation of the symptoms of the disease or disorder being treated. In one aspect, the therapeutically effective amount is that which may treat or alleviate the disease or symptoms of the disease at a reasonable benefit/risk ratio applicable to any medical treatment. However, it is to be understood that the total daily usage of the compounds and compositions described herein may be decided by the attending physician within the scope of sound medical judgment. The specific therapeutically-effective dose level for any particular patient will depend upon a variety of factors, including the disorder being treated and the severity of the disorder; activity of the specific compound employed; the specific composition employed; the age, body weight, general health, gender and diet of the patient: the time of administration, route of administration, and rate of excretion of the specific compound employed; the duration of the treatment; drugs used in combination or coincidentally with the specific compound employed; and like factors well known to the researcher, veterinarian, medical doctor or other clinician of ordinary skill.
[0034] Depending upon the route of administration, a wide range of permissible dosages are contemplated herein, including doses falling in the range from about 1 g/kg to about 1 g/kg. The dosages may be single or divided, and may administered according to a wide variety of protocols, including q.d. (once a day), b.i.d. (twice a day), t.i.d. (three times a day), or even every other day, once a week, once a month, once a quarter, and the like. In each of these cases it is understood that the therapeutically effective amounts described herein correspond to the instance of administration, or alternatively to the total daily, weekly, month, or quarterly dose, as determined by the dosing protocol.
[0035] In addition to the illustrative dosages and dosing protocols described herein, it is to be understood that an effective amount of any one or a mixture of the compounds described herein can be determined by the attending diagnostician or physician by the use of known techniques and/or by observing results obtained under analogous circumstances. In determining the effective amount or dose, a number of factors are considered by the attending diagnostician or physician, including, but not limited to the species of mammal, including human, its size, age, and general health, the specific disease or disorder involved. the degree of or involvement or the severity of the disease or disorder, the response of the individual patient, the particular compound administered, the mode of administration, the bioavailability characteristics of the preparation administered, the dose regimen selected, the use of concomitant medication, and other relevant circumstances.
[0036] The term patient includes human and non-human animals such as companion animals (dogs and cats and the like) and livestock animals. Livestock animals are animals raised for food production. The patient to be treated is preferably a mammal, in particular a human being.
[0037] In some illustrative embodiments, this disclosure relates to a recombinant adenovirus vector comprising a heterologous DNA segment encoding mycobacterial Ag85B-p25 epitope (SEQ ID NO: 1), mycobacterial Ag85B-p25 epitope fusion of autophagy-inducing peptide-C5 (SEQ ID NO: 2), or a substantially homologous functional fragment thereof.
[0038] In some illustrative embodiments, this disclosure relates to a recombinant adenovirus vector as disclosed herein. wherein said vector comprises a heterologous DNA segment having a SEQ ID NO: 3, SEQ ID NO: 4, or a substantially homologous functional fragment thereof.
[0039] In some illustrative embodiments, this disclosure relates to a recombinant adenovirus vector as disclosed herein, wherein said vector is a replication-defective human adenovirus vector, a bovine adenovirus vector or any other adenovirus vector.
[0040] In some illustrative embodiments, this disclosure relates to a recombinant adenovirus vector as disclosed herein, wherein said vector is useful as an effective vaccine for protection from infections by a microorganism.
[0041] In some illustrative embodiments, this disclosure relates to a recombinant adenovirus vector as disclosed herein, wherein the microorganism is a fungus, a virus, or a bacteria.
[0042] In some illustrative embodiments, this disclosure relates to a recombinant adenovirus vector as disclosed herein, wherein the microorganism is Mycobacterium tuberculosis (Mtb).
[0043] In some illustrative embodiments, this disclosure relates to a recombinant adenovirus vector as disclosed herein, wherein said vector is useful as an effective vaccine delivered nasally.
[0044] In some illustrative embodiments, this disclosure relates to a recombinant adenovirus vector as disclosed herein, wherein said vector is an effective vaccine for tuberculosis.
[0045] In some illustrative embodiments, this disclosure relates to a recombinant adenovirus vector as disclosed herein, wherein said vector is useful as an effective vaccine by way of infecting dendritic cells (DCs) that expressed a unique transcriptome of genes regulating antigen processing.
[0046] In some illustrative embodiments, this disclosure relates to a recombinant adenovirus vector as disclosed herein, wherein the heterologous DNA segment is operationally fused in an expression cassette with an autophagy-inducing peptide such as AIP-C5.
[0047] In some illustrative embodiments, this disclosure relates to a method of therapeutically or prophylactically immunizing a subject comprising administering to the subject a recombinant adenovirus vector having a heterologous DNA segment encoding mycobacterial Ag85B-p25 epitope (SEQ ID NO: 1), mycobacterial Ag85B-p25 epitope fusion of autophagy-inducing peptide-C5 (SEQ ID NO: 2), or a substantially homologous functional fragment thereof.
[0048] In some illustrative embodiments, this disclosure relates to a method of therapeutically or prophylactically immunizing a subject as disclosed herein, wherein said vector comprises a heterologous DNA segment having a SEQ ID NO: 3, SEQ ID NO: 4, or a substantially homologous functional fragment thereof.
[0049] In some illustrative embodiments, this disclosure relates to a method of therapeutically or prophylactically immunizing a subject, wherein said vector is a replication defective human adenovirus vector, a bovine adenovirus vector or any other adenovirus vector.
[0050] In some illustrative embodiments, this disclosure relates to a method of therapeutically or prophylactically immunizing a subject, wherein said vector is useful as an effective vaccine for protection from infections by a microorganism.
[0051] In some illustrative embodiments, this disclosure relates to a method of therapeutically or prophylactically immunizing a subject, wherein the microorganism is a fungus, a virus, or a bacteria.
[0052] In some illustrative embodiments, this disclosure relates to a method of therapeutically or prophylactically immunizing a subject, wherein the microorganism is Mycobacterium tuberculosis (Mtb).
[0053] In some illustrative embodiments, this disclosure relates to a method of therapeutically or prophylactically immunizing a subject, wherein said vector is useful as an effective mucosal vaccine.
[0054] In some illustrative embodiments, this disclosure relates to a method of therapeutically or prophylactically immunizing a subject, wherein said vector is useful as an effective vaccine delivered nasally.
[0055] In some illustrative embodiments, this disclosure relates to a method of therapeutically or prophylactically immunizing a subject, wherein said vector is an effective vaccine for tuberculosis.
[0056] In some illustrative embodiments, this disclosure relates to a method of therapeutically or prophylactically immunizing a subject, wherein said vector is useful as an effective vaccine by way of infecting dendritic cells (DCs) that expressed a unique transcriptome of genes regulating antigen processing.
[0057] In some illustrative embodiments, this disclosure relates to a method of therapeutically or prophylactically immunizing a subject, wherein the heterologous DNA segment is operationally fused in an expression cassette with an autophagy-inducing peptide such as AIP-C5.
[0058] In some illustrative embodiments, this disclosure relates to a method of therapeutically or prophylactically immunizing a subject, wherein the subject is a human being or an animal.
[0059] Yet in some illustrative embodiments, this disclosure relates to a pharmaceutical composition for therapeutically or prophylactically immunizing a subject comprising a recombinant adenovirus vector having a heterologous DNA segment encoding mycobacterial Ag85B-p25 epitope (SEQ ID NO: 1), mycobacterial Ag85B-p25 epitope fusion of autophagy-inducing peptide-C5 (SEQ ID NO: 2), or a substantially homologous functional fragment thereof, together with one or more pharmaceutically acceptable carriers, diluents, or excipients.
