ALBUGO CANDIDA RESISTANCE GENE

20240368621 ยท 2024-11-07

    Inventors

    Cpc classification

    International classification

    Abstract

    The present invention relates to a gene encoding a protein which confers resistance to Albugo candida when expressed in a Raphanus sativus plant, wherein said gene comprises: a) a nucleotide sequence encoding a protein having an amino acid sequence, which has in order of increased preference at least 70%, 75%, 80%, 83%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 100% sequence similarity to SEQ ID No. 3; or b) a nucleotide sequence comprising a coding sequence which has in order of increased preference at least 70%, 75%, 80%, 83%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 100% sequence identity to SEQ ID No. 2; or c) a nucleotide sequence encoding at least the amino acid positions 15 to 192 of SEQ ID No. 3, the amino acid positions 209 to 432 of SEQ ID No. 3, and the amino acid positions 540 to 1023 of SEQ ID No. 3; or d) a nucleotide sequence encoding an LRR domain comprising the amino acid positions 540 to 1023 of SEQ ID No. 3 or encoding an LRR domain which has in order of increased preference at least 95%, 96%, 97%, 98%, 99% sequence similarity to the amino acid sequence of the amino acid positions 540 to 1023 of SEQ ID No. 3.

    Claims

    1. A gene encoding a protein which confers resistance to Albugo candida when expressed in a Raphanus sativus plant, wherein said gene comprises: a) a nucleotide sequence encoding a protein having an amino acid sequence, which has in order of increased preference at least 70%, 75%, 80%, 83%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 100% sequence similarity to SEQ ID No. 3; or b) a nucleotide sequence comprising a coding sequence which has in order of increased preference at least 70%, 75%, 80%, 83%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 100% sequence identity to SEQ ID No. 2; or c) a nucleotide sequence encoding at least the amino acid positions 15 to 192 of SEQ ID No. 3, the amino acid positions 209 to 432 of SEQ ID No. 3, and the amino acid positions 540 to 1023 of SEQ ID No. 3; or d) a nucleotide sequence encoding an LRR domain comprising the amino acid positions 540 to 1023 of SEQ ID No. 3 or encoding an LRR domain which has in order of increased preference at least 95%, 96%, 97%, 98%, 99%, 100% sequence similarity to the amino acid sequence of the amino acid positions 540 to 1023 of SEQ ID No. 3.

    2. The gene of claim 1, wherein the gene comprises a thymine on position 2240 of SEQ ID No. 2 or a thymine on a corresponding position of a homologous sequence that has at least 70%, 75%, 80%, 83%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity to SEQ ID No. 2.

    3. A protein encoded by the gene of claim 1.

    4. A method for producing a plant that is resistant against Albugo candida comprising using the gene of claim 1.

    5. A marker for the identification of the gene of claim 1, wherein the marker detects a thymine on position 2240 of SEQ ID No. 2, or wherein the marker detects a thymine on a corresponding position of a homologous sequence that has at least 70% sequence identity to SEQ ID No. 2.

    6. The marker of claim 5, wherein the marker is a nucleic acid molecule comprising SEQ ID No. 4.

    7. The marker of claim 5, wherein the marker is a nucleic acid molecule comprising SEQ ID No. 5.

    8. A method for identifying a plant comprising a gene encoding a protein which confers resistance to Albugo candida when expressed in a Raphanus sativus plant comprising using the marker of claim 5.

    9. Method for identifying a plant resistant to Albugo candida, wherein the method comprises the following steps: a) detecting in the genome of a plant the gene of claim 1, and/or b) detecting a unique polymorphism in the gene of claim 1, and optionally c) testing of the plant comprising the gene of the invention for exhibiting resistance to Albugo candida.

    10. The method of claim 9, wherein the detecting of the unique polymorphism in step (b) is done with a marker that detects a thymine on position 2240 of SEQ ID No. 2, or wherein the marker detects a thymine on a corresponding position of a homologous sequence that has at least 70% sequence identity to SEQ ID No. 2.

    11. A plant comprising the gene of claim 1, wherein the plant is resistant to Albugo candida.

    12. The plant of claim 11, wherein the plant is an agronomically elite plant, in particular a hybrid variety or an inbred line.

    13. The plant of claim 11, wherein the plant belongs to the species Raphanus sativus.

    14. A seed capable of growing into the plant of claim 11.

    15. Propagation material suitable for producing a plant that is resistant to Albugo candida, wherein the propagation material is suitable for sexual reproduction, and is in particular selected from a microspore, pollen, ovary, ovule, embryo sac and egg cell, or is suitable for vegetative reproduction, and is in particular selected from a cutting, root, stem cell, and protoplast, or is suitable for tissue culture of regenerable cells or protoplasts, which regenerable cells or protoplasts are in particular selected from a leaf, pollen, embryo, cotyledon, hypocotyl, meristematic cell, root, root tip, anther, flower and stem, and wherein the propagation material comprises the gene of claim 1.

    16. A method for selecting a plant resistant to Albugo candida, comprising identifying the presence of the gene of claim 1, optionally testing the plant for resistance against Albugo candida, and selecting a plant comprising said gene, wherein said plant exhibits resistance to Albugo candida.

    17. A method for producing a Raphanus sativus plant exhibiting resistance against Albugo candida comprising the steps of: a) crossing a first parent plant comprising the gene of claim 1 with a second parent plant to obtain an F1 population; b) optionally performing one or more rounds of selfing and/or crossing with a plant from the F1 population to obtain a further generation population; c) selecting from the further generation population a plant that comprises the gene of claim 1 as a resistant plant.

    18. A method for producing hybrid seed resistant to Albugo candida, comprising the steps of crossing a first parent plant with a second parent plant, wherein one or both parent plants are homozygous for the gene of claim 1 and harvesting the hybrid seed.

    19. The hybrid seed produced by the method of claim 18.

    20. A plant grown from the hybrid seed of claim 19.

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0040] The patent or application file contains at least one drawing executed in color. Copies of this patent or patent application publication with color drawing(s) will be provided by the Office upon request and payment of the necessary fee.

    [0041] The following detailed description, given by way of example, but not intended to limit the invention solely to the specific embodiments described, may best be understood in conjunction with the accompanying drawings.

    [0042] FIG. 1A-1FRaphanus sativus plants in a young plant test classified according to the scale as presented in Table 2. The pictures show plants for each classification according to the scale of Table 2. FIG. 1A-1B: plants scoring resistant, i.e. showing no symptoms; FIG. 1C-1D plants scoring intermediate resistant, showing only minor symptoms with a single or just a couple of pustules; FIG. 1E-1F: plants scoring susceptible, lobs and leaf covered with white pustules of Albugo candida.

