SMALL MOLECULE OXIDIZERS OF PDI AND THEIR USE
20180092908 ยท 2018-04-05
Inventors
Cpc classification
A61K31/424
HUMAN NECESSITIES
A61K31/424
HUMAN NECESSITIES
A61K31/5377
HUMAN NECESSITIES
A61P7/00
HUMAN NECESSITIES
A61K31/4439
HUMAN NECESSITIES
A61K31/496
HUMAN NECESSITIES
C07D401/06
CHEMISTRY; METALLURGY
C07D261/20
CHEMISTRY; METALLURGY
A61K31/5377
HUMAN NECESSITIES
A61K31/4439
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
A61K31/55
HUMAN NECESSITIES
A61K31/454
HUMAN NECESSITIES
A61K31/437
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
A61K45/06
HUMAN NECESSITIES
C07D513/12
CHEMISTRY; METALLURGY
A61K31/506
HUMAN NECESSITIES
A61K31/437
HUMAN NECESSITIES
A61K31/541
HUMAN NECESSITIES
C07D275/04
CHEMISTRY; METALLURGY
C07D417/12
CHEMISTRY; METALLURGY
A61P25/28
HUMAN NECESSITIES
A61K31/541
HUMAN NECESSITIES
C07D417/06
CHEMISTRY; METALLURGY
A61K31/496
HUMAN NECESSITIES
A61K31/506
HUMAN NECESSITIES
A61K31/454
HUMAN NECESSITIES
International classification
A61K31/496
HUMAN NECESSITIES
A61K31/5377
HUMAN NECESSITIES
C07D275/04
CHEMISTRY; METALLURGY
A61K31/541
HUMAN NECESSITIES
A61P25/28
HUMAN NECESSITIES
C07D261/20
CHEMISTRY; METALLURGY
C07D417/12
CHEMISTRY; METALLURGY
A61K31/454
HUMAN NECESSITIES
C07D417/06
CHEMISTRY; METALLURGY
A61K31/506
HUMAN NECESSITIES
A61P7/00
HUMAN NECESSITIES
Abstract
The present invention provides a method for treating or ameliorating the effects of a neurodegenerative disorder in a subject in need thereof. The method includes, for example, administering to the subject an effective amount of a compound selected from:
##STR00001## ##STR00002##
combinations thereof, or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof. The present invention also provides a method for treating or ameliorating the effects of a condition associated with increased protein disulfide isomerase (PDI) activity and a method of modulating PDI activity in a cell. The present invention also provides compounds, salts, compositions and kits useful for the provided methods.
Claims
1. A method for treating or ameliorating the effects of a neurodegenerative disorder in a subject in need thereof comprising administering to the subject an effective amount of a compound selected from the group consisting of: ##STR00201## ##STR00202## combinations thereof, or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
2. The method of claim 1, wherein the neurodegenerative disease is selected from the group consisting of Alzheimer's disease, Parkinson's disease, amyotrophic lateral sclerosis (ALS), Friedreich's ataxia, multiple sclerosis, Huntington's Disease, transmissible spongiform encephalopathy, Charcot-Marie-Tooth disease, dementia with Lewy bodies, corticobasal degeneration, progressive supranuclear palsy, and hereditary spastic paraparesis.
3. The method of claim 1, wherein the neurodegenerative disease is Huntington's Disease.
4. The method of claim 1, wherein the compound is ##STR00203## or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
5. The method of claim 1, wherein the subject is a mammal.
6. The method of claim 5, wherein the mammal is selected from the group consisting of humans, veterinary animals, and agricultural animals.
7. The method of claim 1, wherein the subject is a human.
8. The method of claim 1, further comprising co-administering to the subject an effective amount of one or more additional therapeutic agents.
9. The method of claim 8, wherein the one or more additional therapeutic agents are selected from the group consisting of 5-hydroxytryptophan, Activase, AFQ056 (Novartis), Aggrastat, Albendazole, alpha-lipoic acid/L-acetyl carnitine, Alteplase, Amantadine (Symmetrel), amlodipine, Ancrod, Apomorphine (Apokyn), Arimoclomol, Arixtra, Armodafinil, Ascorbic acid, Ascriptin, Aspirin, atenolol, Avonex, baclofen (Lioresal), Banzel, Benztropine (Cogentin), Betaseron, BGG492 (Novartis Corp.), Botulinum toxin, Bufferin, Carbatrol, Carbidopa/levodopa immediate-release (Sinemet), Carbidopa/levodopa oral disintegrating (Parcopa), Carbidopa/levodopa/Entacapone (Stalevo), CERE-110: Adeno-Associated Virus Delivery of NGF (Ceregene), cerebrolysin, CinnoVex, citalopram, citicoline, Clobazam, Clonazepam, Clopidogrel, clozapine (Clozaril), Coenzyme Q, Creatine, dabigatran, dalteparin, Dapsone, Davunetide, Deferiprone, Depakene, Depakote ER, Depakote, Desmoteplase, Diastat, Diazepam, Digoxin, Dilantin, Dimebon, dipyridamole, divalproex (Depakote), Donepezil (Aricept), EGb 761, Eldepryl, ELND002 (Elan Pharmaceuticals), Enalapril, enoxaparin, Entacapone (Comtan), epoetin alfa, Eptifibatide, Erythropoietin, Escitalopram, Eslicarbazepine acetate, Esmolol, Ethosuximide, Ethyl-EPA (Miraxion), Exenatide, Extavia, Ezogabine, Felbamate, Felbatol, Fingolimod (Gilenya), fluoxetine (Prozac), fondaparinux, Fragmin, Frisium, Gabapentin, Gabitril, Galantamine, Glatiramer (Copaxone), haloperidol (Haldol), Heparin, human chorionic gonadotropin (hCG), Idebenone, Inovelon, insulin, Interferon beta 1a, Interferon beta 1b, ioflupane 1231 (DATSCAN), IPX066 (Impax Laboratories Inc.), JNJ-26489112 (Johnson and Johnson), Keppra, Klonopin, Lacosamide, L-Alpha glycerylphosphorylcholine, Lamictal, Lamotrigine, Levetiracetam, liraglutide, Lisinopril, Lithium carbonate, Lopressor, Lorazepam, losartan, Lovenox, Lu AA24493, Luminal, LY450139 (Eli Lilly), Lyrica, Masitinib, Mecobalamin, Memantine, methylprednisolone, metoprolol tartrate, Minitran, Minocycline, mirtazapine, Mitoxantrone (Novantrone), Mysoline, Natalizumab (Tysabri), Neurontin, Niacinamide, Nitro-Bid, Nitro-Dur, nitroglycerin, Nitrolingual, Nitromist, Nitrostat, Nitro-Time, Norepinephrine (NOR), Carbamazepine, octreotide, Onfi, Oxcarbazepine, Oxybutinin chloride, PF-04360365 (Pfizer), Phenobarbital, Phenytek, Phenytoin, piclozotan, Pioglitazone, Plavix, Potiga, Pramipexole (Mirapex), pramlintide, Prednisone, Primidone, Prinivil, probenecid, Propranolol, PRX-00023 (EPIX Pharmaceuticals Inc.), PXT3003, Quinacrine, Ramelteon, Rasagiline (Azilect), Rebif, ReciGen, remacemide, Resveratrol, Retavase, reteplase, riluzole (Rilutek), Rivastigmine (Exelon), Ropinirole (Requip), Rotigotine (Neupro), Rufinamide, Sabril, safinamide (EMD Serono), Salagen, Sarafem, Selegiline (1-deprenyl, Eldepryl), SEN0014196 (Siena Biotech), sertraline (Zoloft), Simvastatin, Sodium Nitroprussiate (NPS), sodium phenylbutyrate, Stanback Headache Powder, Tacrine (Cognex), Tamoxifen, tauroursodeoxycholic acid (TUDCA), Tegretol, Tenecteplase, Tenormin, Tetrabenazine (Xenazine), THR-18 (Thrombotech Ltd.), Tiagabine, Tideglusib, tirofiban, tissue plasminogen activator (tPA), tizanidine (Zanaflex), TNKase, Tolcapone (Tasmar), Tolterodine, Topamax, Topiramate, Trihexyphenidyl (formerly Artane), Trileptal, ursodiol, Valproic Acid, valsartan, Varenicline (Pfizer), Vimpat, Vitamin E, Warfarin, Zarontin, Zestril, Zonegran, Zonisamide, Zydis selegiline HCL Oral disintegrating (Zelapar), and combinations thereof.
10. A method for treating or ameliorating the effects of a condition associated with increased protein disulfide isomerase (PDI) activity in a subject in need thereof comprising administering to the subject an effective amount of a compound selected from the group consisting of: ##STR00204## ##STR00205## combinations thereof, or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
11. The method of claim 10, wherein the compound is ##STR00206## or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
12. The method of claim 10, wherein the subject is a mammal.
13. The method of claim 12, wherein the mammal is selected from the group consisting of humans, veterinary animals, and agricultural animals.
14. The method of claim 10, wherein the subject is a human.
15. The method of claim 10, wherein the condition is selected from the group consisting of a protein folding disorder, cancer, HIV, and a blood clot.