[0060] In some illustrative embodiments, this disclosure relates to a pharmaceutical composition for therapeutically or prophylactically immunizing a subject as disclosed herein, wherein said vector comprises a heterologous DNA segment having a SEQ ID NO: 3, SEQ ID NO: 4, or a substantially homologous functional fragment thereof.
[0061] In some illustrative embodiments, this disclosure relates to a pharmaceutical composition for therapeutically or prophylactically immunizing a subject as disclosed herein, wherein said vector is a replication-defective human adenovirus vector, a bovine adenovirus vector or any other adenovirus vector.
[0062] In some illustrative embodiments, this disclosure relates to a pharmaceutical composition for therapeutically or prophylactically immunizing a subject as disclosed herein, wherein said vector is useful as an effective vaccine for protection from infections by a microorganism.
[0063] In some illustrative embodiments, this disclosure relates to a pharmaceutical composition for therapeutically or prophylactically immunizing a subject as disclosed herein, wherein the microorganism is a fungus, a virus, or a bacteria.
[0064] In some illustrative embodiments, this disclosure relates to a pharmaceutical composition for therapeutically or prophylactically immunizing a subject as disclosed herein, wherein the microorganism is Mycobacterium tuberculosis (Mtb).
[0065] In some illustrative embodiments, this disclosure relates to a pharmaceutical composition for therapeutically or prophylactically immunizing a subject as disclosed herein, wherein said vector is useful as an effective mucosal vaccine.
[0066] In some illustrative embodiments, this disclosure relates to a pharmaceutical composition for therapeutically or prophylactically immunizing a subject as disclosed herein, wherein said vector is useful as an effective vaccine delivered nasally.
[0067] In some illustrative embodiments, this disclosure relates to a pharmaceutical composition for therapeutically or prophylactically immunizing a subject as disclosed herein, wherein said vector is an effective vaccine for tuberculosis.
[0068] In some illustrative embodiments, this disclosure relates to a pharmaceutical composition for therapeutically or prophylactically immunizing a subject as disclosed herein, wherein said vector is useful as an effective vaccine by way of infecting dendritic cells (DCs) that expressed a unique transcriptome of genes regulating antigen processing.
[0069] In some illustrative embodiments, this disclosure relates to a pharmaceutical composition for therapeutically or prophylactically immunizing a subject as disclosed herein, wherein the heterologous DNA segment is operationally fused in an expression cassette with an autophagy-inducing peptide such as AIP-C5.
[0070] In some illustrative embodiments, this disclosure relates to a pharmaceutical composition for therapeutically or prophylactically immunizing a subject as disclosed herein, wherein the subject is a human being or an animal.
[0071] The following non-limiting exemplary embodiments are included herein to further illustrate the invention. These exemplary embodiments are not intended and should not be interpreted to limit the scope of the invention in any way. It is also to be understood that numerous variations of these exemplary embodiments are contemplated herein.
[0072] Tuberculosis kills 1.5 million people including children each year and the BCG vaccine offers partial protection from lung disease. We developed mucosal vaccines expressing the autophagy-inducing peptide-C5 (AIP-C5) and mycobacterial Ag85B-p25 epitope using replication-defective human adenovirus (HAdv.sup.85C5) and bovine adenovirus (BAdv.sup.85C5) vectors. BAdv.sup.85C5-infected dendritic cells (DCs) expressed a unique transcriptome of genes regulating antigen processing compared to HAdv.sup.85C5-infected DCs. BAdv.sup.85C5-infected DCs showed an enhanced Galectin-3/8 and autophagy-dependent in vitro Ag85B-p25 epitope presentation to CD4 T cells. Nave or BCG-vaccinated mice were intranasally vaccinated using HAdv.sup.85C5 or BAdv.sup.85C5 followed by aerosolized Mycobacterium tuberculosis (Mtb). BAdv.sup.85C5 protected mice against tuberculosis both as a booster after BCG vaccine (>1.4-log 10 reduction in Mtb lung burden) and as a single intranasal dose (>0.5-log 10 reduction). Protection was associated with a robust expansion of CD4 and CD8 effector (T.sub.EM), central memory (T.sub.CM), and CD103.sup.+/CD69.sup.+ lung resident memory (T.sub.RM) T cells. Thus, BAdv.sup.85C5 is a novel mucosal vaccine for tuberculosis.
[0073] The viral vector-based vaccine platforms for Mtb are excellent in inducing both systemic and mucosal immunity in mice. However, respiratory mucosal booster vaccines following BCG immunization may still fall short from protecting neonates from tuberculosis. This is likely due to a defective expansion of T.sub.RM during influenza infection in neonatal mice and human neonates (Zens et al., 2017). Related studies show that the neonatal immune system is functional but physiologically immature, requiring vaccine adjuvants to elicit a robust T-helper immunity regulating cytokines like IL-12, TNF- and IL1- in APCs (Saso and Kampmann, 2017; Yu et al., 2018). The relevance of an immature neonatal immune system is also underscored by the requirement of boosters for childhood vaccines like DPT and MMR. Therefore, the intrinsic defects of BCG vaccine in APCs combined with an immature neonatal immune system may explain the high prevalence of lung tuberculosis and dissemination of Mtb into the brain in neonates despite BCG vaccination.
[0074] To design a novel vaccine platform capable of antigen presentation through autophagy, we developed a bovine adenovirus (BAdv)-based tuberculosis vaccine expressing the immunodominant mycobacterial Ag85B-p25 epitope along with AIP-C5. Immunogenicity of BAdv vector-based vaccines do not interfere with the pre-existing adenovirus antibodies (Singh et al., 2008; Bangari and Mittal, 2006; Sharma et al., 2010a). We demonstrate herein that our engineered mucosal vaccine augments the ability of APCs to process and present the Ag85B-p25 epitope to CD4 T cells. Our novel nasal vaccine protected mice following aerosolized challenge with Mtb, both as a booster after the BCG vaccine or on its own. There was a robust expansion of CD4 and CD8 effector (T.sub.EM), central memory (T.sub.CM), and CD103.sup.+/CD69.sup.+ resident memory (T.sub.RM) T cells in the lungs of vaccinated mice.
Results
Generation of BAdv- or HAdv-Based Vectors Expressing the Mtb Ag85B-p25 Epitope With or Without AIP-C5
[0075] Adenovirus (Adv) vector-based vaccines elicit both humoral and cell-mediated immune (CMI) responses (Bangari and Mittal, 2006; Vemula and Mittal, 2010) due to the adjuvant- like effect of Adv vectors by activating the innate immune system through both Toll-like Receptor (TLR)-dependent and TLR-independent pathways (Sharma et al., 2010a; Zhu et al., 2007). Influenza is one of the significant respiratory diseases in humans, animals, and birds. Adv vector-based influenza vaccines have conferred protective efficacy in both animal models (Cao et al., 2016; Hoelscher et al., 2006; Hoelscher et al., 2007) and clinical trials in humans (Barouch et al., 2018; Ledgerwood et al., 2017; Smaill et al., 2013; Van Kampen et al., 2005; van Zyl-Smit et al., 2017).
[0076] We expressed the Mtb Ag85B-p25 epitope with or without AIP-C5 in the replication-defective BAdv or HAdv vector system. The Mtb Ag85B-p25 epitope (85) or 85+AIP-C5 (85C5) gene cassette was under the control of the immediate early cytomegalovirus (CMV) promoter and bovine growth hormone (BGH) polyadenylation signal. The generated vectors BAdv.sup.85 (expressing 85), BAdv.sup.85C5 (expressing 85C5), HAdv.sup.85 (expressing 85), or HAdv.sup.85C5 (expressing 85C5) (
Replication-Defective BAdv.SUP.85C5 .Vaccine Efficiently Infects Immature Mouse DCs and Induces a Unique Transcriptome
[0077] To characterize the virus induced transcriptome, bone marrow-derived CD11c.sup.+ immature DCs from wt-C57BL/6 mice and autophagy-deficient ATG7KO-DC mice (Chen et al., 2014) were infected with BAdv.sup.85C5, BAdv vector, HAdv.sup.85C5, or HAdv vector followed by RNAseq analysis (Novogene USA).