    DETAILED DESCRIPTION OF THE INVENTION

    [0043] The gene of the invention is preferably a gene which encodes a protein that confers resistance to Albugo candida when expressed in a Raphanus sativus plant, wherein said gene comprises a nucleotide sequence comprising a coding sequence according to SEQ ID No. 2, or a nucleotide sequence which has in order of increased preference at least 70%, 75%, 80%, 83%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity to SEQ ID No. 2, and wherein the coding sequence comprises a thymine on position 2240 of SEQ ID No. 2 or a thymine on a corresponding position of a homologous sequence that has at least 70%, 75%, 80%, 83%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity to SEQ ID No. 2.

    [0044] The gene of the invention, when present in a plant, in particular a Raphanus sativus, confers resistance to Albugo candida. The Albugo candida resistance conferred by the gene of the invention inherits in a dominant fashion.

    [0045] As used herein, sequence identity is the percentage of nucleotides or amino acids that is identical between two sequences after proper alignment of those sequences. The person skilled in the art is aware of how to align sequences, for example by using a sequence alignment tool such as BLAST, which can be used for both nucleotide sequences and protein sequences. To obtain the most significant result, the best possible alignment that gives the highest sequence identity score should be obtained. The percentage sequence identity is calculated through comparison over the length of the shortest sequence in the assessment. In the present case, a nucleotide sequence represents a gene that at least comprises a start codon and a stop codon or encodes an amino acid sequence which comprises a complete protein encoded by such a gene.

    [0046] Sequence similarity for an amino acid sequence is calculated using EMBOSS stretcher 6.6.0 (www.ebi.ac.uk/Tools/psa/emboss_stretcher), using the EBLOSUM62 matrix with settings Gap open penalty: 12 and Gap extend penalty: 2.

    [0047] The invention further relates to a plant, preferably a plant of the species Raphanus sativus plant, wherein the plant comprises the gene of the invention in its genome. A plant comprising the gene of the invention in its genome is referred to herein as a plant of the invention.

    [0048] In a further embodiment, the plant of the invention is an agronomically elite plant, preferably an agronomically elite Raphanus sativus plant.

    [0049] In the context of this invention, an agronomically elite plant is a plant having a genotype that, as a result of human intervention, comprises an accumulation of distinguishable and desirable agronomic traits which allow a producer to harvest a product of commercial significance, preferably the agronomically elite plant of the invention is a plant of an inbred line or a hybrid.

    [0050] As used herein, a plant of an inbred line is a plant of a population of plants that is the result of three or more rounds of selfing, or backcrossing; or which plant is a double haploid. An inbred line may e.g. be a parent line used for the production of a commercial hybrid.

    [0051] As used herein, a hybrid plant is a plant which is the result of a cross between two different plants having different genotypes. More in particular, a hybrid plant is the result of a cross between plants of two different inbred lines. Such a hybrid plant may e.g. be a plant of an F.sub.1 hybrid variety.

    [0052] In one embodiment, the plant of the invention is a member of the subspecies Raphanus sativus subsp. sativus.

    [0053] In one embodiment, the plant of the invention is a member of the species Raphanus sativus, excluding subspecies Raphanus sativus subsp. niger.

    [0054] Seed of Raphanus sativus L. comprising the gene of the invention was deposited with the NCIMB under accession number NCIMB 43737.

    [0055] The invention thus relates to plants grown from seed deposited under NCIMB accession numbers NCIMB 43737.

    [0056] As used herein, resistance or susceptibility against Albugo candida is determined in a young plant test. Plants to be tested are raised in a greenhouse with a daytime/nighttime temperature regime of 15 C., with 14 hours Son-T light. Nine days after sowing, the young plants are moved to a climate chamber with a daytime/nighttime temperature regime of 14 C./12 C., 14 hours TL lighting per day, and a relative humidity of 80%. Also, nine days after sowing the plants are inoculated using a suspension of Albugo candida spores (100,000 spores/ml). After spraying the inoculum, the plants are covered with plastic for one night. A final assessment of the inoculated plants is done 30 days post sowing by visual scoring for the Albugo candida symptoms, based on the scale described in Table 2.

    [0057] As used herein, a plant exhibiting no symptoms after having been exposed to the above-described disease test, is considered to be resistant against the Albugo candida isolate for which it is tested. A plant exhibiting a single pustule or just a couple of pustules after having been exposed to the above-described disease test, is considered to be partially resistant against the Albugo candida isolate for which it is tested. A plant of which the lobs and leaves are covered with white pustules after having been exposed to the above-described disease test, is considered to be susceptible to the Albugo candida isolate for which it is tested (See Table 2).

    [0058] Another aspect of the invention relates to a seed capable of growing into a plant of the invention wherein said plant comprises the gene of the invention. The invention also relates to use of said seed for the production of a plant of the invention, by growing said seed into a plant.

    [0059] Yet another aspect of the invention relates to a swollen hypocotyl (radish) harvested from a Raphanus sativus plant of the invention wherein said swollen hypocotyl comprises the gene of the invention.

    [0060] The invention also relates to propagation material suitable for producing a plant of the invention, wherein the propagation material is suitable for sexual reproduction, and is in particular selected from a microspore, a pollen, an ovary, an ovule, an embryo sac and an egg cell, or is suitable for vegetative reproduction, and is in particular selected from a cutting, a root, a stem a cell, and a protoplast, or is suitable for tissue culture of regenerable cells or protoplasts, and is in particular selected from a leaf, a pollen, an embryo, a cotyledon, a hypocotyl, a meristematic cell, a root, a root tip, an anther, a flower, a seed and a stem, wherein the propagation material comprises the gene of the invention.

    [0061] The invention further relates to a cell of a plant of the invention. Such a cell may either be in isolated form, or a part of the complete plant or parts thereof and still forms a cell of the invention because such a cell comprises the gene of the invention. Each cell of a plant of the invention carries the gene of the invention. A cell of the invention may also be a regenerable cell that can regenerate into a new plant of the invention.

    [0062] The invention further relates to plant tissue of a plant of the invention, which comprises the gene of the invention. The tissue can be undifferentiated tissue or already differentiated tissue. Undifferentiated tissue is for example a stem tip, an anther, a petal, or pollen, and can be used in micro propagation to obtain new plantlets that are grown into new plants of the invention. The tissue can also be grown from a cell of the invention.