16. A method of modulating PDI activity in a cell comprising contacting the cell with an effective amount of a compound selected from the group consisting of: ##STR00207## ##STR00208## combinations thereof, or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
17. The method of claim 16, wherein the compound is ##STR00209## or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
18. A method for treating or ameliorating the effects of a neurodegenerative disorder in a subject in need thereof comprising administering to the subject an effective amount of a compound selected from the group consisting of formula (I) ##STR00210## formula (II) ##STR00211## formula (III) ##STR00212## and formula (IV): ##STR00213## wherein a dashed line indicates the presence of an optional double bond, wherein W, X, Y and Z are independently selected from the group consisting of C, N, S and O, wherein R.sub.1, R.sub.2, R.sub.3, and R.sub.4 are independently selected from the group consisting of H, D, O, halo, C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl, wherein the C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl may be optionally substituted with an atom or a group selected from the group consisting of halo, C.sub.1-4alkyl, CF.sub.3, and combinations thereof, wherein R.sub.5, R.sub.6, R.sub.7, R.sub.8 and R.sub.10 are independently selected from the group consisting of no atom, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), wherein R.sub.9 and R.sub.11 are independently selected from the group consisting of H, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), wherein R is selected from the group consisting of H, D, O, halo, C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl, wherein the C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl may be optionally substituted with an atom or a group selected from the group consisting of halo, C.sub.1-4alkyl, CF.sub.3, and combinations thereof, or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
19. The method of claim 18, wherein the compound is selected from the group consisting of: ##STR00214## combinations thereof, or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
20. The method of claim 18, wherein the neurodegenerative disease is selected from the group consisting of Alzheimer's disease, Parkinson's disease, amyotrophic lateral sclerosis (ALS), Friedreich's ataxia, multiple sclerosis, Huntington's Disease, transmissible spongiform encephalopathy, Charcot-Marie-Tooth disease, dementia with Lewy bodies, corticobasal degeneration, progressive supranuclear palsy, and hereditary spastic paraparesis.
21. The method of claim 18, wherein the neurodegenerative disease is Huntington's Disease.
22. The method of claim 18, wherein the subject is a mammal.
23. The method of claim 22, wherein the mammal is selected from the group consisting of humans, veterinary animals, and agricultural animals.
24. The method of claim 18, wherein the subject is a human.
25. The method of claim 18, further comprising co-administering to the subject an effective amount of one or more additional therapeutic agents.
26. The method of claim 25, wherein the one or more additional therapeutic agents are selected from the group consisting of 5-hydroxytryptophan, Activase, AFQ056 (Novartis), Aggrastat, Albendazole, alpha-lipoic acid/L-acetyl carnitine, Alteplase, Amantadine (Symmetrel), amlodipine, Ancrod, Apomorphine (Apokyn), Arimoclomol, Arixtra, Armodafinil, Ascorbic acid, Ascriptin, Aspirin, atenolol, Avonex, baclofen (Lioresal), Banzel, Benztropine (Cogentin), Betaseron, BGG492 (Novartis Corp.), Botulinum toxin, Bufferin, Carbatrol, Carbidopa/levodopa immediate-release (Sinemet), Carbidopa/levodopa oral disintegrating (Parcopa), Carbidopa/levodopa/Entacapone (Stalevo), CERE-110: Adeno-Associated Virus Delivery of NGF (Ceregene), cerebrolysin, CinnoVex, citalopram, citicoline, Clobazam, Clonazepam, Clopidogrel, clozapine (Clozaril), Coenzyme Q, Creatine, dabigatran, dalteparin, Dapsone, Davunetide, Deferiprone, Depakene, Depakote ER, Depakote, Desmoteplase, Diastat, Diazepam, Digoxin, Dilantin, Dimebon, dipyridamole, divalproex (Depakote), Donepezil (Aricept), EGb 761, Eldepryl, ELND002 (Elan Pharmaceuticals), Enalapril, enoxaparin, Entacapone (Comtan), epoetin alfa, Eptifibatide, Erythropoietin, Escitalopram, Eslicarbazepine acetate, Esmolol, Ethosuximide, Ethyl-EPA (Miraxion), Exenatide, Extavia, Ezogabine, Felbamate, Felbatol, Fingolimod (Gilenya), fluoxetine (Prozac), fondaparinux, Fragmin, Frisium, Gabapentin, Gabitril, Galantamine, Glatiramer (Copaxone), haloperidol (Haldol), Heparin, human chorionic gonadotropin (hCG), Idebenone, Inovelon, insulin, Interferon beta 1a, Interferon beta 1b, ioflupane 1231 (DATSCAN), IPX066 (Impax Laboratories Inc.), JNJ-26489112 (Johnson and Johnson), Keppra, Klonopin, Lacosamide, L-Alpha glycerylphosphorylcholine, Lamictal, Lamotrigine, Levetiracetam, liraglutide, Lisinopril, Lithium carbonate, Lopressor, Lorazepam, losartan, Lovenox, Lu AA24493, Luminal, LY450139 (Eli Lilly), Lyrica, Masitinib, Mecobalamin, Memantine, methylprednisolone, metoprolol tartrate, Minitran, Minocycline, mirtazapine, Mitoxantrone (Novantrone), Mysoline, Natalizumab (Tysabri), Neurontin, Niacinamide, Nitro-Bid, Nitro-Dur, nitroglycerin, Nitrolingual, Nitromist, Nitrostat, Nitro-Time, Norepinephrine (NOR), Carbamazepine, octreotide, Onfi, Oxcarbazepine, Oxybutinin chloride, PF-04360365 (Pfizer), Phenobarbital, Phenytek, Phenytoin, piclozotan, Pioglitazone, Plavix, Potiga, Pramipexole (Mirapex), pramlintide, Prednisone, Primidone, Prinivil, probenecid, Propranolol, PRX-00023 (EPIX Pharmaceuticals Inc.), PXT3003, Quinacrine, Ramelteon, Rasagiline (Azilect), Rebif, ReciGen, remacemide, Resveratrol, Retavase, reteplase, riluzole (Rilutek), Rivastigmine (Exelon), Ropinirole (Requip), Rotigotine (Neupro), Rufinamide, Sabril, safinamide (EMD Serono), Salagen, Sarafem, Selegiline (1-deprenyl, Eldepryl), SEN0014196 (Siena Biotech), sertraline (Zoloft), Simvastatin, Sodium Nitroprussiate (NPS), sodium phenylbutyrate, Stanback Headache Powder, Tacrine (Cognex), Tamoxifen, tauroursodeoxycholic acid (TUDCA), Tegretol, Tenecteplase, Tenormin, Tetrabenazine (Xenazine), THR-18 (Thrombotech Ltd.), Tiagabine, Tideglusib, tirofiban, tissue plasminogen activator (tPA), tizanidine (Zanaflex), TNKase, Tolcapone (Tasmar), Tolterodine, Topamax, Topiramate, Trihexyphenidyl (formerly Artane), Trileptal, ursodiol, Valproic Acid, valsartan, Varenicline (Pfizer), Vimpat, Vitamin E, Warfarin, Zarontin, Zestril, Zonegran, Zonisamide, Zydis selegiline HCL Oral disintegrating (Zelapar), and combinations thereof.
27. A method of treating or ameliorating the effects of a condition associated with increased protein disulfide isomerase (PDI) activity in a subject in need thereof comprising administering to the subject an effective amount of a compound selected from the group consisting of formula (I) ##STR00215## formula (II) ##STR00216## formula (III) ##STR00217## and formula (IV): ##STR00218## wherein a dashed line indicates the presence of an optional double bond, wherein W, X, Y and Z are independently selected from the group consisting of C, N, S and O, wherein R.sub.1, R.sub.2, R.sub.3, and R.sub.4 are independently selected from the group consisting of H, D, O, halo, C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl, wherein the C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl may be optionally substituted with an atom or a group selected from the group consisting of halo, C.sub.1-4alkyl, CF.sub.3, and combinations thereof, wherein R.sub.5, R.sub.6, R.sub.7, R.sub.8 and R.sub.10 are independently selected from the group consisting of no atom, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), wherein R.sub.9 and R.sub.11 are independently selected from the group consisting of H, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), wherein R is selected from the group consisting of H, D, O, halo, C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl, wherein the C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl may be optionally substituted with an atom or a group selected from the group consisting of halo, C.sub.1-4alkyl, CF.sub.3, and combinations thereof, or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
28. The method of claim 27, wherein the compound is selected from the group consisting of: ##STR00219## combinations thereof, or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
29. The method of claim 27, wherein the subject is a mammal.
30. The method of claim 29, wherein the mammal is selected from the group consisting of humans, veterinary animals, and agricultural animals
31. The method of claim 27, wherein the subject is a human.
32. The method of claim 27, wherein the condition is selected from the group consisting of a protein folding disorder, cancer, HIV, and a blood clot.
