Synthetic proteins and therapeutic uses thereof

12134662 ยท 2024-11-05

Assignee

Inventors

Cpc classification

International classification

Abstract

The present disclosure relates to compositions and methods for treating disease. More particularly, the disclosure relates to synthetic proteins and their use for treating cancer.

Claims

1. A synthetic protein, comprising: a synthetic Epidermal Growth Factor (sEGF) growth factor comprising at least one synthetic targeted signaling pathway (sTSP) domain of a human Epidermal Growth Factor (hEGF) TSP (hTSP) domain, wherein the at least one sTSP is 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence NTENDCPLSHEAYCLHDGVCMYIEALDKYACNCVVGYVGERCQFRDLRWWDAR (SEQ ID NO: 33), excluding the following amino acid changes: T2S, E3D, N4S, DSE, E11D, A12G, V38I, F44Y, R48K, F511, and A52L; at least one linker; and an immunogenic polypeptide, wherein the at least one linker includes a first linker that separates the sTSP from the immunogenic polypeptide.

2. The synthetic protein according to claim 1, wherein the immunogenic polypeptide comprises a cholera toxin B (CT-B) protein.

3. The synthetic protein according to claim 1, wherein the first linker is selected from the group consisting of SSG (SEQ ID NO: 13), GSSG (SEQ ID NO: 14), SSGGG (SEQ ID NO: 15), SGG (SEQ ID NO: 16), GGSGG (SEQ ID NO: 17), GGGGS (SEQ ID NO: 18), SSGGGSGG (SEQ ID NO: 19), SSGGGGSGGG (SEQ ID NO: 20), TSGGGSG (SEQ ID NO: 21), TSGGGGSGG (SEQ ID NO: 22), SSGGGSGGSSG (SEQ ID NO: 23), GGSGGTSGGGSG (SEQ ID NO: 24), SGGTSGGGGSGG (SEQ ID NO: 25), GGSGGTSGGGGSGG (SEQ ID NO: 26), SSGGGGSGGGSSG (SEQ ID NO: 27), SSGGGSGGSSGGG (SEQ ID NO: 28), SGGGGSGGGSSGGG (SEQ ID NO: 29) and GGSGGTSGGGGGSG (SEQ ID NO: 30).

4. The synthetic protein according to claim 3, wherein the first linker is GGSGGTSGGGGGSG (SEQ ID NO: 30).

5. The synthetic protein according to claim 1, wherein the synthetic growth factor comprises a first sTSP domain and a second sTSP domain.

6. The synthetic protein according to claim 5, wherein the at least one linker includes a second linker that separates the first sTSP domain and the second sTSP domain, and the first linker separates the second sTSP domain from the immunogenic polypeptide.

7. The synthetic protein according to claim 6, wherein the second linker is selected from the group consisting of SSG (SEQ ID NO: 13), GSSG (SEQ ID NO: 14), SSGGG (SEQ ID NO: 15), SGG (SEQ ID NO: 16), GGSGG (SEQ ID NO: 17), GGGGS (SEQ ID NO: 18), SSGGGSGG (SEQ ID NO: 19), SSGGGGSGGG (SEQ ID NO: 20), TSGGGSG (SEQ ID NO: 21), TSGGGGSGG (SEQ ID NO: 22), SSGGGSGGSSG (SEQ ID NO: 23), GGSGGTSGGGSG (SEQ ID NO: 24), SGGTSGGGGSGG (SEQ ID NO: 25), GGSGGTSGGGGSGG (SEQ ID NO: 26), SSGGGGSGGGSSG (SEQ ID NO: 27), SSGGGSGGSSGGG (SEQ ID NO: 28), and SSGGGGSGGGSSGGG (SEQ ID NO: 29).

8. The synthetic protein according to claim 6, wherein the second linker is GSSG (SEQ ID NO: 14).

9. The synthetic protein according to claim 1, wherein the synthetic protein has the amino acid sequence of SEQ ID NO:2.

10. An immunogenic composition, comprising the synthetic protein of claim 9 and one or more components selected from the group consisting of an adjuvant, a carrier, an excipient, a diluent, and combinations thereof.

11. An immunogenic composition, comprising the synthetic protein of claim 1 and one or more components selected from the group consisting of an adjuvant, a carrier, an excipient, a diluent, and combinations thereof.

12. The immunogenic composition according to claim 11, wherein the immunogenic polypeptide comprises a cholera toxin B (CT-B) protein.

13. The immunogenic composition according to claim 11, wherein the first linker is selected from the group consisting of SSG (SEQ ID NO: 13), GSSG (SEQ ID NO: 14), SSGGG (SEQ ID NO: 15), SGG (SEQ ID NO: 16), GGSGG (SEQ ID NO: 17), GGGGS (SEQ ID NO: 18), SSGGGSGG (SEQ ID NO: 19), SSGGGGSGGG (SEQ ID NO: 20), TSGGGSG (SEQ ID NO: 21), TSGGGGSGG (SEQ ID NO: 22), SSGGGSGGSSG (SEQ ID NO: 23), GGSGGTSGGGSG (SEQ ID NO: 24), SGGTSGGGGSGG (SEQ ID NO: 25), GGSGGTSGGGGSGG (SEQ ID NO: 26), SSGGGGSGGGSSG (SEQ ID NO: 27), SSGGGSGGSSGGG (SEQ ID NO: 28), SSGGGGSGGGSSGGG (SEQ ID NO: 29) and GGSGGTSGGGGGSG (SEQ ID NO: 30).

14. The immunogenic composition according to claim 13, wherein the first linker is GGSGGTSGGGGGSG (SEQ ID NO: 30).

15. The immunogenic composition according to claim 11, wherein the synthetic Epidermal Growth Factor (sEGF) growth factor comprises a first sTSP domain and a second sTSP domain.

16. The immunogenic composition according to claim 15, wherein the at least one linker includes a second linker that separates the first sTSP domain and the second sTSP domain, and the first linker separates the second sTSP domain from the immunogenic polypeptide.

17. The immunogenic composition according to claim 16, wherein the second linker is selected from the group consisting of SSG (SEQ ID NO: 13), GSSG (SEQ ID NO: 14), SSGGG (SEQ ID NO: 15), SGG (SEQ ID NO: 16), GGSGG (SEQ ID NO: 17), GGGGS (SEQ ID NO: 18), SSGGGSGG (SEQ ID NO: 19), SSGGGGSGGG (SEQ ID NO: 20), TSGGGSG (SEQ ID NO: 21), TSGGGGSGG (SEQ ID NO: 22), SSGGGSGGSSG (SEQ ID NO: 23), GGSGGTSGGGSG (SEQ ID NO: 24), SGGTSGGGGSGG (SEQ ID NO: 25), GGSGGTSGGGGSGG (SEQ ID NO: 26), SSGGGGSGGGSSG (SEQ ID NO: 27), SSGGGSGGSSGGG (SEQ ID NO: 28), and SSGGGGSGGGSSGGG (SEQ ID NO: 29).