Replication-Defective BAdv.SUP.85C5 .Vaccine is Rapidly Internalized by DCs and Localizes to Autophagolysosomal Compartments
[0078] DCs are essential for vaccine-induced immune responses in both mice and humans (Segura and Amigorena, 2015). Earlier studies indicated that Cy3-fluorescent-labeled Adv retain >98% infectivity (Leopold et al., 1998); therefore, Cy3-labeled BAdv.sup.85C5 or BAdv vector was used for infection of mouse CD11c.sup.+ immature DCs followed by confocal microscopy. Since Adv can interact with the autophagy pathway and microtubule-associated light chain-3 (LC3) is a known marker of autophagosomes, LC3 was used as a marker for the virus containing endosomes (Hendrickx et al., 2014). Cy3-BAdv.sup.85C5 and Cy3-BAdv vector were rapidly internalized and
Replication-Defective BAdv.SUP.85C5 .Vaccine Enhances Autophagy-Dependent and -Independent Antigen Presentation in Both Mouse DCs and Human Ms
[0079] Previous studies show that HAdv vectors expressing mycobacterial antigens protect mice and macaques against TB variably; although, human studies have not been encouraging (Hoft et al., 2012; Rodo et al., 2019; Darrah et al., 2019). Because BAdv.sup.85C5 induced robust gene expression in DCs, we sought to further define whether it increases the immunogenicity of DCs in comparison with HAdv.sup.85C5.
[0080] A major function of vaccine ingested DCs is an efficient antigen processing and activation of CD4 and CD8 T cells through MHC-II and MHC-I pathway, respectively. Whereas, vaccines degraded in lysosomes are routed to MHC-II pathway, proteasome digested peptides of vaccines are routed through MHC-I. We demonstrated earlier that autophagy can increase MHC-II-dependent presentation of mycobacterial Ag85B (Jagannath et al., 2009), whereas, autophagy was also found to increase MHC-I-dependent presentation of antigens in APCs (Lee et al., 2010). To decipher the antigen processing mechanisms of DCs, we developed an ex vivo assay initially developed Cliff Harding's group, where, BCG- or Mtb-infected APCs rapidly present an Ag85B-derived p25 epitope to BB7 CD4 T cells in vitro (Ramachandra et al., 1999, 2001) This assay has been extensively used to measure the immunogenicity of BCG and Mtb mutants by us and others (Singh et al., 2006; Soualhine et al., 2007; Saini et al., 2016). We reported earlier that BCG85B (BCG overexpressing full-length Ag85B) or BCG85BC5 (BCG overexpressing full-length Ag85B and AIP-C5) induce robust autophagy, increasing p25 presentation and elicit IL-2 from BB7 CD4 T cells (Jagannath et al., 2009; Khan et al., 2019). Importantly, in vitro antigen presentation responses correlated directly with their efficacy against tuberculosis in mice (Jagannath et al., 2009; Khan et al., 2019). Since the BAdv.sup.85C5 vaccine expressed Ag85Bd-p25 epitope and AIP-C5, we first sought to determine the antigen processing mechanisms in the presence or absence of autophagy.
[0081] Autophagy begins with an intracellular membrane vesicle nucleation, vesicle elongation and autophagophore formation, which encloses pathogens into an autophagosome. The latter fuse with the lysosomes which in turn, degrades pathogens for the production of antigenic peptides through Cathepsin proteases. This process, also known as macroautophagy, involves several autophagy-regulating genes (ATGs) of which, ATG7 and ATG5 are key genes, although alternative pathways exist (Nishida et al., 2009). To determine that autophagy plays a role during a virus vector-based vaccine-induced antigen presentation, wt-DCs and ATG7KO-DCs were infected with BAdv.sup.85C5 or HAdv.sup.85C5 followed by antigen presentation. ATG7 deficiency in DCs led to a significant reduction of antigen presentation after infection with either BAdv.sup.85C5 or HAdv.sup.85C5 (
[0082] Since the BAdv.sup.85C5 vaccine platform is being developed for human neonates following BCG vaccination, human CD14.sup.+ Ms were untreated or treated with 3-methyladenine (50 M) to inhibit autophagy followed by infections with BAdv.sup.85C5 or HAdv.sup.85C5. Even in human Ms, the blockade of autophagy reduced the antigen presentation by BAdv.sup.85C5 or HAdv.sup.85C5 (
Replication-Defective BAdv.SUP.85C5 .Vaccine Enhances Antigen Presentation Through Galectins and Cathepsin Expression in DCs
[0083] Many studies indicate that autophagy plays a role during the translocation of Adv capsids from the endosome to the nuclear pore complex (Hendrickx et al., 2014). During this process, lectin-like intracellular receptors like Galectins, specifically, Lgals-/(Gal3) and Lgals-3 (Gal8) are associated with the vesicular transport of Adv (Hendrickx et al., 2014); although, HAdv5 infection of A549 epithelial cells strongly down-regulated Gal1 and Gal3 expression (Trinh et al., 2013). Transcriptomic studies show that Lgals-3 (
[0084] qPCR and western blot analysis of BAdv.sup.85C5 and HAdv.sup.85C5 infected DCs also showed an enrichment of Gabarap (LC3 family), SQSTM1 a known substrate of autophagy and Rab7, a small GTPase essential for the fusion of autophagosomes to lysosomes (Baba et al., 2019). Galectins including Lgals-3 and Lgals-8 are strongly associated with autophagy; specifically, Lgals-3 binds the Tripartite containing motif protein-16 (TRIM16) to activate autophagy through ATG1/ulk1, we hypothesized that BAdv.sup.85C5 may induce autophagy through a Lgals-3 and/or Lgals-8 dependent mechanism. Because induction of autophagy enhances the ability of APCs (Ms; and DCs) to process and present mycobacterial antigen to CD4 T cells (Jagannath et al., 2009), DCs were subjected to siRNA knockdown of Galectins to determine downstream effects. BAdv.sup.85C5 infected DCs and Ms were subjected to siRNA vs. Lgal-3 and Lgals-8 and siRNA vs. Lgals-3 for HAdv.sup.85C5 infected DCs since the later did not express Lgals-8 (
[0085] Autophagy-mediated delivery of mycobacteria to lysosomes results in their degradation by lysosomal proteases like cathepsins, lipases, and glycosidases. Indeed, we demonstrated earlier that CTSD cleaves Ag85B in mouse Ms to generate the p25 epitope, which is then rapidly presented to CD4 T cells in vitro (Singh et al., 2006). Cathepsins not only digest proteins but also help to load peptides into the groove of MHC-II and CTSS and CTSL play a pivotal role (Katunuma et al., 2003; Lee et al., 2006). DC transcriptome studies indicated that BAdv.sup.85C5 enhanced the expression of multiple cathepsins (
BAdv.SUP.85C5 .Mucosal Vaccine Protects Mice Against Aerosolized Mtb Either on Its Own or as a Booster Following BCG Vaccine
[0086] Ex vivo studies indicated that BAdv.sup.85C5 significantly enhanced the immunogenicity of the DCs in comparison with HAdv.sup.85C5 vaccine (
[0087] Inbred C57BL/6 show a developing immune system akin to the neonatal immune system (Huggins et al., 2019). Thus, C57BL/6 mice are a frequently used model to evaluate the efficacy of BCG and related vaccines. Mice (male and female; 4-6-week-old) were mock-inoculated or vaccinated subcutaneously with BCG, and at 7 days post-immunization, animals received a single intranasal booster vaccination with BAdv.sup.85, BAdv.sup.85C5 or BAdv vector control (
BAdv.SUP.85C5 .Booster Induces Stronger Cytokine Positive T Cells and Effector and Memory T Cells in BCG Vaccinated Mice
[0088] T.sub.H1 immunity mediating cytokines like IFN- and IL-2 play a major defensive role against tuberculosis in mice and humans (Kaveh et al., 2011).