33. A method of modulating PDI activity in a cell comprising contacting the cell with an effective amount of a compound selected from the group consisting of formula (I) ##STR00220## formula (II) ##STR00221## formula (III) ##STR00222## and formula (IV): ##STR00223## wherein a dashed line indicates the presence of an optional double bond, wherein W, X, Y and Z are independently selected from the group consisting of C, N, S and O, wherein R.sub.1, R.sub.2, R.sub.3, and R.sub.4 are independently selected from the group consisting of H, D, O, halo, C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl, wherein the C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl may be optionally substituted with an atom or a group selected from the group consisting of halo, C.sub.1-4alkyl, CF.sub.3, and combinations thereof, wherein R.sub.5, R.sub.6, R.sub.7, R.sub.8 and R.sub.10 are independently selected from the group consisting of no atom, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), wherein R.sub.9 and R.sub.11 are independently selected from the group consisting of H, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), wherein R is selected from the group consisting of H, D, O, halo, C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl, wherein the C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl may be optionally substituted with an atom or a group selected from the group consisting of halo, C.sub.1-4alkyl, CF.sub.3, and combinations thereof, or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
34. The method of claim 33, wherein the compound is selected from the group consisting of: ##STR00224## combinations thereof, or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
35. A compound having the formula (I) ##STR00225## wherein a dashed line indicates the presence of an optional double bond, wherein W, X, Y and Z are independently selected from the group consisting of C, N, S and O, wherein R.sub.1, R.sub.2, R.sub.3, and R.sub.4 are independently selected from the group consisting of H, D, O, halo, C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl, wherein the C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl may be optionally substituted with an atom or a group selected from the group consisting of halo, C.sub.1-4alkyl, CF.sub.3, and combinations thereof, wherein R.sub.5, R.sub.6, R.sub.7, R.sub.8 and R.sub.10 are independently selected from the group consisting of no atom, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), wherein R.sub.9 and R.sub.11 are independently selected from the group consisting of H, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), wherein R is selected from the group consisting of H, D, O, halo, C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl, wherein the C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl may be optionally substituted with an atom or a group selected from the group consisting of halo, C.sub.1-4alkyl, CF.sub.3, and combinations thereof, with the proviso that the compound is not ##STR00226## or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
36. The compound of claim 35, which is selected from the group consisting of: ##STR00227## combinations thereof, or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
37. A compound having the formula (Ia) ##STR00228## wherein a dashed line indicates the presence of an optional double bond, wherein W, X, and Z are independently selected from the group consisting of C, N, S and O, wherein Y is selected from the group consisting of C, N, Se, S and O, wherein R.sub.1, R.sub.2, R.sub.3, and R.sub.4 are independently selected from the group consisting of H, D, O, halo, C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl, wherein the C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl may be optionally substituted with an atom or a group selected from the group consisting of halo, C.sub.1-4alkyl, CF.sub.3, and combinations thereof, wherein R.sub.5, R.sub.6, R.sub.7, R.sub.8 and R.sub.10 are independently selected from the group consisting of no atom, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), wherein R.sub.9 and R.sub.11 are independently selected from the group consisting of H, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), wherein R is selected from the group consisting of H, D, O, halo, C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl, wherein the C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl may be optionally substituted with an atom or a group selected from the group consisting of halo, C.sub.1-4alkyl, CF.sub.3, and combinations thereof, with the proviso that the compound is not ##STR00229## or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
38. The compound of claim 37, which is selected from the group consisting of: ##STR00230## combinations thereof, or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
39. A compound having the formula (II) ##STR00231## wherein a dashed line indicates the presence of an optional double bond, wherein X is selected from the group consisting of S and Se, wherein R.sub.1, R.sub.2, R.sub.3, and R.sub.4 are independently selected from the group consisting of H, D, O, halo, C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl, wherein the C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl may be optionally substituted with an atom or a group selected from the group consisting of halo, C.sub.1-4alkyl, CF.sub.3, and combinations thereof, wherein R.sub.5 is selected from the group consisting of C.sub.1-4alkyl, C(O)NH, C(O), C(O)O, NH and O, wherein R.sub.6, is -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), wherein R.sub.7 and R.sub.8 are independently selected from the group consisting of no atom, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), wherein R.sub.9 is selected from the group consisting of H, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), wherein R.sub.10 is selected from the group consisting of no atom and O, wherein R.sub.11 is selected from the group consisting of O and -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), wherein R is selected from the group consisting of H, D, O, halo, C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl, wherein the C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl may be optionally substituted with an atom or a group selected from the group consisting of halo, C.sub.1-4alkyl, CF.sub.3, and combinations thereof, with the proviso that the compound is not ##STR00232## or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
40. The compound of claim 39, which is selected from the group consisting of: ##STR00233## combinations thereof, or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
41. The compound of claim 39, wherein the compound is ##STR00234## or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
42. A compound having the formula (III) ##STR00235## wherein X is selected from the group consisting of S and Se, wherein R.sub.6, is selected from the group consisting of the group consisting of phenyl, ##STR00236## wherein a wavy line indicates an attachment point to the molecule, wherein R.sub.7 and R.sub.8 are independently selected from the group consisting of no atom, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), wherein R.sub.9 is selected from the group consisting of H, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), wherein R is selected from the group consisting of H, D, O, halo, C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl, wherein the C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl may be optionally substituted with an atom or a group selected from the group consisting of halo, C.sub.1-4alkyl, CF.sub.3, and combinations thereof, with the proviso that the compound is not ##STR00237## or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
43. The compound of claim 42, which is selected from the group consisting of: ##STR00238## combinations thereof, or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
44. A compound of claim 37, which is selected from the group consisting of ##STR00239## and combinations thereof.
45. A composition comprising a compound according to any one of claims 35-44 and a pharmaceutically acceptable carrier, adjuvant or vehicle.
46. A pharmaceutically acceptable salt of a compound according to any one of claims 35-44.
47. A composition comprising a pharmaceutically acceptable salt of a compound according to any one of claims 35-44 and a pharmaceutically acceptable carrier, adjuvant or vehicle.
48. A kit comprising: i) a compound according to any one of claims 35-44 or a composition according to claim 45; and ii) instructions for use.
49. The kit according to claim 48, wherein the instructions for use are instructions for treating or ameliorating the effects of a neurodegenerative disorder in a subject.
50. The kit according to claim 48, wherein the instructions for use are instructions for treating or ameliorating the effects of a condition associated with increased protein disulfide isomerase (PDI) activity in a subject.
51. The kit according to claim 48, wherein the instructions for use are instructions for modulating PDI activity in a cell.
52. A method for treating or ameliorating the effects of a neurodegenerative disorder in a subject in need thereof comprising administering to the subject an effective amount of a compound selected from the group consisting of formula (Ia) ##STR00240## wherein a dashed line indicates the presence of an optional double bond, wherein W, X, and Z are independently selected from the group consisting of C, N, S and O, wherein Y is selected from the group consisting of C, N, Se, S and O, wherein R.sub.1, R.sub.2, R.sub.3, and R.sub.4 are independently selected from the group consisting of H, D, O, halo, C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl, wherein the C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl may be optionally substituted with an atom or a group selected from the group consisting of halo, C.sub.1-4alkyl, CF.sub.3, and combinations thereof, wherein R.sub.5, R.sub.6, R.sub.7, R.sub.8 and R.sub.10 are independently selected from the group consisting of no atom, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), wherein R.sub.9 and R.sub.11 are independently selected from the group consisting of H, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), wherein R is selected from the group consisting of H, D, O, halo, C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl, wherein the C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl may be optionally substituted with an atom or a group selected from the group consisting of halo, C.sub.1-4alkyl, CF.sub.3, and combinations thereof, or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof; formula (II) ##STR00241## wherein a dashed line indicates the presence of an optional double bond, wherein X is selected from the group consisting of S and Se, wherein R.sub.1, R.sub.2, R.sub.3, and R.sub.4 are independently selected from the group consisting of H, D, O, halo, C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl, wherein the C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl may be optionally substituted with an atom or a group selected from the group consisting of halo, C.sub.1-4alkyl, CF.sub.3, and combinations thereof, wherein R.sub.5 is selected from the group consisting of C.sub.1-4alkyl, C(O)NH, C(O), C(O)O, NH and O, wherein R.sub.6, is -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), wherein R.sub.7 and R.sub.8 are independently selected from the group consisting of no atom, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), wherein R.sub.9 is selected from the group consisting of H, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), wherein R.sub.10 is selected from the group consisting of no atom and O, wherein R.sub.11 is selected from the group consisting of O and -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), wherein R is selected from the group consisting of H, D, O, halo, C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl, wherein the C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl may be optionally substituted with an atom or a group selected from the group consisting of halo, C.sub.1-4alkyl, CF.sub.3, and combinations thereof, or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof; and ##STR00242## or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
53. The method of claim 52, wherein the compound is selected from the group consisting of: ##STR00243## combinations thereof, or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
54. A method for treating or ameliorating the effects of a neurodegenerative disorder in a subject in need thereof comprising administering to the subject an effective amount of a composition of claim 45 or claim 47.
55. The method of claim 52 or claim 54, wherein the neurodegenerative disease is selected from the group consisting of Alzheimer's disease, Parkinson's disease, amyotrophic lateral sclerosis (ALS), Friedreich's ataxia, multiple sclerosis, Huntington's Disease, transmissible spongiform encephalopathy, Charcot-Marie-Tooth disease, dementia with Lewy bodies, corticobasal degeneration, progressive supranuclear palsy, and hereditary spastic paraparesis.