18. The immunogenic composition according to claim 17, wherein the second linker is GSSG (SEQ ID NO: 14).

19. The immunogenic composition according to claim 11, wherein the synthetic protein has the amino acid sequence of SEQ ID NO:2.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) The following detailed description, given by way of example, but not intended to limit the disclosure solely to the specific embodiments described, may best be understood in conjunction with the accompanying drawings, in which:

(2) FIGS. 1A-1B depict domains and features for a synthetic protein according to an exemplary embodiment of the disclosure. FIG. 1A depicts the amino acid sequence of BVN22E (SEQ ID NO: 2), including Targeted Signaling Pathway (TSP) domains 1 & 2 shown in single underline, two linker sequences shown in double underline, and an Immunogenic Carrier Domain shown in dotted underline. FIG. 1B shows a Clustal Omega alignment of the synthetic Epidermal Growth Factor (sEGF) regions of BVN22E (SEQ ID NO: 33) aligned with the corresponding regions of human EGF (hEGF) (SEQ ID NO: 35);

(3) FIG. 2 shows a graph of the titration of purified IgG fraction from 5 rabbits immunized with BVN22E binding to immobilized recombinant human Epidermal Growth Factor (rhEGF) coated at a concentration of 1 g/ml according to an exemplary embodiment of the disclosure;

(4) FIG. 3 shows a graph depicting a comparison of pooled IgG fraction from 5 rabbits after immunization with either BVN22E or an equivalent protein containing 2 native Epidermal Growth Factor (EGF) domains according to an exemplary embodiment of the disclosure;

(5) FIGS. 4A-4B show Western blots illustrating the ability of BVN22E to stimulate phosphorylation. FIG. 4A shows a Western blot illustrating that BVN22E is able to stimulate phosphorylation of the Epidermal Growth Factor Receptor (EGFR) of A431 cells to the same extent as a similar molecule containing native human EGF domains, in a concentration-dependent manner. FIG. 4B shows the results of another assay without comparison with an EGF-based molecule;

(6) FIG. 5 depicts a Western blot showing purified pooled IgG from 5 rabbits immunized with BVN22E at two concentrations is able to neutralize EGFR-activation of A431 cells by 30 ng/ml rhEGF in a manner similar to a commercially available neutralizing monoclonal antibody;

(7) FIG. 6 depicts a Western blot showing that sera from all 5 rabbits immunized with BVN22E is able to neutralize EGFR-activation of A431 cells by 30 ng/ml rhEGF in a manner similar to a commercially available neutralizing monoclonal antibody;

(8) FIG. 7 depicts a Western blot showing that pooled sera from rabbits undergoing immunization with BVN22E is able to neutralize the EGFR signaling from 30 ng/ml rhEGF on A431 cells after just one boost injection (test bleed 1; lane 6) as effectively as a neutralizing monoclonal antibody. Sera from animals prior to immunization has no neutralizing activity (lane 5);

(9) FIG. 8 depicts as Western blot showing that neutralizing activity of IgG purified from sera of rabbits immunized against BVN22E is similar to that from animals immunized with a comparable molecule including only native EGF domains; and

(10) FIG. 9 depicts a Western blot showing inhibition of the EGF signaling pathway by pooled sera (n=10) derived from mice immunized with either BVN22E or an immunogen containing chemically conjugated native human EGF (hEGF). Lanes 4-6 demonstrate that BVN22E immunization generated greater EGF-neutralizing capacity than an immunogen based upon native hEGF.

(11) FIG. 10 shows a Coomassie stained SDS gel of a synthetic NRG-CTB molecule in which Un=native, D=heat denatured, R=reduced, RD=reduced and denatured.

(12) FIG. 11 shows an anti-NRG Western Blot of a synthetic NRG-CTB molecule in which Un=native, D=heat denatured, R=reduced, RD=reduced and denatured.

(13) FIG. 12 shows the results of an MCF-7 cell activation assay. The top panel shows activation (e.g., phosphorylation) of the ERB3 Receptor by rhNRG-1 (lane 2), the synthetic NRG-CTB molecule (Lane4), and the inhibition of both with a neutralizing antibody (Lanes 3 and 5), while the lower panel is a control for ERB3 receptor expression.

(14) FIGS. 13A-13C show a SDS gel of a synthetic TGF molecule. FIG. 13A shows a Coomassie stained SDS gel. FIG. 13B is a Western blot of the SDS gel in FIG. 13A, which has been stained with anti-TGF antibodies to show that the synthetic TGF molecule is recognized by two different neutralizing anti-TGF antibodies. FIG. 13C is a Western blot of the SDS gel in FIG. 13A, which is been stained with anti-EGF antibodies to show that two different anti-EGF antibodies do not recognize the synthetic TGF molecule.

(15) FIG. 14 depicts a Coomassie stained Blue-native gel showing that purification of a synthetic TGF molecule produces a single pentamer band.

(16) FIGS. 15A-15B show a Coomassie stained SDS gel and an anti-TGF Western blot, respectively, which show that the synthetic TGF molecule shows improved stability, remaining as a discrete pentamer band after more than three weeks at elevated temperatures (e.g., room temperature and 37 C.).

DETAILED DESCRIPTION OF THE DISCLOSURE

(17) The present disclosure is based, at least in part, on the discovery that synthetic proteins/molecules including one or more protein domains from a synthetic growth factor, one or more linker regions, and one or more immunogenic domains may be used as therapeutic molecules to treat a variety of diseases such as, for example, cancer. The synthetic molecules provide several unexpected advantages over the prior art. For example, unlike prior art human Epidermal Growth Factor (hEGF) molecules (e.g., U.S. Pat. No. 5,984,018 to Davila et al.) that are present in heterogeneous mixtures containing up to 12 different molecular species, the synthetic proteins/molecules described herein may be produced as a single molecule (e.g., a homogenous population of molecules). Additionally, the synthetic proteins/molecules described herein include ten active components per molecule (although the active components may be increased or decreased in multiples of 5, e.g., as part of a pentamer), whereas prior art hEGF molecules (e.g., U.S. Pat. No. 5,984,018 to Davila et al.) are highly variable in the number of active components present per molecule (e.g., the mean number of active components per molecule of Davila is 1.5). Moreover, the synthetic proteins/molecules described herein are much more straightforward to manufacture. For example, prior art hEGF molecules (e.g., U.S. Pat. No. 5,984,018) are made by chemically conjugating rP64k and recombinant human EGF (rhEGF) to produce a final molecule that consists of two molecules chemically conjugated to one another. This is in sharp contrast to the synthetic proteins/molecules described herein, which are a single synthetic molecule. Advantageously, the techniques herein provide novel synthetic proteins that may be used therapeutically to treat diseases such as, for example, cancer (e.g., cancer vaccines) with a higher immunogenic activity level than prior art methods (e.g., U.S. Pat. No. 5,984,018).

Overview

(18) Cancer immunology is the study of interactions between an immune system and cancer cells such as, for example, tumors or malignancies. The initiation of an immune response, such as recognition of cancer-specific antigens that are expressed by human tumors and not expressed in normal tissues, is of particular interest. Generally, methods to control the division and proliferation of the malignant cells have focused on isolating these antigens and presenting them so that they are recognized by the immune system as non-self antigens to induce a specific immune response.

(19) There are a significant number of growth factors identified at present, and most, if not all, have been shown to be important mediators of cell proliferation in various cancers in addition to being implicated in other disease conditions. Generally, growth factors are soluble serum proteins that recognize and bind to a group of growth factor receptors located on cell surfaces. Particular growth factors may be specific for a single receptor, or may bind to more than one closely related receptor with varying affinities. Similarly, some receptors bind to only a single growth factor ligand while others can bind to multiple related growth factors, again usually with differing affinities. Upon binding to its natural receptor, the cytoplasmic domain of the receptor is phosphorylated, and this initiates an intra-cellular signaling cascade that results in modulation of transcription of one or more genes and ultimately to progression through the cell cycle and cell proliferation.