    [0063] The invention further relates to a method for the production of a plant comprising the gene of the invention, which plant is resistant to Albugo candida, by using tissue culture or by using vegetative propagation.

    [0064] The invention moreover relates to progeny of a plant, a cell, a tissue, or a seed of the invention, which progeny comprises the gene of the invention. Such progeny can in itself be a plant, a cell, a tissue, or a seed. The progeny can in particular be progeny of a plant of the invention, representative seeds of which were deposited under NCIMB number 43737. As used herein, progeny comprises the first and all further descendants from a cross with a plant of the invention, wherein a cross comprises a cross with itself or a cross with another plant, and wherein a descendant that is determined to be progeny comprises the gene of the invention. Descendants can be obtained through selfing and/or further crossing of the deposit. Progeny also encompasses material that is obtained by vegetative propagation or another form of multiplication.

    [0065] The invention further relates to the germplasm of plants of the invention. The germplasm is constituted by all inherited characteristics of an organism and according to the invention encompasses at least the resistance trait of the invention. The germplasm can be used in a breeding program for the development of plants that show resistance to Albugo candida. The use of germplasm that comprises the gene of the invention in breeding is also part of the present invention.

    [0066] The invention also relates to the use of the gene of the invention for producing a plant that is resistant to Albugo candida. The plant is preferably a plant that belongs to the Brassicaceae plant family, in particular a Raphanus sativus L. plant.

    [0067] The current invention also relates to the use of a plant of the invention as a crop, as a source of seed or as a source of propagation material.

    [0068] The invention further provides a marker for identifying a Raphanus sativus plant comprising the gene of the invention. Herein referred to as marker of the invention. Preferably, the marker of the invention detects a Thymine (T) on position 2240 of SEQ ID No. 2, or said marker detects a polymorphism, in particular a Thymine (T), on a corresponding position of a homologous sequence that has in order of increased preference at least 70%, 75%, 80%, 83%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity to SEQ ID No. 2. More preferably, the marker of the invention is a nucleic acid molecule comprising a nucleotide sequence according to SEQ ID No. 4, as shown in Table 1. Most preferably, the marker of the invention is a nucleic acid molecule comprising a nucleotide sequence according to SEQ ID No. 5 as shown in Table 1. The wild type alleles that have been investigated in the research that led to the present invention all have Cytosine (C) on position 2240 of SEQ ID No. 2. This SNP can be detected with a marker comprising a nucleotide sequence according to SEQ ID No. 6 as shown in Table 1.

    [0069] The use of the marker of the invention for identification of gene of the invention is also part of this invention.

    [0070] The present invention further relates to a method for identifying a plant resistant to Albugo candida, wherein the method comprises the following steps: [0071] a) detecting in the genome of a plant the gene of the invention, and/or [0072] b) detecting a unique polymorphism in the gene of the invention, and optionally [0073] c) testing of the plant comprising the gene of the invention for exhibiting resistance to Albugo candida.

    [0074] In one embodiment, the unique polymorphism that is detected is the Thymine (T) on position 2240 of SEQ ID No. 2, preferably this is done using the marker of the invention having SEQ ID No. 5.

    [0075] The invention further relates to a method for seed production comprising growing a plant from a seed of the invention that comprises the gene of the invention homozygously, allowing the plant to produce seed and harvesting the seed. Production of the seed is suitably done by selfing or by crossing with another plant that is optionally also a plant of the invention. The plant grown from the seed produced as described herein is resistant to Albugo candida.

    [0076] The invention also relates to a method for producing hybrid seed, comprising crossing a first parent plant with a second parent plant and harvesting the resultant hybrid seed, wherein the first parent plant and/or the second parent plant is a plant of the invention comprising the gene of the invention. Preferably, at least one of the parent plants comprises the gene of the invention homozygously.

    [0077] The invention also relates to the hybrid seed produced by the method described herein and a hybrid plant grown from said hybrid seed.

    [0078] Transgenic techniques used for transferring nucleotide sequences between plants that are sexually incompatible can also be used to produce a plant of the invention, by transferring the gene of the invention from one species to another. Techniques that can suitably be used comprise general plant transformation techniques known to the skilled person, such as the use of an Agrobacterium-mediated transformation method. A plant of the deposit or a descendant thereof is a suitable source of the modified gene.

    [0079] Introduction of the gene of the invention can also be done through introgression from a plant comprising said gene, for example from a plant, representative seed of which was deposited as NCIMB 43737, or from progeny thereof, or from another plant that is resistant to Albugo candida and in which the gene of the invention was identified. Breeding methods such as crossing and selection, backcrossing, recombinant selection, or other breeding methods that result in the transfer of a genetic sequence from a resistant plant to a susceptible plant can be used. A resistant plant can be of the same species or of a different and/or wild species. Difficulties in crossing between species can be overcome through techniques known in the art such as embryo rescue, or cis-genesis can be applied. Progeny of a deposit can be sexual or vegetative descendants of that deposit, which can be selfed and/or crossed, and can be of an F1, F2, or further generation as long as the descendants of the deposit still comprise the modified gene the invention as present in seed of that deposit. A plant produced by such method is also a part of the invention.

    [0080] The invention also relates to a method for the production of a plant exhibiting resistance against Albugo candida, comprising the steps of: [0081] a) crossing a first parent plant comprising the gene of the invention with a second parent plant to obtain an F1 population; [0082] b) optionally performing one or more rounds of selfing and/or crossing with a plant from the F1 population to obtain a further generation; [0083] c) selecting from the further generation a plant that comprises the gene as a resistant plant.

    [0084] The invention also relates to a method for the production of a plant which is resistant to Albugo candida, said method comprising: [0085] a) crossing a first parent plant comprising the gene of the invention with a second parent plant not comprising the gene of the invention; [0086] b) backcrossing the plant resulting from step a) with the second parent plant for at least three generations; [0087] c) selecting from the third or higher backcross population a plant that comprises at least the gene of the invention of the first parent plant of step a) as the plant which is resistant to Albugo candida.

    [0088] The invention additionally provides for a method of introducing another desired trait into a plant that is resistant to Albugo candida, comprising: [0089] a) crossing a plant comprising the gene of the invention with a second plant that comprises the other desired trait to produce F1 progeny; [0090] b) optionally selecting in the F1 for a plant that comprises the resistance and the other desired trait; [0091] c) crossing the optionally selected F1 progeny with one of the parents for at least three generations, to produce backcross progeny; [0092] d) selecting backcross progeny comprising the resistance and the other desired trait; and [0093] e) optionally repeating steps c) and d) one or more times in succession to produce selected fourth or higher backcross progeny that comprises the resistance and the other desired trait.