56. The method of claim 52 or claim 54, wherein the neurodegenerative disease is Huntington's Disease.
57. The method of claim 52 or claim 54, wherein the subject is a mammal.
58. The method of claim 52 or claim 54, wherein the mammal is selected from the group consisting of humans, veterinary animals, and agricultural animals.
59. The method of claim 52 or claim 54, wherein the subject is a human.
60. The method of claim 52 or claim 54, further comprising co-administering to the subject an effective amount of one or more additional therapeutic agents.
61. The method of claim 52 or claim 54, wherein the one or more additional therapeutic agents are selected from the group consisting of 5-hydroxytryptophan, Activase, AFQ056 (Novartis), Aggrastat, Albendazole, alpha-lipoic acid/L-acetyl carnitine, Alteplase, Amantadine (Symmetrel), amlodipine, Ancrod, Apomorphine (Apokyn), Arimoclomol, Arixtra, Armodafinil, Ascorbic acid, Ascriptin, Aspirin, atenolol, Avonex, baclofen (Lioresal), Banzel, Benztropine (Cogentin), Betaseron, BGG492 (Novartis Corp.), Botulinum toxin, Bufferin, Carbatrol, Carbidopa/levodopa immediate-release (Sinemet), Carbidopa/levodopa oral disintegrating (Parcopa), Carbidopa/levodopa/Entacapone (Stalevo), CERE-110: Adeno-Associated Virus Delivery of NGF (Ceregene), cerebrolysin, CinnoVex, citalopram, citicoline, Clobazam, Clonazepam, Clopidogrel, clozapine (Clozaril), Coenzyme Q, Creatine, dabigatran, dalteparin, Dapsone, Davunetide, Deferiprone, Depakene, Depakote ER, Depakote, Desmoteplase, Diastat, Diazepam, Digoxin, Dilantin, Dimebon, dipyridamole, divalproex (Depakote), Donepezil (Aricept), EGb 761, Eldepryl, ELND002 (Elan Pharmaceuticals), Enalapril, enoxaparin, Entacapone (Comtan), epoetin alfa, Eptifibatide, Erythropoietin, Escitalopram, Eslicarbazepine acetate, Esmolol, Ethosuximide, Ethyl-EPA (Miraxion), Exenatide, Extavia, Ezogabine, Felbamate, Felbatol, Fingolimod (Gilenya), fluoxetine (Prozac), fondaparinux, Fragmin, Frisium, Gabapentin, Gabitril, Galantamine, Glatiramer (Copaxone), haloperidol (Haldol), Heparin, human chorionic gonadotropin (hCG), Idebenone, Inovelon, insulin, Interferon beta 1a, Interferon beta 1b, ioflupane 1231 (DATSCAN), IPX066 (Impax Laboratories Inc.), JNJ-26489112 (Johnson and Johnson), Keppra, Klonopin, Lacosamide, L-Alpha glycerylphosphorylcholine, Lamictal, Lamotrigine, Levetiracetam, liraglutide, Lisinopril, Lithium carbonate, Lopressor, Lorazepam, losartan, Lovenox, Lu AA24493, Luminal, LY450139 (Eli Lilly), Lyrica, Masitinib, Mecobalamin, Memantine, methylprednisolone, metoprolol tartrate, Minitran, Minocycline, mirtazapine, Mitoxantrone (Novantrone), Mysoline, Natalizumab (Tysabri), Neurontin, Niacinamide, Nitro-Bid, Nitro-Dur, nitroglycerin, Nitrolingual, Nitromist, Nitrostat, Nitro-Time, Norepinephrine (NOR), Carbamazepine, octreotide, Onfi, Oxcarbazepine, Oxybutinin chloride, PF-04360365 (Pfizer), Phenobarbital, Phenytek, Phenytoin, piclozotan, Pioglitazone, Plavix, Potiga, Pramipexole (Mirapex), pramlintide, Prednisone, Primidone, Prinivil, probenecid, Propranolol, PRX-00023 (EPIX Pharmaceuticals Inc.), PXT3003, Quinacrine, Ramelteon, Rasagiline (Azilect), Rebif, ReciGen, remacemide, Resveratrol, Retavase, reteplase, riluzole (Rilutek), Rivastigmine (Exelon), Ropinirole (Requip), Rotigotine (Neupro), Rufinamide, Sabril, safinamide (EMD Serono), Salagen, Sarafem, Selegiline (1-deprenyl, Eldepryl), SEN0014196 (Siena Biotech), sertraline (Zoloft), Simvastatin, Sodium Nitroprussiate (NPS), sodium phenylbutyrate, Stanback Headache Powder, Tacrine (Cognex), Tamoxifen, tauroursodeoxycholic acid (TUDCA), Tegretol, Tenecteplase, Tenormin, Tetrabenazine (Xenazine), THR-18 (Thrombotech Ltd.), Tiagabine, Tideglusib, tirofiban, tissue plasminogen activator (tPA), tizanidine (Zanaflex), TNKase, Tolcapone (Tasmar), Tolterodine, Topamax, Topiramate, Trihexyphenidyl (formerly Artane), Trileptal, ursodiol, Valproic Acid, valsartan, Varenicline (Pfizer), Vimpat, Vitamin E, Warfarin, Zarontin, Zestril, Zonegran, Zonisamide, Zydis selegiline HCL Oral disintegrating (Zelapar), and combinations thereof.
62. The method of claim 52, wherein the compound is selected from the group consisting of ##STR00244## and combinations thereof.
63. A method for treating or ameliorating the effects of a condition associated with increased protein disulfide isomerase (PDI) activity in a subject in need thereof comprising administering to the subject an effective amount of a compound selected from the group consisting of formula (Ia) ##STR00245## wherein a dashed line indicates the presence of an optional double bond, wherein W, X, and Z are independently selected from the group consisting of C, N, S and O, wherein Y is selected from the group consisting of C, N, Se, S and O, wherein R.sub.1, R.sub.2, R.sub.3, and R.sub.4 are independently selected from the group consisting of H, D, O, halo, C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl, wherein the C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl may be optionally substituted with an atom or a group selected from the group consisting of halo, C.sub.1-4alkyl, CF.sub.3, and combinations thereof, wherein R.sub.5, R.sub.6, R.sub.7, R.sub.8 and R.sub.10 are independently selected from the group consisting of no atom, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), wherein R.sub.9 and R.sub.11 are independently selected from the group consisting of H, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), wherein R is selected from the group consisting of H, D, O, halo, C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl, wherein the C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl may be optionally substituted with an atom or a group selected from the group consisting of halo, C.sub.1-4alkyl, CF.sub.3, and combinations thereof, or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof; formula (II) ##STR00246## wherein a dashed line indicates the presence of an optional double bond, wherein X is selected from the group consisting of S and Se, wherein R.sub.1, R.sub.2, R.sub.3, and R.sub.4 are independently selected from the group consisting of H, D, O, halo, C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl, wherein the C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl may be optionally substituted with an atom or a group selected from the group consisting of halo, C.sub.1-4alkyl, CF.sub.3, and combinations thereof, wherein R.sub.5 is selected from the group consisting of C.sub.1-4alkyl, C(O)NH, C(O), C(O)O, NH and O, wherein R.sub.6, is -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), wherein R.sub.7 and R.sub.8 are independently selected from the group consisting of no atom, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), wherein R.sub.9 is selected from the group consisting of H, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), wherein R.sub.10 is selected from the group consisting of no atom and O, wherein R.sub.11 is selected from the group consisting of O and -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), wherein R is selected from the group consisting of H, D, O, halo, C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl, wherein the C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl may be optionally substituted with an atom or a group selected from the group consisting of halo, C.sub.1-4alkyl, CF.sub.3, and combinations thereof, or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof; and ##STR00247## or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
64. The method of claim 63, wherein the compound is selected from the group consisting of: ##STR00248## ##STR00249## ##STR00250## combinations thereof, or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
65. A method for treating or ameliorating the effects of a condition associated with increased protein disulfide isomerase (PDI) activity in a subject in need thereof comprising administering to the subject an effective amount of a composition of claim 45 or claim 47.
66. The method of claim 63 or claim 65, wherein the subject is a mammal.
67. The method of claim 63 or claim 65, wherein the mammal is selected from the group consisting of humans, veterinary animals, and agricultural animals.
68. The method of claim 63 or claim 65, wherein the subject is a human.
69. The method of claim 63 or claim 65, wherein the condition is selected from the group consisting of a protein folding disorder, cancer, HIV, and a blood clot.
70. The method of claim 63, wherein the compound is selected from the group consisting of ##STR00251## ##STR00252## ##STR00253## and combinations thereof.