(20) Growth factors and their receptors are essential components of the normal processes of growth, development and repair, and their tissue distribution profiles and expression levels closely regulate cell growth. Numerous studies have shown that growth factors can stimulate proliferation of a variety of cell types both in vitro and in vivo (Cohen S., Carpenter G., PNAS USA 72, 1317, 1975, Witsch E et al: Physiology: 25(2):85-101, (2010)). Moreover, certain growth factors have been shown to stimulate proliferation in some cancer cell lines. For example epidermal growth factor (EGF) can stimulate some non-small cell lung carcinoma cells (Osborne C. K. et al. Can Res. 40, 2. 361 (1980)). Other growth factors such as vascular endothelial growth factor (VEGF), fibroblast growth factor (FGF), and platelet-derived growth factor (PDGF) are important in several oncology diseases, such as non-small cell lung cancer (NSCLC) (Ballas M S, Chachoua A., Onco Targets and Therapy: 4, 43-58 (2011)), prostate cancer, (Cox M E et al; Prostate 69 (1):33-40 (2009)), and breast cancer (Law J et al, Cancer Res; 68, 24: 10238-10346 (2008)).

(21) High levels of various growth factor receptors have been reported in malignant tissues. For example, the epidermal growth factor receptor (EGFR) has been detected at unusually high levels in malignant tumors of epithelial origin, such as lung, breast, bladder, ovarian, vulva, colonic, pulmonary, brain and esophagus cancers. The role played by growth factors and their receptors in regulating tumor growth is unknown, but there are suggestions that growth factor receptor expression in tumor cells provides a mechanism for autocrine growth stimulation which leads to uncontrolled proliferation (Schlessinger J., Schreiber A. B., Levi A., Liberman T., Yarden Y. Crit. Rev. Biochem. 1983, 14 (2) 93-111). Further, Liao Y et al; Hum Pathol 36(11): 1186-1196 (2005) and Cox M E et al; Prostate: 69(1) 33-40 (2009) describe the role of increased Insular receptor and growth factor on metastatic prostate cancer.

(22) One treatment strategy to target growth factor signaling in cancer therapy has been to use a passive immunotherapy (e.g., monoclonal antibodies) against the particular receptor/receptors involved. Such studies have demonstrated that the specific recognition by an antibody of the receptor that is able to inhibit the binding of the ligand can have an inhibitory effect on the mitogenic stimulation of malignant cells (SATO J. D., et al. Methods in Enzymology, vol. 146 pp 63-81, 1987). However, antibodies that are of murine origin will usually produce a human anti-mouse antibody response (HAMA), thus limiting them to a single administration.

(23) Other treatment strategies have been to use an active immunotherapy with vaccines that contain the growth factor of interest to induce an immune response against the molecule to inhibit the proliferation effect of the growth factor on tumors. U.S. Pat. No. 5,984,018, to Davila et al, entitled Vaccine Composition Comprising Autologous Epidermal Growth Factor or a Fragment or a Derivative Thereof having Anti-tumor Activity and use Thereof in the Therapy of Malignant Diseases, discloses, for example, the use of a vaccine that contains a mixture of a growth factor and an immunogenic (i.e. non-human) carrier protein chemically conjugated together using glutaraldehyde. However, without being bound to any particular theory it is thought that chemical conjugation hinders immune responses against the vaccine.

(24) This is a technically challenging approach, as it requires that the host generates an immune response to a self antigen, and vertebrate immune systems have evolved to prevent such responses from occurring. Where a strong immune response is generated against a self-antigen, for example, one that includes T-helper cell activation, an auto-immune disease state usually results. For many years it has been hypothesized that some auto-immune disorders, for example, lupus, multiple sclerosis (MS), diabetes etc., might be caused by early exposure to an environmental agent that includes immunogenic epitopes (T-cell epitopes) that closely mimic host self-epitopes. This could lead to the stimulation of T-helper cells that are cross reactive with host epitopes. Subsequent exposure to the environmental agent could then result in an anti-self immune response (Albert, L. J., and Inman, R. D New England Journal of Medicine, December 30th pp 2,068-2074, 1999). It has since been demonstrated that a viral antigen can indeed generate an anti-self immune response against a nerve cell protein (Levin, M. C. et. al, Nature Medicine vol 8 (5) pp 509-513, 2002).

(25) U.S. Publ. No. 2006/0251654, to Casimiro et al, entitled Method for Treatment of Malignant and Infectious Chronic Diseases, (the '654 publication) discloses a method of treating a subject bearing a malignant or infectious chronic disease comprising the method of immunizing the subject with a vaccine containing a self-antigen associated with the malignant or infectious chronic disease that is coupled to a carrier protein; treating the subject with an immune modulator agent; and immunizing the subject again with the vaccine of the step 1, and an appropriate adjuvant selected from aluminum hydroxide and Montanide ISA 51 (Seppic, Paris, France). Unfortunately, the preparation of the vaccine by chemical conjugation is thought to hinder the immune response.

(26) The majority of the vaccines described above exhibit a number of limitations, arising primarily from the method of manufacture and the potential lack of uniformity and homology of the protein product. The vaccines described above generally comprise a mixture of a recombinant carrier protein and polypeptides of human origin that are chemically conjugated using glutaraldehyde. Unfortunately, this reactive reagent can undesirably form covalent cross-linking bonds between varieties of chemical groups, and generally leads to a highly heterogeneous product. Thus, the resulting vaccines may comprise not only carrier protein molecules with varying numbers of the target human polypeptide attached (for example, 0, 1, 2, 3 etc.), but the human polypeptides can each be attached to the carrier via different atoms and so in different positions and in different orientations. Furthermore, both the target polypeptide and carrier protein molecules may be conjugated to themselves, resulting in various homo-multimers that may have no clinical efficacy and may not contribute to an anti-cancer patient immune response.

(27) Synthetic Proteins/Molecules

(28) The present disclosure provides a homogeneous synthetic protein/molecule for improving the presentation of the maximum number of growth factor epitopes, tumor antigen epitopes, and/or receptor binding sites as elements of an immunogenic synthetic protein/molecule. In one illustrative embodiment, a synthetic protein/molecule expressing all or portions of an immunogenic carrier domain (e.g., cholera toxin B (CT-B)), and a synthetic epidermal growth factor (sEGF), a tumor antigen, and/or a receptor is described. In alternative illustrative embodiments, the protein may express other immunogenic synthetic or recombinant proteins/molecules that are modeled based upon known immunogenic proteins. It is contemplated within the scope of the disclosure that such synthetic proteins/molecules may express polypeptides that are highly immunogenic to the human immune system. Preferably, the synthetic proteins/molecules confer additional properties to the chimeric protein such as, for example, high expression yield and ease of manufacture, oral stability and the ability to cross from gut to blood stream, and/or previous safe use in humans.