    [0094] Optionally, selfing steps are performed after any of the crossing or backcrossing steps in above-described methods. Selection of a plant comprising the Albugo candida resistance and the other desired trait can alternatively be done following any crossing or selfing step of the method. The other desired trait can be selected from, but is not limited to, the following group: resistance to bacterial, fungal or viral diseases, insect or pest resistance, improved germination, plant size, plant type, improved shelf-life, water stress and heat stress tolerance, and male sterility. The invention includes a plant produced by this method and a swollen hypocotyl obtained therefrom.

    [0095] Although the present invention and its advantages have been described in detail, it should be understood that various changes, substitutions and alterations can be made herein without departing from the spirit and scope of the invention as defined in the appended claims.

    Sequence Information

    [0096]

    TABLE-US-00001 TABLE1 Sequences. ID# Description Sequence SEQIDNo.1 Genomic TCAATCGCCAATCCCTTCTTTTCCTTAAAATTATCTAGCTCC TCTCTCTCGATCTCTATGGCTCTCTCATTAGCTTCTTCTTCT TCCTCTTCTCGCACTTGGGTGTACGATGTTTTCCCGAGCTT CAGTGGGGCAGACGTCCGTGTTACTTTCCTCAGCCACTTTC GAAAGGAGCTTGACCGGAAACTGATCATTTCTTTCAAAGA CAACGAGATAGAGAGAAGCCGGTCACTGGATCCAGAGCTT AAACAAGCCATAAGAGATTCGAGGATCGCCGTGGTTATCT TCTCTGAAAACTACGCATCTTCAAGCTGGTGTCTAAATGAG TTGCTGGAGATCGTCAAGTGCAGGGATGAGTGTGGTCAAA TGGTGATACCTGTTTTCTACCGTTTGGATCCTTCCCATGTC AGGAAACAAACTGATGACTTTGGACAGATCTTTGAAAAAA CATGCCACAACGAAACGGAGGAGGTGAAAATGCAATGGA GGAGAGCTTTGACAAATGTAGCTAATATCACCGGATTCCA TTCTGTAAACTGGTACGGTTTTATGAAACCTTCATTCTTGA ATAAAGATTGTTACATGTGTATGAATTTATGTTTCTCATTG CTAGATTGTGAAATTATTTTTCTTGTTGATAGGGGTAACGA AGCAAAAATGATTGAAGAAATTGTCAGTGATGTTTTGGAG AAACTACTTTTAACTCCATCGAAGGATTCTGAGAACTTTGT GGGCATCGAAGGTCATATCGCAGATCTGAGTGTATTGCTG GAGTTGGAATTAGAGGAAGTGAGGATGGTTGGTTTATGGG GTGCTTCAGGGATTGGCAAGACTACAATTGCAAGAGTTCT GTTCAACCGACTTTCTCGACACTTTCAAGGTAGCATTTTCA TTGACAGGGCTTTCATATCTAAGAGTACTGAAGTTTTCAGC AGAGCTAATCCGGGCGACTACAGCATGATGTTGCATTTGC AATCGAGATTCCTATCGAAAATTCTAGGGAAAAATGACAT AGAGATAAGTCAATTAGGCGAGTTAGCAGGGAGGCTGAA GCACCATAAAGTTCTTATTTTCATTGATGATTTCAACGACC AAGTGGTGCTAGATTCCTTGGTTGGTCAAACTCAATGGTTT GGAAGTGGGAGCAGAATCGTTGTGGTTACAAATGATAAGC ATCATTTACGATCCCATGGGATTGATCACATTTACGAGGTT TGTCTCCCATCTCAAAAGCTAGCTGTTGAGATGTTTTGTCG ATCTGCTTTCAACGAAAACTCTCCACCTGAAGGTTTTGAGG TGCTTGTAGCTGAAATTACAAGACTTGCGGGTAGTCTTCCT TTAGGTCTTAGTGTTTTGGGTTCATCTCTACGGGGGAGGGA TAAAGAGTACTGGGTAGATTTGTTGCCAACGCTTCAGACT GGTATAGATGGGAAAATCGAGAGAACATTGAAAGTCAGCT ACGAAGGATTAAGTAGCAAAGGAGATAAAACGCTATTTCG ACATATCGCATGCCTTTTCAATGGTGAAAAAGTCACATAC CTAAAGTTGTTGCTCGCAGATAGTGACTTGAGTGTTAATGT TGGGATGGAAAACCTAGCTGATAAGTCCCTCATTCATGTA AGTCCGTGGGGTCATGTGGAGATGCACCGTTTGCTACAAG AGATGGGTAGAAGTATTGTTCGTCTTGACGAGCCTGGGAC ACGAGAATTTCTTATGGACTCACAAGATATATGTGATGTA CTCAGTGATGGCACTGTAAGTTATCTCATATATTCGTGCTC ATCTCATTCATTACGTACTCAGTATATAAGATTTAGAGCAT GCCATTTTTATTAGCAGAACGAATAGTTAGCATCTGTTAAG TTTTTTTTTTTGTTTATATTTCTTATTGATATTATATAATTTT CAGGGGACTCAAAAGATATTAGGTATATCACTGGACACCG ATGAGATTGATGAGTTGCATATACATGAGAACGCCTTCAC AGGGATGCGTAATCTCCGTTTCCTAAAATTTTACTCGAGAT ATGGAGTTGGCACAGTGAAATTGCACATACCCAAAAGCTT CGACTATTTGCCGCTTAAACTGAAATCATTGTGTTGGCCGA GATATCCAATGAGATGTCTTCCTTCTACATTTCGTCCTGAA AACCTCACCGAGCTTAAAATGCAGGGTAGCAAGCTCGAGA AGCTGTGGGAAGGGGTTGTGGTAAGTTTTGAGAAGAATTG TTATGTTATTAGTAGTGAGAGTATAATCCTTGTTTTATATTT CTGGATGACAATCATGTTCTAATCATGAGCCTCTGTTTTGT TGAGTACAGTCGCTTCCATGTCTCAAGAAGATGGATTTGA GTTTTTCTCACAACCTGATAGAAATGCCAGATCTTTCAAAG