[0089] It is known that respiratory infections induce an effector T cell response (T.sub.EM), which enables an immediate containment of infection, followed by their transition into a long-lasting central memory T cell response (T.sub.CM). In many viral infection models and LCMV (lymphocytic choriomeningitis virus) infection of mice, T.sub.CM cells mediate long-term immunity (Wherry et al., 2003; Jabbari and Harty, 2006; Gray et al., 2018). Since the lungs are not lymphoid organs, T.sub.EM and Tem are thought to arise in the lymph nodes and home back to the lungs for containment of infection recruited by the chemokines secreted from the Mtb-infected Ms. For example, chemokine receptors CCR2, CXCR5, CCR5 and CXCR6 enhance lung infiltration with TH1 type immune cells, and CCR2-deficient mice are highly susceptible to tuberculosis (Hoft et al., 2019; Peters et al., 2001).
BAdv.sup.85C5 Booster Induces a Better Expansion of Lung Resident Memory T (T.sub.RM) Cells in BCG-Vaccinated Mice After Mtb Challenge
[0090] The T.sub.RM cells are thought to play a major role in defense against airborne infections (Kumar et al., 2017; Ogongo et al., 2019). The special phenotype of CD4 and CD8 T.sub.RM cells are present in the lungs, and recent studies indicate that both human infants and neonatal mice show a physiologically reduced expansion of T.sub.RM cells after influenza infection (Zens et al., 2017). Use of an adjuvant with a peptide vaccine augmented lung T.sub.RM responses (Thompson et al., 2019). BAdv.sup.85C5 induced a better T.sub.RM response in the lungs of BCG-vaccinated and boosted mice compared to the BCG alone group before and after challenge with Mtb (
[0091] HAdv-based tuberculosis vaccines have been evaluated in mice (Hoft et al., 2012). In spite of supporting data from the mouse and macaque models, human studies have not been encouraging (Rodo et al., 2019; Darrah et al., 2019). We, therefore, sought to develop an alternative approach using the novel BAdv vaccine platform.
[0092] To address pre-existing HAdv vector immunity which could affect vaccine efficacy in humans, we have demonstrated that BAdv vector-based vaccines are equally effective even in the presence of exceptionally high levels of pre-existing HAdv vector immunity (Singh et al., 2008). Besides, BAdv3 internalization is independent of the HAdv5 receptors [Coxackievirus-Adv receptor (CAR) and v3 or v5 integrin] (Bangari et al., 2005a), but utilizes (2,3)-linked as well as (2.6)-linked sialic acid as major receptors (Li et al., 2009). Pre-existing HAd-neutralizing antibodies in humans do not cross-neutralize BAdv3 (Bangari et al., 2005b) and HAdv-specific immune response does not cross react with BAdv (Sharma et al., 2010b). Notably, unlike HAdv5, BAdv3 is a strong inducer of TLR4 and does not deplete Kupffer cells of liver (Sharma et al., 2010a), whereas the Kupffer cell depletion with HAdv5 is the main reason for a faster vector depletion from the host. Biodistribution study with a BAdv3 vector showed that it efficiently transduces the heart, kidney, lung, liver and spleen, and the vector persists for a longer duration compared to a HAdv5 vector especially in the heart, kidney and lung in a mouse model (Sharma et al., 2009). Significantly, sequential administration of HAdv5 and BAdv3 vectors overcomes vector immunity in an immunocompetent mouse model of breast cancer (Tandon et al., 2012) and BAdv3 and HAdv5 vector genomes show similar persistence in human and nonhuman cell lines (Sharma et al., 2009). Thus, BAdv3 vectors offer an attractive alternative to HAdv vectors for effectively immunizing individuals with high levels of pre-existing HAdv immunity with safety similar to HAdv5 vectors. Due to the usage of sialic acid as the primary receptor for BAdv, we believe that this vector-based vaccine platform should be ideal for intranasal immunization (Sayedahmed et al., 2018).
[0093] This study demonstrates a striking finding that the Mtb Ag85B-p25 epitope expressed using BAdv nasal vaccine platform in combination with AIP-C5 generates a significant protection against Mtb in mice. Our previous studies illustrated that the processing and presentation of mycobacterial antigens by APC's are critical components of vaccine-mediated anti-tuberculosis immunity (Jagannath and Bakhru, 2012; Jagannath et al., 2009). Whereas, BCG and wt-Mtb evade phagolysosome fusion, BCG over-expressing Ag85B (BCG.sup.85B), Ag85B plus AIP-C5 (BCG.sup.85BC5) or sapM/fbpA gene knockouts of Mtb (fbpAsapM-Mtb) were delivered to the lysosomes of mouse APCs generating peptides for activation of CD4 T cells ex vivo (Singh et al., 2006; Saikolappan et al., 2011; Khan et al., 2019). Both BCG.sup.85B and BCG.sup.85BC5 induced robust activation of Ag85-p25 epitope-specific CD4 T cells in mice after vaccination and challenge with Mtb (Jagannath et al., 2009; Khan et al., 2019). However, recombinant BCG vaccines cannot be given to infants through the nasal route due to the risk of lung inflammation. Thus, protection of lungs in neonates following the primary BCG vaccination was our main goal.
[0094] Since DCs play a pivotal role during vaccination, we first evaluated gene expression in BAdv.sup.85C5 infected DCs in comparison with HAdv.sup.85C5. Interestingly, BAdv.sup.85C5 induced a significant up-regulation of multiple genes involved in the sorting of vaccine containing endosomes to lysosomes and genes regulating antigen processing (
[0095] Mechanistic studies were performed to understand the efficacy of BAdv.sup.85C5 vaccine. Previous studies show that Lgals-8 plays a role during wt-HAdv modulation of autophagy reducing antigen presentation in human epithelial cells (Montespan et al., 2017), whereas, HAdv infection down regulated Lgals-3 (Trinh et al., 2013). Paradoxically, Galectins participate at various levels autophagy; whereas. Lgals-8 inhibits mTOR inducing autophagy (Jia et al., 2018), and Lgals-3 regulate lysosome stability through lysophagy (Yao et al., 2020; Jia et al., 2020). Indeed, our initial studies using BAdv.sup.85C5 and HAdv.sup.85C5 showed a reduced antigen presentation to CD4 T cells when ATG7KO-DCs were used (
[0096] Consistent with our previous observation that induction of autophagy enhances MHC-II dependent antigen presentation by mycobacteria infected DCs (Jagannath et al., 2009), BAdv.sup.85-infected DCs up-regulated several genes which likely facilitated an autophagy-dependent antigen presentation. Thus, LAMP2 participates during chaperone-mediated autophagy when soluble proteins of cytosol are internalized into lysosomes (Tekirdag and Cuervo, 2018; Wang et al., 2016), and Gabarap (LC3 family) and Rab7 are involved during selective autophagy (Khaminets et al., 2015) and autophagolysosome fusion, respectively. Because, multiple immune-regulatory genes were expressed at lower levels following infection of ATG7KO-DCs with BAdv.sup.85C5 compared to wt-DCs, the signaling pathways which deliver BAdv.sup.85 autophagolysosomes need additional investigations. However, we found a novel cathepsin-dependent mechanism through which BAdv.sup.85 infected DCs show increased immunogenicity compared to HAdv.sup.85.