71. A method of modulating PDI activity in a cell comprising administering to the subject an effective amount of a compound selected from the group consisting of formula (Ia) ##STR00254## wherein a dashed line indicates the presence of an optional double bond, wherein W, X, and Z are independently selected from the group consisting of C, N, S and O, wherein Y is selected from the group consisting of C, N, Se, S and O, wherein R.sub.1, R.sub.2, R.sub.3, and R.sub.4 are independently selected from the group consisting of H, D, O, halo, C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl, wherein the C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl may be optionally substituted with an atom or a group selected from the group consisting of halo, C.sub.1-4alkyl, CF.sub.3, and combinations thereof, wherein R.sub.5, R.sub.6, R.sub.7, R.sub.8 and R.sub.10 are independently selected from the group consisting of no atom, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), wherein R.sub.9 and R.sub.11 are independently selected from the group consisting of H, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), wherein R is selected from the group consisting of H, D, O, halo, C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl, wherein the C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl may be optionally substituted with an atom or a group selected from the group consisting of halo, C.sub.1-4alkyl, CF.sub.3, and combinations thereof, or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof; formula (II) ##STR00255## wherein a dashed line indicates the presence of an optional double bond, wherein X is selected from the group consisting of S and Se, wherein R.sub.1, R.sub.2, R.sub.3, and R.sub.4 are independently selected from the group consisting of H, D, O, halo, C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl, wherein the C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl may be optionally substituted with an atom or a group selected from the group consisting of halo, C.sub.1-4alkyl, CF.sub.3, and combinations thereof, wherein R.sub.5 is selected from the group consisting of C.sub.1-4alkyl, C(O)NH, C(O), C(O)O, NH and O, wherein R.sub.6, is -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), wherein R.sub.7 and R.sub.8 are independently selected from the group consisting of no atom, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), wherein R.sub.9 is selected from the group consisting of H, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), wherein R.sub.10 is selected from the group consisting of no atom and O, wherein R.sub.11 is selected from the group consisting of O and -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), wherein R is selected from the group consisting of H, D, O, halo, C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl, wherein the C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl may be optionally substituted with an atom or a group selected from the group consisting of halo, C.sub.1-4alkyl, CF.sub.3, and combinations thereof, or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof; and ##STR00256## or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
72. The method of claim 71, wherein the compound is selected from the group consisting of: ##STR00257## ##STR00258## ##STR00259## combinations thereof, or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
73. A method of modulating PDI activity in a cell comprising administering to the subject an effective amount of a composition of claim 45 or claim 47.
74. The method of claim 71, wherein the compound is selected from the group consisting of ##STR00260## ##STR00261## ##STR00262## and combinations thereof.
75. A method for treating or ameliorating the effects of a neurodegenerative disorder in a subject in need thereof comprising administering to the subject an effective amount of a compound selected from the group consisting of: ##STR00263## ##STR00264## ##STR00265## combinations thereof, or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
76. The method of claim 75, wherein the neurodegenerative disease is selected from the group consisting of Alzheimer's disease, Parkinson's disease, amyotrophic lateral sclerosis (ALS), Friedreich's ataxia, multiple sclerosis, Huntington's Disease, transmissible spongiform encephalopathy, Charcot-Marie-Tooth disease, dementia with Lewy bodies, corticobasal degeneration, progressive supranuclear palsy, and hereditary spastic paraparesis.
77. The method of claim 75, wherein the neurodegenerative disease is Huntington's Disease.
78. The method of claim 75, wherein the subject is a mammal.
79. The method of claim 78, wherein the mammal is selected from the group consisting of humans, veterinary animals, and agricultural animals.
80. The method of claim 75, wherein the subject is a human.
81. The method of claim 75, further comprising co-administering to the subject an effective amount of one or more additional therapeutic agents.
82. The method of claim 81, wherein the one or more additional therapeutic agents are selected from the group consisting of 5-hydroxytryptophan, Activase, AFQ056 (Novartis), Aggrastat, Albendazole, alpha-lipoic acid/L-acetyl carnitine, Alteplase, Amantadine (Symmetrel), amlodipine, Ancrod, Apomorphine (Apokyn), Arimoclomol, Arixtra, Armodafinil, Ascorbic acid, Ascriptin, Aspirin, atenolol, Avonex, baclofen (Lioresal), Banzel, Benztropine (Cogentin), Betaseron, BGG492 (Novartis Corp.), Botulinum toxin, Bufferin, Carbatrol, Carbidopa/levodopa immediate-release (Sinemet), Carbidopa/levodopa oral disintegrating (Parcopa), Carbidopa/levodopa/Entacapone (Stalevo), CERE-110: Adeno-Associated Virus Delivery of NGF (Ceregene), cerebrolysin, CinnoVex, citalopram, citicoline, Clobazam, Clonazepam, Clopidogrel, clozapine (Clozaril), Coenzyme Q, Creatine, dabigatran, dalteparin, Dapsone, Davunetide, Deferiprone, Depakene, Depakote ER, Depakote, Desmoteplase, Diastat, Diazepam, Digoxin, Dilantin, Dimebon, dipyridamole, divalproex (Depakote), Donepezil (Aricept), EGb 761, Eldepryl, ELND002 (Elan Pharmaceuticals), Enalapril, enoxaparin, Entacapone (Comtan), epoetin alfa, Eptifibatide, Erythropoietin, Escitalopram, Eslicarbazepine acetate, Esmolol, Ethosuximide, Ethyl-EPA (Miraxion), Exenatide, Extavia, Ezogabine, Felbamate, Felbatol, Fingolimod (Gilenya), fluoxetine (Prozac), fondaparinux, Fragmin, Frisium, Gabapentin, Gabitril, Galantamine, Glatiramer (Copaxone), haloperidol (Haldol), Heparin, human chorionic gonadotropin (hCG), Idebenone, Inovelon, insulin, Interferon beta 1a, Interferon beta 1b, ioflupane 1231 (DATSCAN), IPX066 (Impax Laboratories Inc.), JNJ-26489112 (Johnson and Johnson), Keppra, Klonopin, Lacosamide, L-Alpha glycerylphosphorylcholine, Lamictal, Lamotrigine, Levetiracetam, liraglutide, Lisinopril, Lithium carbonate, Lopressor, Lorazepam, losartan, Lovenox, Lu AA24493, Luminal, LY450139 (Eli Lilly), Lyrica, Masitinib, Mecobalamin, Memantine, methylprednisolone, metoprolol tartrate, Minitran, Minocycline, mirtazapine, Mitoxantrone (Novantrone), Mysoline, Natalizumab (Tysabri), Neurontin, Niacinamide, Nitro-Bid, Nitro-Dur, nitroglycerin, Nitrolingual, Nitromist, Nitrostat, Nitro-Time, Norepinephrine (NOR), Carbamazepine, octreotide, Onfi, Oxcarbazepine, Oxybutinin chloride, PF-04360365 (Pfizer), Phenobarbital, Phenytek, Phenytoin, piclozotan, Pioglitazone, Plavix, Potiga, Pramipexole (Mirapex), pramlintide, Prednisone, Primidone, Prinivil, probenecid, Propranolol, PRX-00023 (EPIX Pharmaceuticals Inc.), PXT3003, Quinacrine, Ramelteon, Rasagiline (Azilect), Rebif, ReciGen, remacemide, Resveratrol, Retavase, reteplase, riluzole (Rilutek), Rivastigmine (Exelon), Ropinirole (Requip), Rotigotine (Neupro), Rufinamide, Sabril, safinamide (EMD Serono), Salagen, Sarafem, Selegiline (1-deprenyl, Eldepryl), SEN0014196 (Siena Biotech), sertraline (Zoloft), Simvastatin, Sodium Nitroprussiate (NPS), sodium phenylbutyrate, Stanback Headache Powder, Tacrine (Cognex), Tamoxifen, tauroursodeoxycholic acid (TUDCA), Tegretol, Tenecteplase, Tenormin, Tetrabenazine (Xenazine), THR-18 (Thrombotech Ltd.), Tiagabine, Tideglusib, tirofiban, tissue plasminogen activator (tPA), tizanidine (Zanaflex), TNKase, Tolcapone (Tasmar), Tolterodine, Topamax, Topiramate, Trihexyphenidyl (formerly Artane), Trileptal, ursodiol, Valproic Acid, valsartan, Varenicline (Pfizer), Vimpat, Vitamin E, Warfarin, Zarontin, Zestril, Zonegran, Zonisamide, Zydis selegiline HCL Oral disintegrating (Zelapar), and combinations thereof.
83. A method for treating or ameliorating the effects of a condition associated with increased protein disulfide isomerase (PDI) activity in a subject in need thereof comprising administering to the subject an effective amount of a compound selected from the group consisting of: ##STR00266## ##STR00267## ##STR00268## combinations thereof, or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
84. A method of modulating PDI activity in a cell comprising contacting the cell with an effective amount of a compound selected from the group consisting of: ##STR00269## ##STR00270## ##STR00271## combinations thereof, or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
85. A compound selected from the group consisting of: ##STR00272## ##STR00273## ##STR00274## combinations thereof, or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
86. A composition comprising a compound according to claim 85 and a pharmaceutically acceptable carrier, adjuvant or vehicle.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0033] The application file contains at least one drawing executed in color. Copies of this patent application publication with color drawing(s) will be provided by the Office upon request and payment of the necessary fee.
[0034] The following drawings form part of the present specification and are included to further demonstrate certain aspects of the present invention. The invention may be better understood by reference to one or more of these drawings in combination with the detailed description of specific embodiments presented herein.