GCCACCAATCTGGAGACACTTGATCTTGACGATTGCTATA GTTTGGTGAAGCTTCCTTCCTCTATCCCACATCCCAACAAA CTGATGAGATTGCACCTGATGAATTGTCAAAATCTGGAGA TTATTCCAATTGGCATTAGCCTCAAATCTCTCGAAGAGCTA TATCTCGATGGATGCTCACGGTTGAGGAATTTTCCTCAAAT CTTAACCAACATCGAAACGATCAATATAGACGAAACACGC ATTGAAGAAATCCCTTCAAATTTGCATCTGGAGGATGGGC GTCTCAGGGAACTCAGTATGCAAAACGCAAAGAGTAAAA AACCATGGGAAAGGGTGAAGGTATGTAGTTCCAAACTTTA CGCTTTATCCAACCTTTTTGTTTCCTAAAGTTATTCAGCTAT AGTTAGCATATTAGTTTTGGATCGAACACAATTGTCGTTGC TAGGTCGATCGAATTTTGTATAGACGTGTTTATCACCACGG TATTAGCGTTTTGCTTCAATAGTAAGGATAAATACATTTAA TTATTCTCACACTTTGTAGTAGTTAATCATTGTGGCAAGAC ATTAACTAGCGTTTTTGTAGTTAGATTTGATTTCTAGACAC TAATAAATAACAATTTAGATCATATACTAATTTGCTACTGC AAACCCCTAAGGGGCAAAAACCCAAGGTTTGGTAACTGAA GATGATATTTGTATAATTTTTTTTTCAGCCGCTTATTCTACT CACGGCGATCATGTCTCCACCTTTGAAGTATTTGTATCTAT CGGATATGCCAACCTTGGTGGAGCTCCCTTCTTCATTTCAG AATCTCCATCAACTGACGCATTTGGAAATTACGGACTGCA TAAATCTGGAGACTCTTCCCACCGGAATCAACCTCCGTTCT CTCGATGATCTCTATCTCAATGGATGCTCAAGGTTGAGTAC TTTTCCTGATATCTCAACCAACATCAAAGTCCTCAGCCTAA TCGCAACAGCCATTGAAGATGTTCCTGGGTCAGTTGATAA ATTCTCTGTGCTTGAAGAGCTAAGGATGGAAAGATGCATA AATCTGAAGATTCTTCCCTCTGGTATCAACCTCGCATCCCT CAAATTCTTAGGTTTCAGTGGATGCCCACAGTTGAGTACTT TTCCAGATATCTCTACCAACATTGAAGTGCTCTATCTAAAC GAAACAGCCATTGAAGAGGTTCCTTGTTGGGTTGAGAAAT TCACCAGGCTTGGAGTCTTGGAGATGAAGGGATGCAATAA ATTAAAATTTGTAAGCTTAAACATTTCTAAACTCAAACGTC TTGGGAGAGTTGAGTTATCAGACTGCTTAAACTTGGATCA AGAAGCTCTGAAAACATATTCAGATTGTCTACTGAAGTTG TCAAGTGAAGAAGTGCCTTCATATTTCATTCACCGTACTAC GGTAACCTCCTCCTTCTCCTCTTTAACCGTCCCTCTACTTCC CAGCTCTCTCTCGCAGCCATTCCTCCAATTCACGGCTTGCC TTGTGCATACTTGGGACAATATGTCAGAAATTGATGCTATG CCTAGTTTTACAAACAGATTTTGGAACAGCTCTGATTCCTA TGTTCAGGAACAAGACTTCTACGGAACATGTACGAGTGAT AGGCATATGTTAACATTGGTCTATTATATCTTTCTAAGCAG AGATAGGGATATCCTAGCTCAAATGAACTACACGCATGTC GATGTGCAGCTTGATATTAAGAATCGTAGTCCCTCTGAGTT CAAAGAGTGGGGTATACGACTAGACTCAGGCCCGGCCCTG TACTAAAACTGGTAAAGCAATAGCTTTAGGCGCCACAGAT AACATATATTTACAGGGCGCCAAATGTACGTAGAGTCACT TTGCCTTGGTGGTTTGGCTGCTGTTGTTTTGTAGCAAGGTG ATGAGTTCGACACCTCCTCCCTTTAATATTTTTTTGTTTTTC TTTTGGAAATTAGTAATAAAGATTTGGCCTCAACGATTTGG TTTCCTTTTCTAAACAAATTTAATTATTTTATTACAAAATTA CATAGATGATATTTTATTAATAAATTGTTTATCTAGGTAAA TTTTAATTATTCTAAAATAAAGTATTTTTTATTGGTTCTCCA CTTCTCCC SEQIDNo.2 CDS ATGGCTCTCTCATTAGCTTCTTCTTCTTCCTCTTCTCGCACT TGGGTGTACGATGTTTTCCCGAGCTTCAGTGGGGCAGACG TCCGTGTTACTTTCCTCAGCCACTTTCGAAAGGAGCTTGAC CGGAAACTGATCATTTCTTTCAAAGACAACGAGATAGAGA GAAGCCGGTCACTGGATCCAGAGCTTAAACAAGCCATAAG AGATTCGAGGATCGCCGTGGTTATCTTCTCTGAAAACTACG CATCTTCAAGCTGGTGTCTAAATGAGTTGCTGGAGATCGTC AAGTGCAGGGATGAGTGTGGTCAAATGGTGATACCTGTTT TCTACCGTTTGGATCCTTCCCATGTCAGGAAACAAACTGAT GACTTTGGACAGATCTTTGAAAAAACATGCCACAACGAAA CGGAGGAGGTGAAAATGCAATGGAGGAGAGCTTTGACAA ATGTAGCTAATATCACCGGATTCCATTCTGTAAACTGGGGT AACGAAGCAAAAATGATTGAAGAAATTGTCAGTGATGTTT TGGAGAAACTACTTTTAACTCCATCGAAGGATTCTGAGAA CTTTGTGGGCATCGAAGGTCATATCGCAGATCTGAGTGTAT TGCTGGAGTTGGAATTAGAGGAAGTGAGGATGGTTGGTTT ATGGGGTGCTTCAGGGATTGGCAAGACTACAATTGCAAGA GTTCTGTTCAACCGACTTTCTCGACACTTTCAAGGTAGCAT TTTCATTGACAGGGCTTTCATATCTAAGAGTACTGAAGTTT TCAGCAGAGCTAATCCGGGCGACTACAGCATGATGTTGCA TTTGCAATCGAGATTCCTATCGAAAATTCTAGGGAAAAAT GACATAGAGATAAGTCAATTAGGCGAGTTAGCAGGGAGG CTGAAGCACCATAAAGTTCTTATTTTCATTGATGATTTCAA CGACCAAGTGGTGCTAGATTCCTTGGTTGGTCAAACTCAAT GGTTTGGAAGTGGGAGCAGAATCGTTGTGGTTACAAATGA TAAGCATCATTTACGATCCCATGGGATTGATCACATTTACG AGGTTTGTCTCCCATCTCAAAAGCTAGCTGTTGAGATGTTT TGTCGATCTGCTTTCAACGAAAACTCTCCACCTGAAGGTTT TGAGGTGCTTGTAGCTGAAATTACAAGACTTGCGGGTAGT CTTCCTTTAGGTCTTAGTGTTTTGGGTTCATCTCTACGGGG GAGGGATAAAGAGTACTGGGTAGATTTGTTGCCAACGCTT CAGACTGGTATAGATGGGAAAATCGAGAGAACATTGAAA GTCAGCTACGAAGGATTAAGTAGCAAAGGAGATAAAACG