[0097] BAdv.sup.85C5 enhanced the cathepsin gene and protein expression compared to HAdv.sup.85C5 (
[0098] These data together indicate that BAdv.sup.85C5 is better than HAdv.sup.85C5 in enhancing lysosomal production of the Ag85B-p25 epitope thereby boosting the immunogenicity of DCs. We recall here that the mammalian target of rapamycin, mTOR, which is a major negative regulator of autophagy, controls the accumulation of DCs in the lungs and governs the programing of their metabolomes (Sinclair et al., 2017). Since BAdv.sup.85C5 induces positive changes in DCs mainly through autophagy pathway (
[0099] Consistent with the in vitro immunogenicity data, the BAdv.sup.85C5 vaccine showed a marked protective effect in mice exposed to Mtb. First, BAdv.sup.85C5 induced a robust gene expression in the lungs and BAL of mice when given as a single nasal vaccine compared to BAdv.sup.85 (
[0100] Immunity against tuberculosis is multifactorial, including TH1-immunity facilitated by cytokine secreting CD4 and CD8 T cells, a variety of other innate T cells, neutrophils, myeloid cells and antibodies.
[0101] BCG revaccination of healthy volunteers reduces skin test conversion, but the impact of this issue to the susceptibility for tuberculosis remains unclear. Because, intranasal BCG is not feasible, we propose that BAdv.sup.85C5 nasal vaccine will strengthen the lung compartment to resist aerosol infection with Mtb. Supporting this concept, the BAdv.sup.85C5 booster enhanced the T.sub.RM response in the lungs of BCG-vaccinated mice before and after Mtb exposure (
[0102] In summary, the BAdv vaccine platform enables the expression of an Mtb immunogenic peptide and activates Lgals-3 and Lgals-8 dependent autophagy leading to robust antigen presentation by both mouse DCs and human Ms resulting in an excellent protection in the mouse model of tuberculosis. Our results suggest that autophagy-mediated antigen presentation through the BAdv vaccine platform expressing multivalent immunogenic proteins of Mtb will assist in designing a more potent mucosal tuberculosis vaccine for use in children and adults.
[0103] While the inventions have been illustrated and described in detail in the drawings and foregoing description, the same is to be considered as illustrative and not restrictive in character, it being understood that only certain embodiments have been shown and described and that all changes and modifications that come within the spirit of the invention are desired to be protected.
[0104] It is intended that that the scope of the present methods and compositions be defined by the following claims. However, it must be understood that this disclosure may be practiced otherwise than is specifically explained and illustrated without departing from its spirit or scope. It should be understood by those skilled in the art that various alternatives to the embodiments described herein may be employed in practicing the claims without departing from the spirit and scope as defined in the following claims.
CITED REFERENCES
[0105] Ahi, Y.S., Bangari, D.S., and Mittal, S.K. (2011). Adenoviral vector immunity: its implications and circumvention strategies. Curr Gene Ther 11, 307-320. [0106] Baba, T., Toth, D.J., Sengupta, N., Kim, Y.J., and Balla, T. (2019). Phosphatidylinositol 4,5-bisphosphate controls Rab7 and PLEKHM1 membrane cycling during autophagosome-lysosome fusion. EMBO J 38, e100312. [0107] Bailey, C.J., Crystal, R.G., and Leopold, P.L. (2003). Association of adenovirus with the microtubule organizing center. J Virol 77, 13275-13287. [0108] Bakhru, P. (2012). Induction of stronger and long lasting vaccine mediated immunity to tuberculosis. In Pathology (Houston: University of Texas Health Sciences Center), pp. 155. [0109] Bakhru, P., Sirisaengtaksin, N., Soudani, E., Mukherjee, S., Khan, A., and Jagannath., C. (2013). BCG vaccine mediated reduction in MHC-II expression of macrophages and dendritic cells can be reversed using activation of Toll-like receptors 7 and 9. Cellular Immunology (2013). [0110] Bangari, D.S., and Mittal, S.K. (2006). Current strategies and future directions for eluding adenoviral vector immunity. Curr Gene Ther 6, 215-226. [0111] Bangari, D.S., Sharma, A., and Mittal, S.K. (2005a). Bovine adenovirus type 3 internalization is independent of primary receptors of human adenovirus type 5 and porcine adenovirus type 3. Biochem Biophys Res Commun 331, 1478-1484. [0112] Bangari, D.S., Shukla, S., and Mittal, S.K. (2005b). Comparative transduction efficiencies of human and nonhuman adenoviral vectors in human, murine, bovine, and porcine cells in culture. Biochem Biophys Res Commun 327, 960-966. [0113] Barouch, D.H., Tomaka, F.L., Wegmann, F., Stich, D.J., Alter, G., Robb, M.L., Michael, N.L., Peter, L., Nkolola, J.P., Borducchi, E.N., et al. (2018). Evaluation of a mosaic HIV-1 vaccine in a multicentre, randomised, double-blind, placebo-controlled, phase a clinical trial (APPROACH) and in rhesus monkeys (NHP 13-19). Lancet 392, 232-243. [0114] Cao, W., Liepkalns, J.S., Hassan, A.O., Kamal, R.P., Hofstetter, A.R., Amoah, S., Kim, J.H., Reber, A.J., Stevens, J., Katz, J.M., et al. (2016). A highly immunogenic vaccine against A/H7N9 influenza virus. Vaccine 34, 744-749. [0115] Chauhan, S., Kumar, S., Jain, A., Ponpuak, M., Mudd, M.H., Kimura, T., Choi, S.W., Peters, R., et al. (2016). TRIMs and Galectins Globally Cooperate and TRIM16 and Galectin-3 Co-direct Autophagy in Endomembrane Damage Homeostasis. Dev Cell 39, 13-27. [0116] Chen, M., Hong. M.J., Sun, H., Wang, L., Shi, X., Gilbert, B.E., Corry, D.B., Kheradmand, F., and Wang, J. (2014). Essential role for autophagy in the maintenance of immunological memory against influenza infection. Nat Med 20, 503-510. [0117] Darrah, P.A., DiFazio, R.M., Maiello, P., Gideon, H.P., Myers, A.J., Rodgers, M.A., Hackney, J.A., Lindenstrom, T., Evans, T., et al. (2019). Boosting BCG with proteins or rAd5 does not enhance protection against tuberculosis in rhesus macaques. NPJ Vaccines 4, 21. [0118] Fausther-Bovendo, H., and Kobinger, G.P. (2014). Pre-existing immunity against Ad vectors: humoral, cellular, and innate response. Hum Vaccin Immunother 10, 2875-2884. [0119] Florido, M., Muflihah, H., Lin, L.C.W., Xia, Y., Sierro, F., Palendira, M., Feng, C.G., Bertolino, P., Stambas, J., Triccas, J.A., et al. (2018). Pulmonary immunization with