(29) In an illustrative embodiment, the synthetic proteins/molecules disclosed herein may include or express a high proportion of a protein sequence derived from target self antigens, as a function of total molecular weight. This may be achieved, for example, by using a large protein model containing multiple growth factor epitopes. These growth factor epitopes may be multiple copies of whole or part of a single growth factor, or copies of whole or part of more than one different growth factor. These growth factor epitopes may be naturally occurring or synthetic (e.g., artificial). For example, BVN22E, an illustrative synthetic protein described herein, may have a molecular weight of about 120 kD. In an illustrative embodiment, the growth factor epitopes described herein may correspond to one or more domains within the growth factor (e.g., EGF targeted signaling pathway (TSP) domains). In an illustrative embodiment, an EGF domain may include the region which presents or constrains the -loop, e.g., the region defined by about cysteine 6 to about cysteine 42, the region defined by about cysteine 6 to about cysteine 31 or the region defined by about cysteine 22 about cysteine 33 or the region defined by about cysteine 22 about cysteine 31 or the region defined by about cysteine 62 about cysteine 14 of the synthetic protein sequence (e.g., FIG. 1A). Without being bound by any particular theory, it is contemplated within the scope of the disclosure that different regions or sub-regions between cysteine 6 and cysteine 42 may have beneficial effects when incorporated into the synthetic proteins/molecules of the disclosure. For example, the following regions may have beneficial effects: the region between cysteine 6 and cysteine 14, the region between cysteine 6 and cysteine 20, the region between cysteine 6 and cysteine 31, the region between cysteine 6 and cysteine 33, and the region between cysteine 6 and cysteine 42. It is also contemplated within scope of the disclosure that the reverse progressive sequence may also be beneficial. For example, the following regions may have beneficial effects: the region between cysteine 42 and cysteine 33, the region between cysteine 42 and cysteine 31, the region between cysteine 42 and cysteine 20, the region between cysteine 42 and cysteine 14, and the region between cysteine 42 and cysteine 6. It is further contemplated within the scope of the invention that specific intervals within the region between cysteine 6 and cysteine 42 may provide beneficial effects when incorporated into the synthetic proteins/molecules of the disclosure (e.g., the region between cysteine 6 and cysteine 14, the region between cysteine 14 and cysteine 20, the region between cysteine 20 and cysteine 31, and the region between cysteine 33 and cysteine 42).

(30) According to the disclosure, the expressions of the growth factor epitopes should be folded allowing their natural conformation to be substantially retained and presented to components of the host immune system in such a way as to elicit a robust host immune response to said epitopes. Examples of suitable natural protein models to model an epitope supporting domain of a synthetic proteins/molecules include, but are not limited to, cholera toxin B sub-unit, E. coli heat-labile LT and LT-II enterotoxin B subunits, veratoxin, pertussis toxin, C. jejuni enterotoxin, Shiga toxin, listeria toxin, tetanus toxoid, diphtheria toxoid, N. meningitidis outer membrane protein, bacteriophage coat protein, adenovirus and other viral coat proteins. Alternatively, a non-self component of the protein can be small. At a minimum, the non-self sequence(s) should comprise about 9, 10, 11 or more amino acids in length, and include either entirely or in-part at least one human T-cell epitope. As described herein, non-natural synthetic polypeptides (e.g., BVN22E) may be used that fulfill the requirements of conferring immunogenicity to the whole protein and allowing appropriate presentation of growth factors, receptors, tumor antigens or epitopes thereof to the host immune system.

(31) According to the disclosure, the synthetic proteins/molecules provided herein-whether growth factors or parts thereof, cellular receptors or parts thereof, or tumor antigens or parts thereofare related to a broad range of cellular pathways involved in chronic disease, growth factor based or receptor based cancers, and/or solid tumors for use as tumor antigens within the said synthetic proteins. The proteins are in the form of a synthetic proteins/molecules and may be useful in treating chronic diseases, for example, breast, lung, bladder, ovarian, vulva, colonic, pulmonary, brain, colorectal, intestinal, head and neck, and esophagus cancers. As different tumor antigens can be expressed and multiple cellular receptors and growth factors over expressed in the said diseases, the proteins described hereunder can contain one or more different tumor antigens, one or more different receptors or growth factors of one or multiple cellular pathways associated with the disease. These proteins are called multivalent.

(32) In an illustrative embodiment, a protein comprised of a homogeneous synthetic proteins/molecules expressing one or more epidermal growth factor (EGF) neutralizing domains (e.g., TSP domains) is disclosed. The protein may be in the form of a synthetic proteins/molecules and may be useful in treating chronic diseases, for example, breast, lung, bladder, ovarian, vulva, colonic, pulmonary, brain, colorectal, head and neck, and esophagus cancers. In an illustrative embodiment, the protein is a synthetic proteins/molecules expressing or including synthetic EGF sequences and CT-B sequences, as shown in FIG. 1A. In an illustrative embodiment, a growth factor component of the synthetic protein sequence may include a sequence that is less than 80% identical to EGF. For example, a growth factor component may include an EGF sequence with 11 amino acid substitutions that may increase the immunogenicity of the growth factor portion of the synthetic protein sequence. Without being bound by theory, it is believed that the region of EGF that presents or constrains the -loop (e.g., the region defined by Cys6 to Cys31) may be an important to include in the synthetic protein and amenable to target for amino acid modification. In an illustrative embodiment, regions outside of Cys6 to Cys31 may also be targeted for modification (e.g., E11 and A12).

(33) In an illustrative embodiment, the TSP1 and TSP2 domains of hEGF may be modified as shown in FIG. 1B to create synthetic EGF (sEGF) regions to be included in a synthetic protein/molecule herein.

(34) In an illustrative embodiment, the synthetic proteins/molecules disclosed herein may include all, or a portion of, growth factors including without limitation grow factors such as, for example, Neuregulin 1 (NRG1), Transforming Growth Factor (TGF), Vascular endothelial growth factor (VEGF), and the like.

(35) In other illustrative embodiments, the synthetic proteins/molecules described herein may include one or more linkers or spacers. One or more of the embodiments described above include sEGF fused to CT-B such that the sEGF portion of the synthetic molecule is separated from the CT-B portion by a GGSGGTSGGGGGSG linker. These resulting recombinant or chimeric proteins essentially included sEGF fused directly to CT-B. In other illustrative embodiments, the EGF and CT-B components of the chimeric protein are effectively separated by 3 to 14 amino acids, which form a flexible spacer or linker between the two domains. It is contemplated within the scope of the disclosure that the linker may be 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, or 14 amino acids in length. In some cases in which a growth factor has a larger size (e.g., human growth factor), it may be useful to use a longer linker sequence. The following exemplary linkers may be used and include, but are not limited to, the following: SSG (SEQ ID NO: 13), GSSG (SEQ ID NO: 14), SSGGG (SEQ ID NO: 15), SGG (SEQ ID NO: 16), GGSGG (SEQ ID NO: 17), GGGGS (SEQ ID NO: 18), SSGGGSGG (SEQ ID NO: 19), SSGGGGSGGG (SEQ ID NO: 20), TSGGGSG (SEQ ID NO: 21), TSGGGGSGG (SEQ ID NO: 22), SSGGGSGGSSG (SEQ ID NO: 23), GGSGGTSGGGSG (SEQ ID NO: 24), SGGTSGGGGSGG (SEQ ID NO: 25), GGSGGTSGGGGSGG (SEQ ID NO: 26), SSGGGGSGGGSSG (SEQ ID NO: 27), SSGGGSGGSSGGG (SEQ ID NO: 28), and SSGGGGSGGGSSGGG (SEQ ID NO: 29). One of skill in the art will appreciate that there are many other sequences/combinations of primarily G and S that would also serve as useful linker sequences.

(36) Without being bound by any particular theory, it is contemplated that the synthetic proteins/molecules disclosed herein provide significant clinical benefits. For example, the synthetic proteins/molecules disclosed herein may be expressed in bacterial systems at commercial scale and purity, while producing stable polypeptides that fold correctly and are functional. Additionally, the synthetic proteins/molecules disclosed herein are able to form a pentamers. Additionally, the synthetic proteins/molecules disclosed herein have the advantageous property of requiring much lower levels of protein for vaccination because the amount of carrier necessary significantly lower than prior art methods (e.g., U.S. Pat. No. 5,984,018 to Davila et al.). In this regard, the synthetic proteins/molecules disclosed herein are able to deliver more growth factor to a patient in a significantly lower volume of vaccine.