CTATTTCGACATATCGCATGCCTTTTCAATGGTGAAAAAGT CACATACCTAAAGTTGTTGCTCGCAGATAGTGACTTGAGT GTTAATGTTGGGATGGAAAACCTAGCTGATAAGTCCCTCA TTCATGTAAGTCCGTGGGGTCATGTGGAGATGCACCGTTTG CTACAAGAGATGGGTAGAAGTATTGTTCGTCTTGACGAGC CTGGGACACGAGAATTTCTTATGGACTCACAAGATATATG TGATGTACTCAGTGATGGCACTGGGACTCAAAAGATATTA GGTATATCACTGGACACCGATGAGATTGATGAGTTGCATA TACATGAGAACGCCTTCACAGGGATGCGTAATCTCCGTTTC CTAAAATTTTACTCGAGATATGGAGTTGGCACAGTGAAAT TGCACATACCCAAAAGCTTCGACTATTTGCCGCTTAAACTG AAATCATTGTGTTGGCCGAGATATCCAATGAGATGTCTTCC TTCTACATTTCGTCCTGAAAACCTCACCGAGCTTAAAATGC AGGGTAGCAAGCTCGAGAAGCTGTGGGAAGGGGTTGTGTC GCTTCCATGTCTCAAGAAGATGGATTTGAGTTTTTCTCACA ACCTGATAGAAATGCCAGATCTTTCAAAGGCCACCAATCT GGAGACACTTGATCTTGACGATTGCTATAGTTTGGTGAAG CTTCCTTCCTCTATCCCACATCCCAACAAACTGATGAGATT GCACCTGATGAATTGTCAAAATCTGGAGATTATTCCAATTG GCATTAGCCTCAAATCTCTCGAAGAGCTATATCTCGATGG ATGCTCACGGTTGAGGAATTTTCCTCAAATCTTAACCAACA TCGAAACGATCAATATAGACGAAACACGCATTGAAGAAAT CCCTTCAAATTTGCATCTGGAGGATGGGCGTCTCAGGGAA CTCAGTATGCAAAACGCAAAGAGTAAAAAACCATGGGAA AGGGTGAAGCCGCTTATTCTACTCACGGCGATCATGTCTCC ACCTTTGAAGTATTTGTATCTATCGGATATGCCAACCTTGG TGGAGCTCCCTTCTTCATTTCAGAATCTCCATCAACTGACG CATTTGGAAATTACGGACTGCATAAATCTGGAGACTCTTCC CACCGGAATCAACCTCCGTTCTCTCGATGATCTCTATCTCA ATGGATGCTCAAGGTTGAGTACTTTTCCTGATATCTCAACC AACATCAAAGTCCTCAGCCTAATCGCAACAGCCATTGAAG ATGTTCCTGGGTCAGTTGATAAATTCTCTGTGCTTGAAGAG CTAAGGATGGAAAGATGCATAAATCTGAAGATTCTTCCCT CTGGTATCAACCTCGCATCCCTCAAATTCTTAGGTTTCAGT GGATGCCCACAGTTGAGTACTTTTCCAGATATCTCTACCAA CATTGAAGTGCTCTATCTAAACGAAACAGCCATTGAAGAG GTTCCTTGTTGGGTTGAGAAATTCACCAGGCTTGGAGTCTT GGAGATGAAGGGATGCAATAAATTAAAATTTGTAAGCTTA AACATTTCTAAACTCAAACGTCTTGGGAGAGTTGAGTTATC AGACTGCTTAAACTTGGATCAAGAAGCTCTGAAAACATAT TCAGATTGTCTACTGAAGTTGTCAAGTGAAGAAGTGCCTTC ATATTTCATTCACCGTACTACGGTAACCTCCTCCTTCTCCTC TTTAACCGTCCCTCTACTTCCCAGCTCTCTCTCGCAGCCATT CCTCCAATTCACGGCTTGCCTTGTGCATACTTGGGACAATA TGTCAGAAATTGATGCTATGCCTAGTTTTACAAACAGATTT TGGAACAGCTCTGATTCCTATGTTCAGGAACAAGACTTCTA CGGAACATGTACGAGTGATAGGCATATGTTAACATTGGTC TATTATATCTTTCTAAGCAGAGATAGGGATATCCTAGCTCA AATGAACTACACGCATGTCGATGTGCAGCTTGATATTAAG AATCGTAGTCCCTCTGAGTTCAAAGAGTGGGGTATACGAC TAGACTCAGGCCCGGCCCTGTAC SEQIDNo.3 Aminoacid MALSLASSSSSSRTWVYDVFPSFSGADVRVTFLSHFRKELDR sequence KLIISFKDNEIERSRSLDPELKQAIRDSRIAVVIFSENYASSSWC LNELLEIVKCRDECGQMVIPVFYRLDPSHVRKQTDDFGQIFEK TCHNETEEVKMQWRRALTNVANITGFHSVNWGNEAKMIEEI VSDVLEKLLLTPSKDSENFVGIEGHIADLSVLLELELEEVRMV GLWGASGIGKTTIARVLFNRLSRHFQGSIFIDRAFISKSTEVFS RANPGDYSMMLHLQSRFLSKILGKNDIEISQLGELAGRLKHH KVLIFIDDFNDQVVLDSLVGQTQWFGSGSRIVVVTNDKHHLR SHGIDHIYEVCLPSQKLAVEMFCRSAFNENSPPEGFEVLVAEI TRLAGSLPLGLSVLGSSLRGRDKEYWVDLLPTLQTGIDGKIER TLKVSYEGLSSKGDKTLFRHIACLENGEKVTYLKLLLADSDL SVNVGMENLADKSLIHVSPWGHVEMHRLLQEMGRSIVRLDE PGTREFLMDSQDICDVLSDGTGTQKILGISLDTDEIDELHIHEN AFTGMRNLRFLKFYSRYGVGTVKLHIPKSFDYLPLKLKSLCW PRYPMRCLPSTFRPENLTELKMQGSKLEKLWEGVVSLPCLKK MDLSFSHNLIEMPDLSKATNLETLDLDDCYSLVKLPSSIPHPN KLMRLHLMNCONLEIIPIGISLKSLEELYLDGCSRLRNFPQILT NIETINIDETRIEEIPSNLHLEDGRLRELSMQNAKSKKPWERVK PLILLTAIMSPPLKYLYLSDMPTLVELPSSFQNLHQLTHLEITD CINLETLPTGINLRSLDDLYLNGCSRLSTFPDISTNIKVLSLIAT AIEDVPGSVDKFSVLEELRMERCINLKILPSGINLASLKFLGFS GCPQLSTFPDISTNIEVLYLNETAIEEVPCWVEKFTRLGVLEM KGCNKLKFVSLNISKLKRLGRVELSDCLNLDQEALKTYSDCL LKLSSEEVPSYFIHRTTVTSSFSSLTVPLLPSSLSQPFLQFTACL VHTWDNMSEIDAMPSFTNRFWNSSDSYVQEQDFYGTCTSDR HMLTLVYYIFLSRDRDILAQMNYTHVDVQLDIKNRSPSEFKE WGIRLDSGPALY SEQIDNo.4 AATTTGCATCTGGAGGATGGG SEQIDNo.5 marker YATAGACGAAACACGCATTGAAGAAATCCYTTCAAATTTG CATCTGGAGGATGGGCGTCTCAGGGAACTCASTATGCAAA AY SEQIDNo.6 marker YATAGACGAAACACGCATTGAAGAAATCCYTTCAAATTTG CATCCGGAGGATGGGCGTCTCAGGGAACTCASTATGCAAA AY