a recombinant influenza A virus vaccine induces lung-resident CD4 (+) memory T cells that are associated with protection against tuberculosis. Mucosal Immunol. [0120] Florido, M., Pillay, R., Gillis, C.M., Xia, Y., Turner, S.J., Triccas, J.A., Stambas, J., and Britton, W.J. (2015). Epitope-specific CD4+, but not CD8+, T-cell responses induced by recombinant influenza A viruses protect against Mycobacterium tuberculosis infection. Eur J Immunol 45, 780-793. [0121] Gengenbacher, M., Nieuwenhuizen, N., Vogelzang, A., Liu, H., Kaiser, P., Schuerer, S., Lazar, D., Wagner, I., Mollenkopf, H.J., and Kaufmann, S.H. (2016). Deletion of nuoG from the Vaccine Candidate Mycobacterium bovis BCG DeltaureC::hly Improves Protection against Tuberculosis. MBio 7. [0122] Gray, J.I., Westerhof, L.M., and Macleod, M.K.L. (2018). The roles of resident, central and effector memory CD4 T-cells in protective immunity following infection or vaccination. Immunology. [0123] Guzman, E., Cubillos-Zapata, C., Cottingham, M.G., Gilbert, S.C., Prentice, H., Charleston, B., and Hope, J.C. (2012). Modified vaccinia virus Ankara-based vaccine vectors induce apoptosis in dendritic cells draining from the skin via both the extrinsic and intrinsic caspase pathways, preventing efficient antigen presentation. J Virol 86, 5452-5466. [0124] Hendrickx. R., Stichling, N., Koelen, J., Kuryk, L., Lipiec, A., and Greber, U.F. (2014). Innate immunity to adenovirus. Hum Gene Ther 25, 265-284. [0125] Hoelscher, M.A., Garg, S., Bangari, D.S., Belser, J.A., Lu, X., Stephenson, I., Bright, R.A., Katz, J.M., Mittal, S.K., and Sambhara, S. (2006). Development of adenoviral-vector-based pandemic influenza vaccine against antigenically distinct human H5N1 strains in mice. Lancet 367, 475-481. [0126] Hoelscher, M.A., Jayashankar, L., Garg, S., Veguilla, V., Lu, X., Singh, N., Katz, J.M., Mittal, S.K., and Sambhara, S. (2007). New pre-pandemic influenza vaccines: an egg- and adjuvant-independent human adenoviral vector strategy induces long-lasting protective immune responses in mice. Clin Pharmacol Ther 82, 665-671. [0127] Hoft, D.F., Blazevic, A., Stanley, J., Landry, B., Sizemore, D., Kpamegan, E., Gearhart, J., Scott, A., Kik, S., Pau, M.G., et al. (2012). A recombinant adenovirus expressing immunodominant TB antigens can significantly enhance BCG-induced human immunity. Vaccine 30, 2098-2108. [0128] Hoft, S.G., Sallin, M.A., Kauffman, K.D., Sakai, S., Ganusov, V.V., and Barber, D.L. (2019). The Rate of CD4 T Cell Entry into the Lungs during Mycobacterium tuberculosis Infection Is Determined by Partial and Opposing Effects of Multiple Chemokine Receptors. Infect Immun 87. [0129] Huggins, M.A., Sjaastad, F.V., Pierson, M., Kucaba, T.A., Swanson, W., Staley, C., Weingarden, A.R., Jensen, I.J., Danahy, D.B., Badovinac, V.P., et al. (2019). Microbial Exposure Enhances Immunity to Pathogens Recognized by TLR2 but Increases Susceptibility to Cytokine Storm through TLR4 Sensitization. Cell Rep 28, 1729-1743 e1725. [0130] Jabbari, A., and Harty, J.T. (2006). Secondary memory CD8+T cells are more protective but slower to acquire a central-memory phenotype. J Exp Med 203, 919-932. [0131] Jagannath, C., and Bakhru, P. (2012). Rapamycin-induced enhancement of vaccine efficacy in mice. Methods Mol Biol 821, 295-303. [0132] Jagannath, C., Lindsey, D.R., Dhandayuthapani, S., Xu, Y., Hunter, R.L., Jr., and Eissa, N.T. (2009). Autophagy enhances the efficacy of BCG vaccine by increasing peptide presentation in mouse dendritic cells. Nat Med 15, 267-276. [0133] Jia, J., Abudu, Y.P., Claude-Taupin, A., Gu, Y., Kumar, S., Choi, S.W., Peters, R., Mudd, M.H., Allers, L., Salemi, M., et al. (2018). Galectins Control mTOR in Response to Endomembrane Damage. Mol Cell 70, 120-135 e128. [0134] Jia, J., Claude-Taupin, A., Gu, Y., Choi, S.W., Peters, R., Bissa, B., Mudd, M.H., Allers, L., Pallikkuth, S., Lidke, K.A., et al. (2020). Galectin-3 Coordinates a Cellular System for Lysosomal Repair and Removal. Dev Cell 52, 69-87 e68. [0135] Katunuma, N., Matsunaga, Y., Himeno, K., and Hayashi, Y. (2003). Insights into the roles of cathepsins in antigen processing and presentation revealed by specific inhibitors. Biol Chem 384, 883-890. [0136] Kaveh, D.A., Bachy, V.S., Hewinson, R.G., and Hogarth, P.J. (2011). Systemic BCG immunization induces persistent lung mucosal multifunctional CD4 T (EM) cells which expand following virulent mycobacterial challenge. PLOS One 6, e21566. [0137] Khaminets, A., Heinrich, T., Mari, M., Grumati, P., Huebner, A.K., Akutsu, M., Liebmann, L., Stolz, A., Nietzsche, S., Koch, N., et al. (2015). Regulation of endoplasmic reticulum turnover by selective autophagy. Nature 522, 354-358. [0138] Khan, A., Bakhru, P., Saikolappan, S., Das, K., Soudani, E., Singh, C.R., Estrella, J.L., Zhang, D., Pasare, C., Ma, Y., et al. (2019). An autophagy-inducing and TLR-2 activating BCG vaccine induces a robust protection against tuberculosis in mice. NPJ Vaccines 4, 34. [0139] Kumar, B.V., Ma, W., Miron, M., Granot, T., Guyer, R.S., Carpenter, D.J., Senda, T., Sun, X., Ho, S.H., Lerner, H., et al. (2017). Human Tissue-Resident Memory T Cells Are Defined by Core Transcriptional and Functional Signatures in Lymphoid and Mucosal Sites. Cell Rep 20, 2921-2934. [0140] Ledgerwood, J.E., DeZure, A.D., Stanley, D.A., Coates, E.E., Novik, L., Enama, M.E., Berkowitz, N.M., Hu, Z., Joshi, G., Ploquin, A., et al. (2017). Chimpanzee Adenovirus Vector Ebola Vaccine. N Engl J Med 376, 928-938. [0141] Lee, H.K., Mattei, L.M., Steinberg, B.E., Alberts, P., Lee, Y.H., Chervonsky, A., Mizushima, N., Grinstein, S., and Iwasaki, A. (2010). In vivo requirement for Atg5 in antigen presentation by dendritic cells. Immunity 32, 227-239. [0142] Lee, J.A., Sinkovits, R.S., Mock, D., Rab, E.L., Cai, J., Yang, P., Saunders, B., Hsueh, R.C., Choi, S., Subramaniam, S., et al. (2006). Components of the antigen processing and presentation pathway revealed by gene expression microarray analysis following B cell antigen receptor (BCR) stimulation. BMC Bioinformatics 7, 237. [0143] Leopold, P.L., Ferris, B., Grinberg, I., Worgall, S., Hackett, N.R., and Crystal, R.G. (1998). Fluorescent virions: dynamic tracking of the pathway of adenoviral gene transfer vectors in living cells. Hum Gene Ther 9, 367-378. [0144] Li, F.Y., Wang, S.F., Bernardes, E.S., and Liu, F.T. (2020). Galectins