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
DETAILED DESCRIPTION OF THE INVENTION
[0052] One embodiment of the present invention is a method for treating or ameliorating the effects of a neurodegenerative disorder in a subject in need thereof comprising administering to the subject an effective amount of a compound selected from the group consisting of:
##STR00051##
combinations thereof,
or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
[0053] As used herein, an N-oxide means a compound containing an NO bond with three additional hydrogen and/or side chains attached to N, so that there is a positive charge on the nitrogen. The N-oxides of compounds of the present invention may be synthesized by simple oxidation procedures well known to those skilled in the art. For example, the oxidation procedure described by P. Brougham et al. (Synthesis, 1015-1017, 1987), allows the two nitrogen of a piperazine ring to be differentiated, enabling both the N-oxides and N,N-dioxide to be obtained. Other oxidation procedures are disclosed in, e.g., U.S. Patent Publication No. 20070275977; S. L. Jain, J. K. Joseph, B. Sain, Synlett, 2006, 2661-2663; A. McKillop, D. Kemp, Tetrahedron, 1989, 45, 3299-3306; R. S. Varma, K. P. Naicker, Org. Lett., 1999, 1, 189-191; and N. K. Jana, J. G. Verkade, Org. Lett., 2003, 5, 3787-3790. Thus, the present invention includes these and other well known procedures for making N-oxides, so long as the end product is sufficiently effective as set forth in more detail below.
[0054] The term crystalline form, as used herein, refers to the crystal structure of a compound. A compound may exist in one or more crystalline forms, which may have different structural, physical, pharmacological, or chemical characteristics. Different crystalline forms may be obtained using variations in nucleation, growth kinetics, agglomeration, and breakage. Nucleation results when the phase-transition energy barrier is overcome, thereby allowing a particle to form from a supersaturated solution. Crystal growth is the enlargement of crystal particles caused by deposition of the chemical compound on an existing surface of the crystal. The relative rate of nucleation and growth determine the size distribution of the crystals that are formed. The thermodynamic driving force for both nucleation and growth is supersaturation, which is defined as the deviation from thermodynamic equilibrium. Agglomeration is the formation of larger particles through two or more particles (e.g., crystals) sticking together and forming a larger crystalline structure.
[0055] As used herein, a hydrate means a compound that contains water molecules in a definite ratio and in which water forms an integral part of the crystalline structure of the compound. Methods of making hydrates are known in the art. For example, some substances spontaneously absorb water from the air to form hydrates. Others may form hydrates upon contact with water. In most cases, however, hydrates are made by changes in temperature or pressure. Additionally, the compounds of the present invention as well as their salts may contain, e.g., when isolated in crystalline form, varying amounts of solvents, such as water. Included within the scope of the invention are, therefore, all hydrates of the compounds and all hydrates of salts of the compounds of the present invention, so long as such hydrates are sufficiently effective as set forth in more detail below.
[0056] In one aspect of this embodiment the neurodegenerative disease is selected from the group consisting of Alzheimer's disease, Parkinson's disease, amyotrophic lateral sclerosis (ALS), Friedreich's ataxia, multiple sclerosis, Huntington's Disease, transmissible spongiform encephalopathy, Charcot-Marie-Tooth disease, dementia with Lewy bodies, corticobasal degeneration, progressive supranuclear palsy, and hereditary spastic paraparesis. In a preferred embodiment, the neurodegenerative disease is Huntington's Disease.
[0057] In one aspect of this embodiment the compound is
##STR00052##
or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
[0058] In another aspect of this embodiment the subject is a mammal. In some aspects of this embodiment the mammal is selected from the group consisting of humans, veterinary animals, and agricultural animals. In another aspect of this embodiment the subject is a human.
[0059] In one aspect of this embodiment the method further comprises co-administering to the subject an effective amount of one or more additional therapeutic agents. Preferably, the one or more additional therapeutic agents are selected from the group consisting of 5-hydroxytryptophan, Activase, AFQ056 (Novartis), Aggrastat, Albendazole, alpha-lipoic acid/L-acetyl carnitine, Alteplase, Amantadine (Symmetrel), amlodipine, Ancrod, Apomorphine (Apokyn), Arimoclomol, Arixtra, Armodafinil, Ascorbic acid, Ascriptin, Aspirin, atenolol, Avonex, baclofen (Lioresal), Banzel, Benztropine (Cogentin), Betaseron, BGG492 (Novartis Corp.), Botulinum toxin, Bufferin, Carbatrol, Carbidopa/levodopa immediate-release (Sinemet), Carbidopa/levodopa oral disintegrating (Parcopa), Carbidopa/levodopa/Entacapone (Stalevo), CERE-110: Adeno-Associated Virus Delivery of NGF (Ceregene), cerebrolysin, CinnoVex, citalopram, citicoline, Clobazam, Clonazepam, Clopidogrel, clozapine (Clozaril), Coenzyme Q, Creatine, dabigatran, dalteparin, Dapsone, Davunetide, Deferiprone, Depakene, Depakote ER, Depakote, Desmoteplase, Diastat, Diazepam, Digoxin, Dilantin, Dimebon, dipyridamole, divalproex (Depakote), Donepezil (Aricept), EGb 761, Eldepryl, ELND002 (Elan Pharmaceuticals), Enalapril, enoxaparin, Entacapone (Comtan), epoetin alfa, Eptifibatide, Erythropoietin, Escitalopram, Eslicarbazepine acetate, Esmolol, Ethosuximide, Ethyl-EPA (Miraxion), Exenatide, Extavia, Ezogabine, Felbamate, Felbatol, Fingolimod (Gilenya), fluoxetine (Prozac), fondaparinux, Fragmin, Frisium, Gabapentin, Gabitril, Galantamine, Glatiramer (Copaxone), haloperidol (Haldol), Heparin, human chorionic gonadotropin (hCG), Idebenone, Inovelon, insulin, Interferon beta 1a, Interferon beta 1b, ioflupane 1231 (DATSCAN), IPX066 (Impax Laboratories Inc.), JNJ-26489112 (Johnson and Johnson), Keppra, Klonopin, Lacosamide, L-Alpha glycerylphosphorylcholine, Lamictal, Lamotrigine, Levetiracetam, liraglutide, Lisinopril, Lithium carbonate, Lopressor, Lorazepam, losartan, Lovenox, Lu AA24493, Luminal, LY450139 (Eli Lilly), Lyrica, Masitinib, Mecobalamin, Memantine, methylprednisolone, metoprolol tartrate, Minitran, Minocycline, mirtazapine, Mitoxantrone (Novantrone), Mysoline, Natalizumab (Tysabri), Neurontin, Niacinamide, Nitro-Bid, Nitro-Dur, nitroglycerin, Nitrolingual, Nitromist, Nitrostat, Nitro-Time, Norepinephrine (NOR), Carbamazepine, octreotide, Onfi, Oxcarbazepine, Oxybutinin chloride, PF-04360365 (Pfizer), Phenobarbital, Phenytek, Phenytoin, piclozotan, Pioglitazone, Plavix, Potiga, Pramipexole (Mirapex), pramlintide, Prednisone, Primidone, Prinivil, probenecid, Propranolol, PRX-00023 (EPIX Pharmaceuticals Inc.), PXT3003, Quinacrine, Ramelteon, Rasagiline (Azilect), Rebif, ReciGen, remacemide, Resveratrol, Retavase, reteplase, riluzole (Rilutek), Rivastigmine (Exelon), Ropinirole (Requip), Rotigotine (Neupro), Rufinamide, Sabril, safinamide (EMD Serono), Salagen, Sarafem, Selegiline (1-deprenyl, Eldepryl), SEN0014196 (Siena Biotech), sertraline (Zoloft), Simvastatin, Sodium Nitroprussiate (NPS), sodium phenylbutyrate, Stanback Headache Powder, Tacrine (Cognex), Tamoxifen, tauroursodeoxycholic acid (TUDCA), Tegretol, Tenecteplase, Tenormin, Tetrabenazine (Xenazine), THR-18 (Thrombotech Ltd.), Tiagabine, Tideglusib, tirofiban, tissue plasminogen activator (tPA), tizanidine (Zanaflex), TNKase, Tolcapone (Tasmar), Tolterodine, Topamax, Topiramate, Trihexyphenidyl (formerly Artane), Trileptal, ursodiol, Valproic Acid, valsartan, Varenicline (Pfizer), Vimpat, Vitamin E, Warfarin, Zarontin, Zestril, Zonegran, Zonisamide, Zydis selegiline HCL Oral disintegrating (Zelapar), and combinations thereof.
[0060] Another embodiment of the present invention is a method for treating or ameliorating the effects of a condition associated with increased protein disulfide isomerase (PDI) activity in a subject in need thereof comprising administering to the subject an effective amount of a compound selected from the group consisting of:
##STR00053##
combinations thereof,
or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
[0061] In one aspect of this embodiment the compound is
##STR00054##
or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
[0062] In another aspect of this embodiment the subject is a mammal. In some aspects of this embodiment the mammal is selected from the group consisting of humans, veterinary animals, and agricultural animals. In another aspect of this embodiment the subject is a human.
[0063] In one aspect of this embodiment the condition is a protein folding disorder. In another aspect of this embodiment the condition is cancer. In yet another aspect of this embodiment the condition is HIV. In yet another aspect of this embodiment the condition is a blood clot.