(37) Adjuvant

(38) Certain illustrative embodiments as provided herein include synthetic proteins/molecules according to the disclosure within vaccine compositions and immunological adjuvant compositions, including pharmaceutical compositions, that contain, in addition to synthetic proteins/molecules at least one adjuvant, which refers to a component of such compositions that has adjuvant activity. An adjuvant having such adjuvant activity includes a composition that, when administered to a subject such as a human (e.g., a human patient), a non-human primate, a mammal or another higher eukaryotic organism having a recognized immune system, is capable of altering (i.e., increasing or decreasing in a statistically significant manner, and in certain preferred embodiments, enhancing or increasing) the potency and/or longevity of an immune response. In certain illustrative embodiments disclosed herein a desired antigen and or antigens contain within a protein carrier, and optionally one or more adjuvants, may so alter, e.g., elicit or enhance, an immune response that is directed against the desired antigen and or antigens which may be administered at the same time or may be separated in time and/or space (e.g., at a different anatomic site) in its administration, but certain illustrative embodiments are not intended to be so limited and thus also contemplate administration of synthetic proteins/molecules in a composition that does not include a specified antigen but which may also include but is not limited to one or more co-adjuvant, an imidazoquinline immune response modifier.

(39) Accordingly and as noted above, adjuvants include compositions that have adjuvant effects, such as saponins and saponin mimetics, including QS21 and QS21 mimetics (see, e.g., U.S. Pat. No. 5,057,540; EP 0 362 279 B1; WO 95/17210), alum, plant alkaloids such as tomatine, detergents such as (but not limited to) saponin, polysorbate 80, Span 85 and stearyl tyrosine, one or more cytokines (e.g., GM-CSF, IL-2, IL-7, IL-12, TNF-alpha, IFN-gamma), an imidazoquinoline immune response modifier, and a double stem loop immune modifier (dSLIM, e.g., Weeratna et al, 2005 Vaccine 23:5263).

(40) Detergents including saponins are taught in, e.g., U.S. Pat. No. 6,544,518; Lacaille-Dubois, M and Wagner H. (1996 Phytomedicine 2:363-386), U.S. Pat. No. 5,057,540, Kensil, Crit. Rev Ther Drug Carrier Syst, 1996, 12 (1-2): 1-55, and EP 0 362 279 B1. Particulate structures, termed Immune Stimulating Complexes (ISCOMS), comprising fractions of Quil A (saponin) are hemolytic and have been used in the manufacture of vaccines (Morein, B., EP 0 109 942 B 1). These structures have been reported to have adjuvant activity (EP 0 109 942 B 1; WO 96/1 1711). The hemolytic saponins QS21 and QS17 (HPLC purified fractions of Quil A) have been described as potent systemic adjuvants, and the method of their production is disclosed in U.S. Pat. No. 5,057,540 and EP 0 362 279 B1. Also described in these references is the use of QS7 (a non-hemolytic fraction of Quil-A) which acts as a potent adjuvant for systemic vaccines. Use of QS21 is further described in Kensil et al. (1991. J. Immunology 146:431-437). Combinations of QS21 and polysorbate or cyclodextrin are also known (WO 99/10008). Particulate adjuvant systems comprising fractions of QuilA, such as QS21 and QS7 are described in WO 96/33739 and WO 96/1 1711. Other saponins which have been used in systemic vaccination studies include those derived from other plant species such as Gypsophila and Saponaria (Bomford et al, Vaccine, 10(9):572-577, 1992). Escin is another detergent related to the saponins for use in the adjuvant compositions of the embodiments herein disclosed. Escin is described in the Merck index (12.sup.th Ed. entry 3737) as a mixture of saponin occurring in the seed of the horse chestnut tree, Aesculus hippocastanum. Its isolation is described by chromatography and purification (Fiedler, Arzneimittel-Forsch. 4, 213 (1953)), and by ion-exchange resins (Erbring et al, U.S. Pat. No. 3,238,190). Fractions of escin (also known as aescin) have been purified and shown to be biologically active (Yoshikawa M, et al. (Chem Pharm Bull (Tokyo) 1996 August; 44(8): 1454-1464)). Digitonin is another detergent, also being described in the Merck index (12th Ed., entry 3204) as a saponin, being derived from the seeds of Digitalis purpurea and purified according to the procedure described by Gisvold et al, J. Am. Pharm. Assoc., 1934, 23, 664; and Rubenstroth-Bauer, Physiol. Chem., 1955, 301, 621.

(41) Other adjuvants or co-adjuvants for use according to certain herein disclosed embodiments include a block co-polymer or biodegradable polymer, which refers to a class of polymeric compounds with which those in the relevant art will be familiar. Examples of a block co-polymer or biodegradable polymer that may be included in a vaccine composition or a immunological adjuvant include Pluronic L121 (BASF Corp., Mount Olive, N.J.; see, e.g., Yeh et al, 1996 Pharm. Res. 13: 1693).

(42) Certain further illustrative embodiments contemplate immunological adjuvants that include but are not limited to an oil, which in some such embodiments may contribute co-adjuvant activity and in other such embodiments may additionally or alternatively provide a pharmaceutically acceptable carrier or excipient. Any number of suitable oils are known and may be selected for inclusion in vaccine compositions and immunological adjuvant compositions based on the present disclosure. Examples of such oils, by way of illustration and not limitation, include squalene, squalane, mineral oil, olive oil, cholesterol, and a mannide monooleate.

(43) Immune response modifiers such as imidazoquinoline immune response modifiers are also known in the art and may also be included as adjuvants or co-adjuvants in certain presently disclosed embodiments.

(44) As also noted above, one type of adjuvant or co-adjuvant for use in a vaccine composition according to the disclosure as described herein may be the aluminum co-adjuvants, which are generally referred to as alum. Alum co-adjuvants are based on the following: aluminum oxy-hydroxide; aluminum hydroxyphosphoate; or various proprietary salts. Alum co-adjuvants are be advantageous because they have a good safety record, augment antibody responses, stabilize antigens, and are relatively simple for large-scale production. (Edelman 2002 Mol. Biotechnol. 21: 129-148; Edelman, R. 1980 Rev. Infect. Dis. 2:370-383.)

(45) Pharmaceutical Compositions

(46) In certain illustrative embodiments, the pharmaceutical composition is a vaccine composition that comprises both the synthetic proteins/molecules according to the disclosure and may further comprise one or more components, as provided herein, that are selected from TLR agonist, co-adjuvant (including, e.g., a cytokine, an imidazoquinoline immune response modifier and/or a dSLIM) and the like and/or a recombinant expression construct, in combination with a pharmaceutically acceptable carrier, excipient or diluent.

(47) Illustrative carriers will be nontoxic to recipients at the dosages and concentrations employed. For vaccines comprising synthetic proteins/molecules, about 0.01 g/kg to about 100 mg/kg body weight will be administered, typically by the intradermal, subcutaneous, intramuscular or intravenous route, or by other routes.