    [0097] The present invention will be further illustrated in the following Examples which are given for illustration purposes only and are not intended to limit the invention in any way.

    EXAMPLES

    Example 1Albugo candida Bioassay

    [0098] In the process of identifying new sources of Albugo candida resistance, various sources of radish plants were screened in an Albugo candida bioassay. Next to the potential resistance sources two positive controls (line S 19.42074 and inbred line NIZ-AC2 of Nickerson/Hazera) and one negative control (variety Rudolf of Bejo) were included in the bioassay. The bioassay screened for three different isolates of Albugo candida separately. The first isolate was gathered in The Netherlands (Westland), the second isolate was gathered in Germany (Pfalz), and the third isolate was gathered in, Australia (Daylesford). Line S 19.42074 is resistant to isolate 1 and 3, while inbred line NIZ-AC2 is resistant to isolate 1 and 2. Young plants of each of the genotypes were inoculated with Albugo candida.

    [0099] All plants were raised in a greenhouse with a daytime/nighttime temperature regime of 15 C., with 14 hours Son-T light. Nine days after sowing the young plants were moved to a climate chamber with a daytime/nighttime temperature regime of 14 C./12 C., 14 hours TL lighting per day, and a relative humidity of 80%. Also, nine days after sowing the plants were inoculated using a suspension of Albugo candida spores (100,000 spores/ml). After spraying the inoculum, the plants were covered with plastic for one night. A final assessment of the inoculated plants was done 30 days post sowing by visual scoring for the Albugo candida symptoms, based on the scale described in Table 2.

    TABLE-US-00002 TABLE 2 Albugo Plant Disease Test Disease Score Albugo symptoms on plants 1 No signs of infection of Albugo candida. Resistant Plants are totally healthy and no pustules are visible. 2 Minor infection (single pustule or just a couple of Partial pustules) of Albugo candida. resistance 3 Strong infection, lobs and leaf covered with white Susceptible pustules of Albugo candida.

    [0100] The screen resulted in the identification of a source accession 970917 (internal denomination) that is resistant to all three isolates used in the bioassay. The positive controls plants (line S 19.42074 and inbred line NIZ-AC2, not comprising the gene of the invention) score, as expected, only resistant to two out of the three isolates, and the negative control (Variety Rudolf) is fully susceptible to all three isolates. The results are summarized in Table 3.

    TABLE-US-00003 TABLE 3 Resistant scores against different Albugo candida isolates Line/variety Isolate 1 (NL) Isolate 2 (D) Isolate 3(AU) Line 970917 R R R line S 19.42074 R S R inbred line NIZ- R R S AC2 Variety Rudolf S S S

    Example 2Identification of Candidate Gene

    [0101] In order to determine the underlying genetics of the observed resistance in accession 970917, a QTL mapping on an F2 population of a cross between a plant of accession 970917 and a plant of fully susceptible line 1081.C341 (internally developed proprietary line) was performed. The F2 population that was used for the QTL study contained 180 individuals. Each F2 plant was selfed and 30 F3 seeds from each selfing were sown for phenotyping with the three isolates as described in Example 1. A genetic map was constructed for which 166 polymorphic markers were used having a maximum spacing of 29 cM. On chromosome 6 one major QTL was detected with size of about 17.1 cM and 10.5 Mbp. The QTL had an explained variance of 78-90%.

    [0102] Further fine-mapping was done in order to reduce the size of the QTL. The first round of fine-mapping was performed on the F3 individuals. A second round of fine-mapping was performed on recombinants in the F4. The QTL region became significantly smaller, approx. 38.8 kbp. However, the introgression from accession 970917 deviated significantly from the reference genome which hampered further fine-mapping. Therefore, the genomes of the parents were de novo assembled to better compare the sequences between the susceptible parent and the resistant parent. High molecular weight DNA from the plants was sequenced using Oxford Nanopore Technologies, and assembled using Canu (Koren, S. et al. (2017): Canu: Scalable and accurate long-read assembly via adaptive x-mer weighting and repeat separation. Genome Res. 27, 722-736). The sequences were polished using Racon (Vaser, R., Sovi, I., Nagarajan, N. & iki, M. (2017): Fast and accurate de novo genome assembly from long uncorrected reads. Genome Res. 27, 737-746), Medaka (nanoporetech.github.io/medaka/), and finally Pilon (Walker, B. J. et al. Pilon (2014): An Integrated Tool for Comprehensive Microbial Variant Detection and Genome Assembly Improvement. PLoS One 9, e112963) using Illumina short reads from the same plant. Sequence comparison, structural annotation and confirmation with expression data led to the identification of the gene of invention.