[0064] Another embodiment of the present invention is a method of modulating PDI activity in a cell comprising contacting the cell with an effective amount of a compound selected from the group consisting of:
##STR00055##
combinations thereof,
or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
[0065] In one aspect of this embodiment the compound is
##STR00056##
or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
[0066] Another embodiment of the present invention is a method for treating or ameliorating the effects of a neurodegenerative disorder in a subject in need thereof comprising administering to the subject an effective amount of a compound selected from the group consisting of formula (I)
##STR00057##
formula (II)
##STR00058##
formula (III)
##STR00059##
and formula (IV):
##STR00060##
wherein a dashed line indicates the presence of an optional double bond,
wherein W, X, Y and Z are independently selected from the group consisting of C, N, S and O,
wherein R.sub.1, R.sub.2, R.sub.3, and R.sub.4 are independently selected from the group consisting of H, D, O, halo, C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl, wherein the C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl may be optionally substituted with an atom or a group selected from the group consisting of halo, C.sub.1-4alkyl, CF.sub.3, and combinations thereof,
wherein R.sub.5, R.sub.6, R.sub.7, R.sub.8 and R.sub.10 are independently selected from the group consisting of no atom, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S),
wherein R.sub.9 and R.sub.11 are independently selected from the group consisting of H, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S),
wherein R is selected from the group consisting of H, D, O, halo, C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl, wherein the C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl may be optionally substituted with an atom or a group selected from the group consisting of halo, C.sub.1-4alkyl, CF.sub.3, and combinations thereof,
or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
[0067] The term aliphatic, as used herein, refers to a group composed of carbon and hydrogen atoms that do not contain aromatic rings. Accordingly, aliphatic groups include alkyl, alkenyl, alkynyl, and carbocyclyl groups. Additionally, unless otherwise indicated, the term aliphatic is intended to include both unsubstituted aliphatics and substituted aliphatics, the latter of which refers to aliphatic moieties having substituents replacing a hydrogen on one or more carbons of the aliphatic group. Such substituents can include, for example, a halogen, a deuterium, a hydroxyl, a carbonyl (such as a carboxyl, an alkoxycarbonyl, a formyl, or an acyl), a thiocarbonyl (such as a thioester, a thioacetate, or a thioformate), an alkoxyl, a phosphoryl, a phosphate, a phosphonate, a phosphinate, an amino, an amido, an amidine, an imine, a cyano, a nitro, an azido, a sulfhydryl, an alkylthio, a sulfate, a sulfonate, a sulfamoyl, a sulfonamido, a sulfonyl, a heterocyclyl, an aralkyl, an aromatic, or heteroaromatic moiety.
[0068] The term alkyl refers to the radical of saturated aliphatic groups that does not have a ring structure, including straight-chain alkyl groups, and branched-chain alkyl groups. In certain embodiments, a straight chain or branched chain alkyl has 6 or fewer carbon atoms in its backbone (e.g., C.sub.1-C.sub.6 for straight chains, C.sub.3-C.sub.6 for branched chains). Such substituents include all those contemplated for aliphatic groups, except where stability is prohibitive.
[0069] Moreover, unless otherwise indicated, the term alkyl as used throughout the specification, examples, and claims is intended to include both unsubstituted alkyls and substituted alkyls, the latter of which refers to alkyl moieties having substituents replacing a hydrogen on one or more carbons of the hydrocarbon backbone. Indeed, unless otherwise indicated, all groups recited herein are intended to include both substituted and unsubstituted options.
[0070] The term alkenyl, as used herein, refers to an aliphatic group containing at least one double bond and unless otherwise indicated, is intended to include both unsubstituted alkenyls and substituted alkenyls, the latter of which refers to alkenyl moieties having substituents replacing a hydrogen on one or more carbons of the alkenyl group. Such substituents include all those contemplated for aliphatic groups, as discussed below, except where stability is prohibitive. For example, substitution of alkenyl groups by one or more alkyl, carbocyclyl, aryl, heterocyclyl, or heteroaryl groups is contemplated.
[0071] The term C.sub.x-y when used in conjunction with a chemical moiety, such as, alkyl and cycloalkyl, is meant to include groups that contain from x to y carbons in the chain. For example, the term C.sub.x-yalkyl refers to substituted or unsubstituted saturated hydrocarbon groups, including straight-chain alkyl and branched-chain alkyl groups that contain from x to y carbons in the chain, including haloalkyl groups such as trifluoromethyl and 2,2,2-tirfluoroethyl, etc.
[0072] The terms amine and amino are art-recognized and refer to both unsubstituted and substituted amines and salts thereof, e.g., a moiety that can be represented by
##STR00061##
wherein R.sup.7, R.sup.8, and R.sup.8 each independently represent a hydrogen or a hydrocarbyl group, or R.sup.7 and R.sup.8 taken together with the N atom to which they are attached complete a heterocycle having from 4 to 8 atoms in the ring structure. The term primary amine means only one of R.sup.7 and R.sup.8 or one of R.sup.7, R.sup.8, and R.sup.8 is a hydrocarbyl group. Secondary amines have two hydrocarbyl groups bound to N. In tertiary amines, all three groups, R.sup.7, R.sup.8, and R.sup.8, are replaced by hydrocarbyl groups.
[0073] The term aryl as used herein includes substituted or unsubstituted single-ring aromatic groups in which each atom of the ring is carbon. Preferably the ring is a 3- to 8-membered ring, more preferably a 6-membered ring. The term aryl also includes polycyclic ring systems having two or more cyclic rings in which two or more carbons are common to two adjoining rings wherein at least one of the rings is aromatic, e.g., the other cyclic rings can be cycloalkyls, cycloalkenyls, cycloalkynyls, aryls, heteroaryls, and/or heterocyclyls. Aryl groups include benzene, naphthalene, phenanthrene, phenol, aniline, and the like.
[0074] The term alkyl-aryl refers to an alkyl group substituted with at least one aryl group.
[0075] The terms halo and halogen are used interchangeably herein and mean halogen and include chloro, fluoro, bromo, and iodo.
[0076] The term heterocycle refers to substituted or unsubstituted non-aromatic ring structures, preferably 3- to 8-membered rings, whose ring structures include at least one heteroatom, preferably one to four heteroatoms, more preferably one or two heteroatoms. The term heterocycle also includes polycyclic ring systems having two or more cyclic rings in which two or more carbons are common to two adjoining rings wherein at least one of the rings is heterocyclic, e.g., the other cyclic rings can be cycloalkyls, cycloalkenyls, cycloalkynyls, aryls, heteroaryls, and/or heterocyclyls. Heterocycle groups include, for example, piperidine, piperazine, pyrrolidine, morpholine, lactones, lactams, and the like.
[0077] The term heteroatom as used herein means an atom of any element other than carbon or hydrogen. Preferred heteroatoms are nitrogen, oxygen, and sulfur; more preferably, nitrogen and oxygen.
[0078] The term substituted refers to moieties having substituents replacing a hydrogen on one or more carbons of the backbone. It will be understood that substitution or substituted with includes the implicit proviso that such substitution is in accordance with the permitted valence of the substituted atom and the substituent, and that the substitution results in a stable compound, e.g., which does not spontaneously undergo transformation such as by rearrangement, cyclization, elimination, etc. As used herein, the term substituted is contemplated to include all permissible substituents of organic compounds. In a broad aspect, the permissible substituents include acyclic and cyclic, branched and unbranched, carbocyclic and heterocyclic, aromatic and non-aromatic substituents of organic compounds. The permissible substituents can be one or more and the same or different for appropriate organic compounds. For purposes of this invention, the heteroatoms such as nitrogen may have hydrogen substituents and/or any permissible substituents of organic compounds described herein which satisfy the valences of the heteroatoms. Substituents can include any substituents described herein, for example, a halogen, a hydroxyl, a carbonyl (such as a carboxyl, an alkoxycarbonyl, a formyl, or an acyl), a thiocarbonyl (such as a thioester, a thioacetate, or a thioformate), an alkoxyl, a phosphoryl, a phosphate, a phosphonate, a phosphinate, an amino, an amido, an amidine, an imine, a cyano, a nitro, an azido, a sulfhydryl, an alkylthio, a sulfate, a sulfonate, a sulfamoyl, a sulfonamido, a sulfonyl, a heterocyclyl, an aralkyl, or an aromatic or heteroaromatic moiety. It will be understood by those skilled in the art that the moieties substituted on the hydrocarbon chain can themselves be substituted, if appropriate.
[0079] As set forth previously, unless specifically stated as unsubstituted, references to chemical moieties herein are understood to include substituted variants. For example, reference to an aryl group or moiety implicitly includes both substituted and unsubstituted variants.
[0080] In one aspect of this embodiment the neurodegenerative disease is selected from the group consisting of Alzheimer's disease, Parkinson's disease, amyotrophic lateral sclerosis (ALS), Friedreich's ataxia, multiple sclerosis, Huntington's Disease, transmissible spongiform encephalopathy, Charcot-Marie-Tooth disease, dementia with Lewy bodies, corticobasal degeneration, progressive supranuclear palsy, and hereditary spastic paraparesis. In a preferred embodiment, the neurodegenerative disease is Huntington's Disease.
[0081] In one aspect of this embodiment the compound is
##STR00062##
or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
[0082] In another aspect of this embodiment the subject is a mammal. In some aspects of this embodiment the mammal is selected from the group consisting of humans, veterinary animals, and agricultural animals. In another aspect of this embodiment the subject is a human.