(48) It will be evident to those skilled in the art that the number and frequency of administration will be dependent upon the response of the host. Pharmaceutically acceptable carriers for therapeutic use are well known in the pharmaceutical art, and are described, for example, in Remington's Pharmaceutical Sciences, Mack Publishing Co. (A. R. Gennaro edit. 1985). For example, sterile saline and phosphate-buffered saline at physiological pH may be used. Preservatives, stabilizers, dyes and even flavoring agents may be provided in the pharmaceutical composition. For example, sodium benzoate, ascorbic acid and esters of p-hydroxybenzoic acid may be added as preservatives. In addition, antioxidants and suspending agents may be used.

(49) The pharmaceutical compositions may be in any form which allows for the composition to be administered to a patient. For example, the composition may be in the form of a solid, liquid or gas (aerosol). Typical routes of administration include, without limitation, oral, topical, parenteral (e.g., sublingually or buccally), sublingual, rectal, vaginal, and intranasal (e.g., as a spray). The term parenteral as used herein includes iontophoretic sonophoretic, passive transdermal, microneedle administration and also subcutaneous injections, intravenous, intramuscular, intrasternal, intracavernous, intrathecal, intrameatal, intraurethral injection or infusion techniques. In a particular embodiment, a composition as described herein (including vaccine and pharmaceutical compositions) is administered intradermally by a technique selected from iontophoresis, microcavitation, sonophoresis or microneedles.

(50) The pharmaceutical composition is formulated so as to allow the active ingredients contained therein to be bioavailable upon administration of the composition to a patient. Compositions that will be administered to a patient take the form of one or more dosage units, where for example, a tablet may be a single dosage unit, and a container of one or more compounds of the invention in aerosol form may hold a plurality of dosage units.

(51) For oral administration, an excipient and/or binder may be present. Examples are sucrose, kaolin, glycerin, starch dextrins, sodium alginate, carboxymethylcellulose and ethyl cellulose. Coloring and/or flavoring agents may be present. A coating shell may be employed.

(52) The composition may be in the form of a liquid, e.g., an elixir, syrup, solution, emulsion or suspension. The liquid may be for oral administration or for delivery by injection, as two examples. When intended for oral administration, preferred compositions contain one or more of a sweetening agent, preservatives, dye/colorant and flavor enhancer. In a composition intended to be administered by injection, one or more of a surfactant, preservative, wetting agent, dispersing agent, suspending agent, buffer, stabilizer and isotonic agent may be included.

(53) A liquid pharmaceutical composition as used herein, whether in the form of a solution, suspension or other like form, may include one or more of the following carriers or excipients: sterile diluents such as water for injection, saline solution, preferably physiological saline, Ringer's solution, isotonic sodium chloride, fixed oils such as squalene, squalane, mineral oil, a mannide monooleate, cholesterol, and/or synthetic mono or digylcerides which may serve as the solvent or suspending medium, polyethylene glycols, glycerin, propylene glycol or other solvents; antibacterial agents such as benzyl alcohol or methyl paraben; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid; buffers such as acetates, citrates or phosphates and agents for the adjustment of tonicity such as sodium chloride or dextrose. The parenteral preparation can be enclosed in ampoules, disposable syringes or multiple dose vials made of glass or plastic. An injectable pharmaceutical composition is preferably sterile.

(54) In a particular embodiment, a pharmaceutical or vaccine composition of the invention comprises a stable aqueous suspension of less than 0.2 um and further comprises at least one component selected from the group consisting of phospholipids, fatty acids, surfactants, detergents, saponins, fluorodated lipids, and the like.

(55) It may also be desirable to include other components in a vaccine or pharmaceutical composition, such as delivery vehicles including but not limited to aluminum salts, water-in-oil emulsions, biodegradable oil vehicles, oil-in-water emulsions, biodegradable microcapsules, and liposomes. Examples of additional immunostimulatory substances (co-adjuvants) for use in such vehicles are also described above and may include N-acetylmuramyl-L-alanine-D-isoglutamine (MDP), glucan, IL-12, GM-CSF, gamma interferon and IL-12.

(56) While any suitable carrier known to those of ordinary skill in the art may be employed in the pharmaceutical compositions of this invention, the type of carrier will vary depending on the mode of administration and whether a sustained release is desired. For parenteral administration, such as subcutaneous injection, the carrier preferably comprises water, saline, alcohol, a fat, a wax or a buffer. For oral administration, any of the above carriers or a solid carrier, such as mannitol, lactose, starch, magnesium stearate, sodium saccharine, talcum, cellulose, glucose, sucrose, and magnesium carbonate, may be employed. Biodegradable microspheres (e.g., polylactic galactide) may also be employed as carriers for the pharmaceutical compositions of this invention.

(57) Pharmaceutical compositions may also contain diluents such as buffers, antioxidants such as ascorbic acid, low molecular weight (less than about 10 residues) polypeptides, proteins, amino acids, carbohydrates including glucose, sucrose or dextrins, chelating agents such as EDTA, glutathione and other stabilizers and excipients. Neutral buffered saline or saline mixed with nonspecific serum albumin are exemplary appropriate diluents. Preferably, product may be formulated as a lyophilizate using appropriate excipient solutions (e.g., sucrose) as diluents.

(58) In an illustrative embodiment, the epitope or receptor supporting domain of the synthetic protein/molecule, whether derived from a natural or synthetic polypeptide sequence, should have the capacity to self-assemble into oligomeric multimers under appropriate chemical/environmental conditions, or to be reduced to monomers under alternative conditions. Ideally, multimerisation domains will assemble into stable multimers with a discreet number of sub-units, for example dimers, trimers, tetramers, pentamers, etc., such that a product of homogeneous size is generated. Examples of natural polypeptides include, but are not limited to, leucine zippers, lac repressor protein, streptavidin/avidin, cholera toxin B sub-unit, Pseudomonas trimerization domain, and viral capsid proteins.

(59) In an illustrative embodiment, a process of preparing a multivalent molecule is disclosed. In this illustrative embodiment, the process includes assembling multimers from monomeric sub-units to form a synthetic protein including one or more tumor antigens, receptors, and/or a growth factors or parts thereof.

(60) In another illustrative embodiment, a process of preparing a vaccine formulation is disclosed. In this illustrative embodiment, the process includes mixing one or more single monovalent multimers together preparing a multivalent vaccine including a synthetic protein/molecule including one or more tumor antigens, receptors, and/or a growth factors or parts thereof.

(61) In yet another illustrative embodiment, a process for treating a patient is disclosed. In this illustrative embodiment, the process includes administering separately to the patient one or more monovalent, one tumor antigen, receptor, and/or growth factor, recombinant proteins in a same day or at alternate days or times during a vaccination period.

(62) While the synthetic protein/molecule is described as including or expressing one or more of all or a portion of at least one sequence of the tumor antigens, the growth factors, and/or the receptors, and the CT-B sequence, the synthetic protein/molecule may include the natural CT-B sequence or a sequence substantially similar to the natural CT-B sequence and/or a synthetic sequence. While the synthetic protein/molecule is described as including or expressing the CT-B sequence, the synthetic protein/molecule may include or express a derivation of the CT-B sequence or a sequence that is substantially similar to the CT-B sequence.

(63) While the homogeneous synthetic proteins/molecules expressing or incorporating one or more tumor antigens, synthetic growth factors, and/or receptors have been described and illustrated in connection with certain embodiments, many variations and modifications will be evident to those skilled in the art and may be made without departing from the spirit and scope of the disclosure. The disclosure is thus not to be limited to the precise details of methodology or construction set forth above as such variations and modification are intended to be included within the scope of the disclosure.