    Example 3Introduction of the Gene of the Invention into a Susceptible Parent Line

    [0103] A plant of accession 970917 was crossed with 1081.C341. From the F2 three plants homozygous for the gene of the invention were selected and inbred to produce F3 seed. This seed was deposited with the NCIMB under deposit accession number NCIMB 43737.

    [0104] A seed of the same F3 population was crossed with a plant of a susceptible parent line. The introduction of the gene of the invention was done by backcrossing with the susceptible parent line. The gene of the invention was followed by using a marker based on nucleotide sequences SEQ ID No. 5 and 6. In SEQ ID No. 5 and No. 6, the SNP of interest is on position 45. Susceptible variants of the gene of the invention that were analyzed all had a cytosine on position 45, while the resistant form carries a thymine on position 45. This position in SEQ ID No. 5 and 6 corresponds to position 2240 of SEQ ID No. 2, the CDS of the gene of the invention.

    [0105] After four backcross-generations the gene of the invention was introgressed in the susceptible parent. Plants of this backcrossed line were subjected to the bioassay as described in Example 1. All plants of the backcrossed line scored fully resistant to all three isolates. The parent line can be combined with any other Raphanus sativus parent line to create a hybrid variety resistant to Albugo candida.

    [0106] The invention is further described by the following numbered paragraphs:

    [0107] 1. A gene encoding a protein which confers resistance to Albugo candida when expressed in a Raphanus sativus plant, wherein said gene comprises: [0108] a) a nucleotide sequence encoding a protein having an amino acid sequence, which has in order of increased preference at least 70%, 75%, 80%, 83%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 100% sequence similarity to SEQ ID No. 3; or [0109] b) a nucleotide sequence comprising a coding sequence which has in order of increased preference at least 70%, 75%, 80%, 83%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 100% sequence identity to SEQ ID No. 2; or [0110] c) a nucleotide sequence encoding at least the amino acid positions 15 to 192 of SEQ ID No. 3, the amino acid positions 209 to 432 of SEQ ID No. 3, and the amino acid positions 540 to 1023 of SEQ ID No. 3; or [0111] d) a nucleotide sequence encoding an LRR domain comprising the amino acid positions 540 to 1023 of SEQ ID No. 3 or encoding an LRR domain which has in order of increased preference at least 95%, 96%, 97%, 98%, 99%, 100% sequence similarity to the amino acid sequence of the amino acid positions 540 to 1023 of SEQ ID No. 3.

    [0112] 2. The gene of paragraph 1, wherein the gene comprises a thymine on position 2240 of SEQ ID No. 2 or a thymine on a corresponding position of a homologous sequence that has at least 70%, 75%, 80%, 83%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity to SEQ ID No. 2.

    [0113] 3. A protein encoded by the gene of paragraph 1 or 2.

    [0114] 4. Use of the gene of paragraphs 1 or 2 for producing a plant that is resistant against Albugo candida.

    [0115] 5. A marker for the identification of the gene of paragraphs 1 or 2, wherein the marker detects a thymine on position 2240 of SEQ ID No. 2, or wherein the marker detects a thymine on a corresponding position of a homologous sequence that has at least 70% sequence identity to SEQ ID No. 2.

    [0116] 6. The marker of paragraph 5, wherein the marker is a nucleic acid molecule comprising SEQ ID No. 4.

    [0117] 7. The marker of paragraph 5, wherein the marker is a nucleic acid molecule comprising SEQ ID No. 5.

    [0118] 8. Use of the marker of any one of paragraphs 5 to 7 for identification of a plant comprising the gene of the invention.

    [0119] 9. Method for identifying a plant resistant to Albugo candida, wherein the method comprises the following steps: [0120] a) detecting in the genome of a plant the gene of paragraphs 1 or 2, and/or [0121] b) detecting a unique polymorphism in the gene of paragraphs 1 or 2, and optionally [0122] c) testing of the plant comprising the gene of the invention for exhibiting resistance to Albugo candida.

    [0123] 10. The method of paragraph 9, wherein the detecting of the unique polymorphism is done with the marker of any one of paragraphs 5 to 7.

    [0124] 11. A plant, comprising the gene of paragraphs 1 or 2, wherein the plant is resistant to Albugo candida.

    [0125] 12. The plant of paragraph 11, wherein the plant is an agronomically elite plant, in particular a hybrid variety or an inbred line.

    [0126] 13. The plant of paragraph 11 or 12, wherein the plant belongs to the species Raphanus sativus.

    [0127] 14. A seed capable of growing into a plant of any one paragraphs 11-13.

    [0128] 15. Propagation material suitable for producing a plant of any one of paragraphs 11 to 13, wherein the propagation material is suitable for sexual reproduction, and is in particular selected from a microspore, pollen, ovary, ovule, embryo sac and egg cell, or is suitable for vegetative reproduction, and is in particular selected from a cutting, root, stem cell, and protoplast, or is suitable for tissue culture of regenerable cells or protoplasts, which regenerable cells or protoplasts are in particular selected from a leaf, pollen, embryo, cotyledon, hypocotyl, meristematic cell, root, root tip, anther, flower and stem, and wherein the propagation material comprises the gene of paragraph 1.

    [0129] 16. A method for selecting a plant resistant to Albugo candida, comprising identifying the presence of the gene of paragraph 1 or 2, optionally testing the plant for resistance against Albugo candida, and selecting a plant comprising said gene, wherein said plant exhibits resistance to Albugo candida.

    [0130] 17. A method for producing a Raphanus sativus plant exhibiting resistance against Albugo candida comprising the steps of: [0131] a) crossing a first parent plant comprising the gene of paragraph 1 or 2 with a second parent plant to obtain an F1 population; [0132] b) optionally performing one or more rounds of selfing and/or crossing with a plant from the F1 population to obtain a further generation population; [0133] c) selecting from the further generation population a plant that comprises the gene of paragraph 1 or 2 as a resistant plant.

    [0134] 18. A method for producing hybrid seed resistant to Albugo candida, comprising the steps of crossing a first parent plant with a second parent plant, wherein one or both parent plants are homozygous for the gene of paragraph 1 or 2 and harvesting the hybrid seed.

    [0135] 19. The hybrid seed produced by the method of paragraph 18.

    [0136] 20. A plant grown from the hybrid seed of paragraph 19.

    [0137] Having thus described in detail preferred embodiments of the present invention, it is to be understood that the invention defined by the above paragraphs is not to be limited to particular details set forth in the above description as many apparent variations thereof are possible without departing from the spirit or scope of the present invention.