in Host Defense Against Microbial Infections. Adv Exp Med Biol 1204, 141-167. [0145] Li, X., Bangari, D.S., Sharma, A., and Mittal, S.K. (2009). Bovine adenovirus serotype 3 utilizes sialic acid as a cellular receptor for virus entry. Virology 392, 162-168. [0146] Maier, O., Marvin, S.A., Wodrich, H., Campbell, E.M., and Wiethoff, C.M. (2012). Spatiotemporal dynamics of adenovirus membrane rupture and endosomal escape. J Virol 86, 10821-10828. [0147] Montespan, C., Marvin, S.A., Austin, S., Burrage, A.M., Roger, B., Rayne, F., Faure, M., Campell, E.M., Schneider, C., Reimer, R., et al. (2017). Multi-layered control of Galectin-8 mediated autophagy during adenovirus cell entry through a conserved PPxY motif in the viral capsid. PLOS Pathog 13, e1006217. [0148] Munz, C. (2015). Of LAP, CUPS, and DRibbles-Unconventional Use of Autophagy Proteins for MHC Restricted Antigen Presentation. Front Immunol 6, 200. [0149] Nishida, Y., Arakawa, S., Fujitani, K., Yamaguchi, H., Mizuta, T., Kanaseki, T., Komatsu, M., Otsu, K., Tsujimoto, Y., and Shimizu, S. (2009). Discovery of Atg5/Atg7-independent alternative macroautophagy. Nature 461, 654-658. [0150] Ogongo, P., Porterfield, J.Z., and Leslie, A. (2019). Lung Tissue Resident Memory T-Cells in the Immune Response to Mycobacterium tuberculosis. Front Immunol 10, 992. [0151] Orme, I.M. (2010). The Achilles heel of BCG. Tuberculosis (Edinb) 90, 329-332. [0152] Perez-Montesinos, G., Lopez-Ortega, O., Piedra-Reyes, J., Bonifaz, L.C., and Moreno, J. (2017). Dynamic Changes in the Intracellular Association of Selected Rab Small GTPases with MHC Class II and DM during Dendritic Cell Maturation. Front Immunol 8, 340. [0153] Peters, W., Scott, H.M., Chambers, H.F., Flynn, J.L., Charo, I.F., and Ernst, J.D. (2001). Chemokine receptor 2 serves an early and essential role in resistance to Mycobacterium tuberculosis. Proc Natl Acad Sci USA 98, 7958-7963. [0154] Pires, D., Marques, J., Pombo, J.P., Carmo, N., Bettencourt, P., Neyrolles, O., Lugo-Villarino, G., and Anes, E. (2016). Role of Cathepsins in Mycobacterium tuberculosis Survival in Human Macrophages. Sci Rep 6, 32247. [0155] Ramachandra, L., Noss, E., Boom, W.H., and Harding, C.V. (1999). Phagocytic processing of antigens for presentation by class II major histocompatibility complex molecules. Cell Microbiol 1, 205-214. [0156] Ramachandra, L., Noss, E., Boom, W.H., and Harding, C.V. (2001). Processing of Mycobacterium tuberculosis antigen 85B involves intraphagosomal formation of peptide-major histocompatibility complex II complexes and is inhibited by live bacilli that decrease phagosome maturation. J Exp Med 194, 1421-1432. [0157] Ramzan, M., Ali, S.M., Malik, A., Zaka-ur-Rab, Z., and Shahab, T. (2009). Frequency of HIV infection amongst children with disseminated tuberculosis and tuberculous meningitis in Aligarh (North India)-a low HIV prevalence area. J Coll Physicians Surg Pak 19, 566-569. [0158] Rivera-Marrero, C.A., Stewart, J., Shafer, W.M., and Roman, J. (2004). The down-regulation of cathepsin G in THP-1 monocytes after infection with Mycobacterium tuberculosis is associated with increased intracellular survival of bacilli. Infect Immun 72, 5712-5721. [0159] Rodo, M.J., Rozot, V., Nemes, E., Dintwe, O., Hatherill, M., Little, F., and Scriba, T.J. (2019). A comparison of antigen-specific T cell responses induced by six novel tuberculosis vaccine candidates. PLOS Pathog 15, e1007643. [0160] Saikolappan, S., Estrella, J., Khan, A., Smitha, K., Jagannath, C., and Dhandayuthapani, S. (2011). The deltafbpA/deltasapM double knocout mutant derived from Mycobacterium tuberculosis H37Rv is attenuated and highly immunogenic in macrophages (under revision). PLOSone. [0161] Saini, N.K., Baena, A., Ng, T.W., Venkataswamy, M.M., Kennedy, S.C., Kunnath-Velayudhan, S., Carreno, L.J., Xu, J., Chan, J., Larsen, M.H., et al. (2016). Suppression of autophagy and antigen presentation by Mycobacterium tuberculosis PE_PGRS47. Nat Microbiol 1, 16133. [0162] Santosuosso, M., McCormick, S., Zhang, X., Zganiacz, A., and Xing, Z. (2006). Intranasal boosting with an adenovirus-vectored vaccine markedly enhances protection by parenteral Mycobacterium bovis BCG immunization against pulmonary tuberculosis. Infect Immun 74, 4634-4643. [0163] Saso, A., and Kampmann, B. (2017). Vaccine responses in newborns. Semin Immunopathol 39, 627-642. [0164] Sayedahmed, E.E., Hassan, A.O., Kumari, R., Cao, W., Gangappa, S., York, I., Sambhara, S., and Mittal, S.K. (2018). A bovine adenoviral vector-based H5N1 influenza-vaccine provides enhanced immunogenicity and protection at a significantly low dose. Mol Ther Methods Clin Dev 10, 210-222. [0165] Schaaf, M.B., Keulers, T.G., Vooijs, M.A., and Rouschop, K.M. (2016). LC3/GABARAP family proteins: autophagy-(un) related functions. FASEB J 30, 3961-3978. [0166] Segura, E., and Amigorena, S. (2015). Cross-Presentation in Mouse and Human Dendritic Cells. Adv Immunol 127, 1-31. [0167] Sharma, A., Bangari, D.S., Tandon, M., Hogenesch, H., and Mittal, S.K. (2010a). Evaluation of innate immunity and vector toxicity following inoculation of bovine, porcine or human adenoviral vectors in a mouse model. Virus Res 153, 134-142. [0168] Sharma, A., Bangari, D.S., Tandon, M., Pandey, A., HogenEsch, H., and Mittal, S.K. (2009). Comparative analysis of vector biodistribution, persistence and gene expression following intravenous delivery of bovine, porcine and human adenoviral vectors in a mouse model. Virology 386, 44-54. [0169] Sharma, A., Tandon, M., Ahi, Y.S., Bangari, D.S., Vemulapalli, R., and Mittal, S.K. (2010b). Evaluation of Cross-Reactive Cell-Mediated Immune Responses among Human, Bovine and Porcine Adenoviruses. Gene Ther 17, 634-642. [0170] Sharma, P.K., Dmitriev, I.P., Kashentseva, E.A., Raes, G., Li, L., Kim, S.W., Lu, Z.H., Arbeit, J.M., Fleming, T.P., Kaliberov, S.A., et al. (2018). Development of an adenovirus vector vaccine platform for targeting dendritic cells. Cancer Gene Ther 25, 27-38. [0171] Sinclair, C., Bommakanti, G., Gardinassi, L., Loebbermann, J., Johnson, M.J., Hakimpour, P., Hagan, T., Benitez, L., Todor, A., Machiah, D., et al. (2017). mTOR regulates metabolic adaptation of APCs in the lung and controls the outcome of allergic inflammation. Science 357, 1014-1021. [0172] Singh, C.R., Bakhru, P., Khan, A., Li, Q.B., and Jagannath, C. (2011). Cutting Edge: Nicastrin and Related Components of gamma-Secretase Generate a Peptide Epitope Facilitating Immune Recognition of Intracellular Mycobacteria, through MHC Class IIDependent Priming of T Cells. J Immunol 187, 5495-5499. [0173] Singh, C.R., Moulton, R.A., Armitige, L. Y., Bidani, A., Snuggs, M., Dhandayuthapani, S., Hunter, R.L., and Jagannath, C. (2006). Processing and presentation of a mycobacterial antigen 85B epitope by murine macrophages is dependent on the phagosomal acquisition of vacuolar proton ATPase and in situ activation of cathepsin D. J Immunol 177, 3250-3259. [0174] Singh, N., Pandey, A., Jayashankar, L., and Mittal, S.K. (2008). Bovine adenoviral vector-based H5N1 influenza vaccine overcomes exceptionally high levels of pre-existing immunity against human adenovirus. Mol Ther 16, 965-971. [0175] Smaill, F., Jeyanathan, M., Smieja, M., Medina, M.F., Thanthrige-Don, N., Zganiacz, A., Yin, C., Heriazon, A., Damjanovic, D., Puri, L., et al. (2013). A human type 5 adenovirus-based tuberculosis vaccine induces robust T cell responses in humans despite preexisting anti-adenovirus immunity. Sci Transl Med 5, 205ra134. [0176] Soualhine, H., Deghmane, A.E., Sun, J., Mak, K., Talal, A., Av-Gay, Y., and Hmama, Z. (2007). Mycobacterium bovis Bacillus Calmette-Guerin secreting active cathepsin S stimulates expression of mature MHC class II molecules and antigen presentation in human macrophages. J Immunol 179, 5137-5145. [0177] Tameris, M.D., Hatherill, M., Landry, B.S., Scriba, T.J., Snowden, M.A., Lockhart, S., Shea, J.E., McClain, J.B., Hussey, G.D., Hanekom, W.A., et al. (2013). Safety and efficacy of MVA85A, a new tuberculosis vaccine, in infants previously vaccinated with BCG: a randomised, placebo-controlled phase 2b trial. Lancet 381, 1021-1028. [0178] Tamura, T., Ariga, H., Kinashi, T., Uehara, S., Kikuchi, T., Nakada, M., Tokunaga, T., Xu, W., Kariyone, A., Saito, T., et al. (2004). The role of antigenic peptide in CD4+ T helper phenotype development in a T cell receptor transgenic model. Int Immunol 16, 1691-1699. [0179] Tandon, M., Sharma, A., Vemula, S.V., Bangari, D.S., and Mittal, S.K. (2012). Sequential administration of bovine and human adenovirus vectors to overcome vector immunity in an immunocompetent mouse model of breast cancer. Virus Res 163, 202-211. [0180] Tekirdag, K., and Cuervo, A.M. (2018). Chaperone-mediated autophagy and endosomal microautophagy: Joint by a chaperone. J Biol Chem 293, 5414-5424. [0181] Thompson, E.A., Darrah, P.A., Foulds, K.E., Hoffer, E., Caffrey-Carr, A., Norenstedt, S., Perbeck, L., Seder, R.A., Kedl, R.M., and Lore, K. (2019). Monocytes Acquire the Ability to Prime Tissue-Resident T Cells via IL-10-Mediated TGF-beta Release. Cell Rep 28, 1127-1135 e1124. [0182] Thurston, T.L., Wandel, M.P., von Muhlinen, N., Foeglein, A., and Randow, F. (2012). Galectin 8 targets damaged vesicles for autophagy to defend cells against bacterial invasion. Nature 482, 414-418. [0183] Trinh, H.V., Grossmann, J., Gehrig, P., Roschitzki, B., Schlapbach, R., Greber, U.F., and Hemmi, S. (2013). iTRAQ-Based and Label-Free Proteomics Approaches for Studies of Human Adenovirus Infections. Int J Proteomics 2013, 581862. [0184] Van Kampen, K.R., Shi, Z., Gao, P., Zhang, J., Foster, K.W., Chen, D.T., Marks, D., Elmets, C.A., and Tang, D.C. (2005). Safety and immunogenicity of adenovirus-vectored nasal and epicutaneous influenza vaccines in humans. Vaccine 23, 1029-1036. [0185] van Zyl-Smit, R.N., Esmail, A., Bateman, M.E., Dawson, R., Goldin, J., van Rikxoort, E., Douoguih, M., Pau, M.G., Sadoff, J.C., McClain, J.B., et al. (2017). Safety and Immunogenicity of Adenovirus 35 Tuberculosis Vaccine Candidate in Adults with Active or Previous Tuberculosis. A Randomized Trial. Am J Respir Crit Care Med 195, 1171-1180. [0186] Vemula, S.V., and Mittal, S.K. (2010). Production of adenovirus vectors and their use as a delivery system for influenza vaccines. Expert Opin Biol Ther 10, 1469-1487. [0187] Vogelzang, A., Perdomo, C., Zedler, U., Kuhlmann, S., Hurwitz, R., Gengenbacher, M., and Kaufmann, S.H. (2014). Central memory CD4+ T cells are responsible for the recombinant Bacillus Calmette-Guerin DeltaureC::hly vaccine's superior protection against tuberculosis. J Infect Dis 210, 1928-1937. [0188] Wang, B., Chen, Z., Yu, F., Chen, Q., Tian, Y., Ma, S., Wang, T., and Liu, X. (2016). Hsp90 regulates autophagy and plays a role in cancer therapy. Tumour Biol 37, 1-6. [0189] Weng, I.C., Chen, H.L., Lo, T.H., Lin, W.H., Chen, H.Y., Hsu, D.K., and Liu, F.T. (2018). Cytosolic galectin-3 and-8 regulate antibacterial autophagy through differential recognition of host glycans on damaged phagosomes. Glycobiology 28, 392-405. [0190] Wherry, E.J., Teichgraber, V., Becker, T.C., Masopust, D., Kaech, S.M., Antia, R., von Andrian, U.H., and Ahmed, R. (2003). Lineage relationship and protective immunity of memory CD8 T cell subsets. Nat Immunol 4, 225-234. [0191] Xing, Z., McFarland, C.T., Sallenave, J.M., Izzo, A., Wang, J., and McMurray, D.N. (2009). Intranasal mucosal boosting with an adenovirus-vectored vaccine markedly enhances the protection of BCG-primed guinea pigs against pulmonary tuberculosis. PLOS One 4, e5856. [0192] Yao, R.Q., Ren, C., Xia, Z.F., and Yao, Y.M. (2020). Organelle-specific autophagy in inflammatory diseases: a potential therapeutic target underlying the quality control of multiple organelles. Autophagy, 1-17. [0193] Yu, J.C., Khodadadi, H., Malik, A., Davidson, B., Salles, E., Bhatia, J., Hale, V.L., and Baban, B. (2018). Innate Immunity of Neonates and Infants. Front Immunol 9, 1759. [0194] Zens, K.D., Chen, J.K., Guyer, R.S., Wu, F.L., Cvetkovski, F., Miron, M., and Farber, D.L. (2017). Reduced generation of lung tissue-resident memory T cells during infancy. J Exp Med 214, 2915-2932. [0195] Zhang, L., Li, H., Hai, Y., Yin, W., Li, W., Zheng, B., Du, X., Li, N., Zhang, Z., Deng, Y., et al. (2017). CpG in Combination with an Inhibitor of Notch Signaling Suppresses Formalin-Inactivated Respiratory Syncytial Virus-Enhanced Airway Hyperresponsiveness and Inflammation by Inhibiting Th17 Memory Responses and Promoting Tissue-Resident Memory Cells in Lungs. J Virol 91. [0196] Zhu, J., Huang, X., and Yang, Y. (2007). Innate immune response to adenoviral vectors is mediated by both Toll-like receptor-dependent and-independent pathways. J Virol 81, 3170-3180.