EXAMPLES

(64) The present disclosure is further illustrated by the following examples, which should not be construed as limiting. The contents of all references, GenBank Accession and Gene numbers, and published patents and patent applications cited throughout the application are hereby incorporated by reference. Those skilled in the art will recognize that the disclosure may be practiced with variations on the disclosed structures, materials, compositions and methods, and such variations are regarded as within the scope of the disclosure.

Example 1: BVN22E Immunization Protocol

(65) BVN22E was expressed in the cytoplasm of 500 milliliters (ml) BL21 pLys6 cells as inclusion bodies using standard protocols. Exclusion bodies were isolated by centrifugation, washed, and solubilized in 10 ml 8M Urea 2 mM DTT. One milliliter of the protein solution was re-folded by drop-wise dilution into 100 ml 50 mM Tris-HCl buffer 2 M Urea, 1 mM DTT pH 7.4 containing a redox buffer (GSH/GSSG) over a period of 1 hour. The protein was stored at 4 C. to allow folding to continue.

(66) The largely folded protein was buffer-exchanged into 50 mM Trsi-HCl pH 8.0 by dialysis, and then purified by ion exchange chromatography (IEX) on a Hitrap HP Q column. The fraction equating to eluted BVN22E was isolated by step wise elution, and further purified on a Sephadex 75 size exclusion column to separate the pentameric protein from other oligomeric states. This was then further purified to remove endotoxin using standard methodologies.

(67) The protein was immunized into rabbits (n=5) at 100 g/injection in Freund's complete (prime injection only) or Freund's incomplete (boost injections) using the following schedule:

(68) TABLE-US-00013 Day 0 Pre-bleed Day 0 Immunization Week 4 Boost 1 Week 6 Test bleed 1 Week 8 Boost 2 Week 9 Test bleed 2 Week 12 Boost 3 Week 13 Final bleed

(69) Sera from individual rabbits was purified by standard caprylic acid precipitation to isolate the IgG fraction, and purified antibodies were either pooled or assayed individually.

Example 2: Binding ELISA Assay

(70) Plates were coated for 1 hour at room temperature with 100 l rhEGF at 1 g/ml, washed 3 with PBS, and blocked with 200 l/well 2% BSA for 2 hours. Plates were washed as described, and 200 l/well of purified IgG was added to the first well. One hundred microliters from the first wells was pipetted into 100 l PBS in adjacent wells, and serial 2-fold dilutions were made across the plate. The plates were incubated at room temperature for 1 hour and washed as before. HRP-labeled anti-rabbit secondary antibody was added as prescribed and incubated for 1 hour at room temperature before washing with PBS-tween. One hundred microliters/well TMB substrate was added, and incubated until color developed. Reactions were stopped with 50 l 1 M H.sub.2SO.sub.4 and plates read at 450 nm.

(71) As shown in FIG. 2, titration of purified IgG fraction from each of the five immunized rabbits in the rhEGF binding assay was approximately consistent across the 1,000-1,000,000 fold serial dilution range, indicating a strong immune response to BVN22E in each of the immunized rabbits.

(72) To test the specificity and sensitivity of the BVN22E immune response, the purified IgG fractions from each of the five rabbits were pooled and compared in the rhEGF binding assay to purified IgG fractions from a pool of five that has been immunized with an equivalent protein containing two native EGF domains (lower sequence in FIG. 1B).

Example 3: A431 EGFR Phosphorylation (EGF Signaling) Assay

(73) A431 cells were cultured to 50% confluence in T75 culture flasks under standard conditions in DMEM supplemented with 10% FBS. Cells were washed by pipetting-off the media and adding 10 ml of pre-warmed PBS. This was then removed and 2 ml of Trypsin was added. The flask was incubated for 20 minutes (or longer if required) to allow cells to detach from the flask. Ten milliliters of fresh DMEM was added to the flask, and the cells were then transferred to a 50 ml Falcon tube. The cells were pelleted gently at 250g for 10 minutes, the supernatant decanted to remove the trypsin, and the cells were then resuspended in 10 ml of fresh DMEM.

(74) Two hundred microliters cells were pipetted into each well of 96-well plate, which was then incubated overnight to allow the cells to adhere to the plate. The next day all wells were washed once with PBS, and fresh serum-free media was added. The plates were then incubated for another day/overnight to enable a basal level of EGF-R phosphorylation to become established.

(75) To assay the cells, the media was removed, and one of the following was added: i) 100 l fresh serum-free media (basal EGF-R activation); ii) 100 l SFM+rhEGF @ 30 ng/ml (EGF-R activation control); iii) 100 l SFM+control (neutralizing) antibody at desired concentration (5 g/ml); or iv) 100 l SFM+sample antibody at desired concentration+/rhEGF @ 30 ng/ml.

(76) For wells requiring rhEGF and antibody (control or sample), 500 l reaction was prepared in Eppendorf tubes and pre-incubated for 1 hour @ 37 C. One hundred microliters was then applied to A431 cells as above.

(77) In all assays, quadruplicate wells were prepared. The cells were incubated with the reaction media for 60 minutes at 37 C. in 5% CO.sub.2.

(78) After incubation time, media was removed by pipetting and 40 l lysis buffer (6M urea, 50 Mm TrisHCl pH7.9, 2% SDS, 5% Beta-mercaptoethanol) per well added. The plate was incubated for 10 minutes on the bench to lyse cells. Reactions from 4 replicate wells for each sample were pipetted up and down gently, scraping bottom of well to release all lysate, and transferred into a fresh Eppendorf tube. Twenty microliters loading dye was added to each tube, and tubes boiled for 10 minutes followed by centrifugation for 5 minutes top speed.

(79) Samples were either used for Western blots directly or stored at 4 C. until needed.

(80) Westerns blots were performed in duplicate, with one membrane being probed with rabbit anti-EGFR antibody (Abcam ab52894) to normalize receptor expression levels between samples, and the second with phosphorylated EGFR-specific rabbit antibody (Abcam ab32578) to assess receptor activation levels. They were both developed with HRP-labelled anti-rabbit antibody (Abcam ab97051).

(81) As shown in FIGS. 4A-4B, BVN22E is able to stimulate phosphorylation of EGFR in A431 cells. In particular, FIG. 4A shows a Western blot illustrating that BVN22E is able to stimulate phosphorylation of the EGFR of A431 cells to the same extent as a similar molecule containing native human EGF domains, and that this stimulation occurs in a concentration-dependent manner. FIG. 4B shows the results of a similar assay, but without comparison to an EGF-based molecule.

(82) Anti-BVN22E antibodies are able to neutralize EGFR-activation. As shown in FIG. 5, purified pooled IgG from 5 rabbits immunized with BVN22E at two concentrations is able to neutralize EGFR-activation of A431 cells by 30 ng/ml rhEGF in a manner similar to a commercially available neutralizing monoclonal antibody (e.g., R&D Systems monoclonal antibody 10825). FIG. 6 shows that individual sera from each of the 5 rabbits immunized with BVN22E is able to neutralize EGFR-activation of A431 cells by 30 ng/ml rhEGF in a manner similar to a commercially available neutralizing monoclonal antibody.

(83) Anti-BVN22E antibodies are able to neutralize EGFR-activation even after only one boost injection. For example, FIG. 7 shows that pooled sera from rabbits undergoing immunization with BVN22E was able to neutralize EGFR signaling from 30 ng/ml rhEGF on A431 cells after only one boost injection (test bleed 1) as effectively as a neutralizing monoclonal antibody (e.g., R&D Systems monoclonal antibody 10825). Sera from animals prior to immunization had no neutralizing activity (lane 5).

(84) Additionally, anti-BVN22E antibodies are quite effective at neutralizing EGFR-activation. For example, FIG. 8 shows that the neutralizing activity of anti-BVN22E IgG is similar to that of IgG purified from animals immunized with a comparable molecule including only native EGF domains and having the following sequence (SEQ ID NO: 31):

(85) TABLE-US-00014 NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWW ELRGSSGNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQ YRDLKWWELRGGSGGTSGGGGGSGTPQNITDLCAEYHNTQIHTLNDKIFS YTESLADKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAY LTEAKVEKLCVWNNKTPHAIAAISMAN.

Example 4: Comparison of Potency of BVN22E with Native hEGF-Based Immunogen

(86) BVN22E was expressed and purified as described in Example 1 above. Native EGF-based immunogen was prepared by chemically cross-linking rhEGF with an immunogenic bacterial protein of similar size to CTB pentamers.

(87) The proteins were immunized into mice (n=10) at 30 g/injection in Freund's complete (prime injection only) or Freund's incomplete (boost injection) using the following schedule:

(88) TABLE-US-00015 Day 0 Pre-bleed Day 0 Immunization Day 14 Bleed 2 Day 14 Boost Day 28 Bleed 3

(89) Sera from each group of 10 mice was pooled, and used at three different concentrations to assess the phosphorylation/inhibition of phosphorylation of A431 cells by rhEGF exactly as outlined in Example 3 above.

(90) FIG. 9 shows that the sera generated by both immunogens was able to elicit an immune response that included antibodies able to block the EGF signaling pathway. It can also be seen, when comparing lane 4 with 7, and lane 5 with 8, that the anti-BVN22E sera has a greater neutralizing activity than antisera to the native EGF containing immunogen.

Example 5: Stable Synthetic Neuregulin 1 can be Produced by Bacterial Expression Systems

(91) Neuregulin 1 (NRG1) based molecules have proven very difficult to produce and use. For example, it is very difficult to produce functional NRG1 in E. coli because such bacterially generated NRG1 is produced at very low yields, is undesirably glycosylated, and is unable to fold into a functionally active form. Additionally, bacterially produced NRG1 protein is not stable. For example, native wild type Neuregulin is naturally very unstable, and commercially purchased material has a shelf life of only one month at 80 C.

(92) NRG1 includes the following sequence (SEQ ID NO: 32):

(93) TABLE-US-00016 GTSHLVKcAEKEKTFcVNGGEcFMVKDLSNPSRYLcKcPNEFTGDRcQNY VMASF

(94) The equivalent portion of BVN22E includes the following sequence (SEQ ID NO: 33):

(95) TABLE-US-00017 NTENDcPLSHEAYcLHDGVcMYIEALDKYAcNcVVGYVGERcQFRDLRWW DAR

(96) To test whether portions of the BVN22E sequence could exert positive effects on the yield, stability, and function of the NRG1 polypeptide, regions of NRG1 between the cysteine residues (lowercase) were systematically replaced with the equivalent regions from the BVN22E polypeptide. Surprisingly, the portion of BVN22E located between the first and second cysteine (e.g., PLSHEAY) had a beneficial impact when incorporated into the analogous position with NRG1, while the regions between the remaining cysteine residues did not. This hybrid synthetic polypeptide sequence is referred to as the NRG-BVN hybrid polypeptide, and has the following sequence:

(97) TABLE-US-00018 NRG-BVNhybridpolypeptide (SEQIDNO:11) GTSHLVKcPLSHEAYcVNGGEcFMVKDLSNPSRYLcKcPNEFTGDRcQNY VMASF

(98) NRG-BVN hybrid polypeptide is able to be expressed in E. coli as a folded protein, and purified in a modified (but still very similar) version of the BVN22E purification process as a pentamer. The NRG-BVN sequence can also be expressed in a folded soluble form in an appropriate E. coli strain, albeit at lower yield.

(99) As shown in FIGS. 10 and 11, bands in a Western Blot reflect the ability of the anti-NRG antibody to recognize various states of protein.

(100) FIG. 12 shows a MCF-7 cell activation assay in which the top panel shows activation (e.g., phosphorylation) of the ERB3 Receptor by rhNRG-1 (lane 2), the synthetic NRG-CTB molecule (Lane4), and the inhibition of both with a neutralizing antibody (Lanes 3 and 5). The lower panel is a control for ERB3 receptor expression. This data shows that the synthetic NRG-BVN hybrid polypeptide shows significant stability (e.g., there was no visible degradation after >1 month). Additionally, the NRG-BVN hybrid polypeptide also does not bind to the EGFR (ERB1), the natural receptor for EGF.

Example 6: Stable Synthetic TGF can be Produced by Bacterial Expression Systems

(101) TGF-based molecules have also been problematic to produce in bacterial expression systems. For example, a main problem with TGF-based molecules is that while they can be expressed in bacterial systems to produce a folded protein, the resulting protein is also highly labile and subject to unfolding.

(102) To test whether portions of the BVN22E sequence could exert positive effects on the lability and function of a TGF-based polypeptide, regions of TGF between the cysteine residues were systematically replaced with the equivalent regions from the BVN22E polypeptide. Synthetic molecules were designed and made using computer modelling and known structural information to predict/identify important receptor-binding regions. In contrast to the NRG-BVN hybrid polypeptide, the synthetic TGF molecule contains only the TGF sequence found from cysteine 3 to 5 (e.g., RFLVQEDKPACV (SEQ ID NO: 34)). This region included the B-loop. This hybrid synthetic polypeptide sequence is referred to as the TGF hybrid polypeptide, and has the following sequence:

(103) TABLE-US-00019 TGFhybridpolypeptide (SEQIDNO:12) NTENDcPLSHEAYcLHDGVcRFLVQEDKPAcVcVVGYVGERcQFRDLRWW DAR

(104) As shown in FIGS. 13A-13C, the TGF hybrid polypeptide can be expressed, folded and purified in a very similar way to BVN22E. This figure shows an SDS gel of the synthetic TGF molecule (FIG. 13A) which is recognized by 2 different neutralizing anti-TGF antibodies (FIG. 13B) but not by either of two different anti-EGF antibodies (FIG. 13C)

(105) Additionally, the TGF hybrid polypeptide forms pentamers and some other oligomers that are removed during purification. As shown in FIG. 14, following purification a single pentamer band is visible on Blue-native gels.

(106) As shown in FIGS. 15A and 15B, the TGF hybrid polypeptide also shows improved stability, remaining as sharp pentamer after >3 weeks at elevated temperatures in an accelerated stability study.

INCORPORATION BY REFERENCE

(107) All documents cited or referenced herein and all documents cited or referenced in the herein cited documents, together with any manufacturer's instructions, descriptions, product specifications, and product sheets for any products mentioned herein or in any document incorporated by reference herein, are hereby incorporated by reference, and may be employed in the practice of the disclosure.

EQUIVALENTS

(108) It is understood that the detailed examples and embodiments described herein are given by way of example for illustrative purposes only, and are in no way considered to be limiting to the disclosure. Various modifications or changes in light thereof will be suggested to persons skilled in the art and are included within the spirit and purview of this application and are considered within the scope of the appended claims. Additional advantageous features and functionalities associated with the systems, methods, and processes of the present disclosure will be apparent from the appended claims. Moreover, those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the disclosure described herein. Such equivalents are intended to be encompassed by the following claims.