[0083] In one aspect of this embodiment the method further comprises co-administering to the subject an effective amount of one or more additional therapeutic agents. Preferably, the one or more additional therapeutic agents are selected from the group consisting of 5-hydroxytryptophan, Activase, AFQ056 (Novartis), Aggrastat, Albendazole, alpha-lipoic acid/L-acetyl carnitine, Alteplase, Amantadine (Symmetrel), amlodipine, Ancrod, Apomorphine (Apokyn), Arimoclomol, Arixtra, Armodafinil, Ascorbic acid, Ascriptin, Aspirin, atenolol, Avonex, baclofen (Lioresal), Banzel, Benztropine (Cogentin), Betaseron, BGG492 (Novartis Corp.), Botulinum toxin, Bufferin, Carbatrol, Carbidopa/levodopa immediate-release (Sinemet), Carbidopa/levodopa oral disintegrating (Parcopa), Carbidopa/levodopa/Entacapone (Stalevo), CERE-110: Adeno-Associated Virus Delivery of NGF (Ceregene), cerebrolysin, CinnoVex, citalopram, citicoline, Clobazam, Clonazepam, Clopidogrel, clozapine (Clozaril), Coenzyme Q, Creatine, dabigatran, dalteparin, Dapsone, Davunetide, Deferiprone, Depakene, Depakote ER, Depakote, Desmoteplase, Diastat, Diazepam, Digoxin, Dilantin, Dimebon, dipyridamole, divalproex (Depakote), Donepezil (Aricept), EGb 761, Eldepryl, ELND002 (Elan Pharmaceuticals), Enalapril, enoxaparin, Entacapone (Comtan), epoetin alfa, Eptifibatide, Erythropoietin, Escitalopram, Eslicarbazepine acetate, Esmolol, Ethosuximide, Ethyl-EPA (Miraxion), Exenatide, Extavia, Ezogabine, Felbamate, Felbatol, Fingolimod (Gilenya), fluoxetine (Prozac), fondaparinux, Fragmin, Frisium, Gabapentin, Gabitril, Galantamine, Glatiramer (Copaxone), haloperidol (Haldol), Heparin, human chorionic gonadotropin (hCG), Idebenone, Inovelon, insulin, Interferon beta 1a, Interferon beta 1b, ioflupane 1231 (DATSCAN), IPX066 (Impax Laboratories Inc.), JNJ-26489112 (Johnson and Johnson), Keppra, Klonopin, Lacosamide, L-Alpha glycerylphosphorylcholine, Lamictal, Lamotrigine, Levetiracetam, liraglutide, Lisinopril, Lithium carbonate, Lopressor, Lorazepam, losartan, Lovenox, Lu AA24493, Luminal, LY450139 (Eli Lilly), Lyrica, Masitinib, Mecobalamin, Memantine, methylprednisolone, metoprolol tartrate, Minitran, Minocycline, mirtazapine, Mitoxantrone (Novantrone), Mysoline, Natalizumab (Tysabri), Neurontin, Niacinamide, Nitro-Bid, Nitro-Dur, nitroglycerin, Nitrolingual, Nitromist, Nitrostat, Nitro-Time, Norepinephrine (NOR), Carbamazepine, octreotide, Onfi, Oxcarbazepine, Oxybutinin chloride, PF-04360365 (Pfizer), Phenobarbital, Phenytek, Phenytoin, piclozotan, Pioglitazone, Plavix, Potiga, Pramipexole (Mirapex), pramlintide, Prednisone, Primidone, Prinivil, probenecid, Propranolol, PRX-00023 (EPIX Pharmaceuticals Inc.), PXT3003, Quinacrine, Ramelteon, Rasagiline (Azilect), Rebif, ReciGen, remacemide, Resveratrol, Retavase, reteplase, riluzole (Rilutek), Rivastigmine (Exelon), Ropinirole (Requip), Rotigotine (Neupro), Rufinamide, Sabril, safinamide (EMD Serono), Salagen, Sarafem, Selegiline (1-deprenyl, Eldepryl), SEN0014196 (Siena Biotech), sertraline (Zoloft), Simvastatin, Sodium Nitroprussiate (NPS), sodium phenylbutyrate, Stanback Headache Powder, Tacrine (Cognex), Tamoxifen, tauroursodeoxycholic acid (TUDCA), Tegretol, Tenecteplase, Tenormin, Tetrabenazine (Xenazine), THR-18 (Thrombotech Ltd.), Tiagabine, Tideglusib, tirofiban, tissue plasminogen activator (tPA), tizanidine (Zanaflex), TNKase, Tolcapone (Tasmar), Tolterodine, Topamax, Topiramate, Trihexyphenidyl (formerly Artane), Trileptal, ursodiol, Valproic Acid, valsartan, Varenicline (Pfizer), Vimpat, Vitamin E, Warfarin, Zarontin, Zestril, Zonegran, Zonisamide, Zydis selegiline HCL Oral disintegrating (Zelapar), and combinations thereof.
[0084] Another embodiment of the present invention is a method of treating or ameliorating the effects of a condition associated with increased protein disulfide isomerase (PDI) activity in a subject in need thereof comprising administering to the subject an effective amount of a compound selected from the group consisting of formula (I)
##STR00063##
formula (II)
##STR00064##
formula (III)
##STR00065##
and formula (IV):
##STR00066##
wherein a dashed line indicates the presence of an optional double bond,
wherein W, X, Y and Z are independently selected from the group consisting of C, N, S and O,
wherein R.sub.1, R.sub.2, R.sub.3, and R.sub.4 are independently selected from the group consisting of H, D, O, halo, C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl, wherein the C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl may be optionally substituted with an atom or a group selected from the group consisting of halo, C.sub.1-4alkyl, CF.sub.3, and combinations thereof,
wherein R.sub.5, R.sub.6, R.sub.7, R.sub.8 and R.sub.10 are independently selected from the group consisting of no atom, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S),
wherein R.sub.9 and R.sub.11 are independently selected from the group consisting of H, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S),
wherein R is selected from the group consisting of H, D, O, halo, C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl, wherein the C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl may be optionally substituted with an atom or a group selected from the group consisting of halo, C.sub.1-4alkyl, CF.sub.3, and combinations thereof,
or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
[0085] In another aspect of this embodiment the subject is a mammal. In some aspects of this embodiment the mammal is selected from the group consisting of humans, veterinary animals, and agricultural animals. In another aspect of this embodiment the subject is a human.
[0086] In one aspect of this embodiment the condition is a protein folding disorder. In another aspect of this embodiment the condition is cancer. In yet another aspect of this embodiment the condition is HIV. In yet another aspect of this embodiment the condition is a blood clot.
[0087] Another embodiment of the present invention is a method of modulating PDI activity in a cell comprising contacting the cell with an effective amount of a compound selected from the group consisting of formula (I)
##STR00067##
formula (II)
##STR00068##
formula (III)
##STR00069##
and formula (IV):
##STR00070##
wherein a dashed line indicates the presence of an optional double bond,
wherein W, X, Y and Z are independently selected from the group consisting of C, N, S and O,
wherein R.sub.1, R.sub.2, R.sub.3, and R.sub.4 are independently selected from the group consisting of H, D, O, halo, C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl, wherein the C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl may be optionally substituted with an atom or a group selected from the group consisting of halo, C.sub.1-4alkyl, CF.sub.3, and combinations thereof,
wherein R.sub.5, R.sub.6, R.sub.7, R.sub.8 and R.sub.10 are independently selected from the group consisting of no atom, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S),
wherein R.sub.9 and R.sub.11 are independently selected from the group consisting of H, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S),
wherein R is selected from the group consisting of H, D, O, halo, C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl, wherein the C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl may be optionally substituted with an atom or a group selected from the group consisting of halo, C.sub.1-4alkyl, CF.sub.3, and combinations thereof,
or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
[0088] Another embodiment of the present invention is a compound having the
##STR00071##
wherein a dashed line indicates the presence of an optional double bond,
wherein W, X, Y and Z are independently selected from the group consisting of C, N, S and O,
wherein R.sub.1, R.sub.2, R.sub.3, and R.sub.4 are independently selected from the group consisting of H, D, O, halo, C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl, wherein the C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl may be optionally substituted with an atom or a group selected from the group consisting of halo, C.sub.1-4alkyl, CF.sub.3, and combinations thereof,
wherein R.sub.5, R.sub.6, R.sub.7, R.sub.8 and R.sub.10 are independently selected from the group consisting of no atom, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S),
wherein R.sub.9 and R.sub.11 are independently selected from the group consisting of H, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S),
wherein R is selected from the group consisting of H, D, O, halo, C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl, wherein the C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl may be optionally substituted with an atom or a group selected from the group consisting of halo, C.sub.1-4alkyl, CF.sub.3, and combinations thereof,
with the proviso that the compound is not
##STR00072##
or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
[0089] Another embodiment of the present invention is a compound having the formula (Ia)
##STR00073##
wherein a dashed line indicates the presence of an optional double bond,
wherein W, X, and Z are independently selected from the group consisting of C, N, S and O,
wherein Y is selected from the group consisting of C, N, Se, S and O, or another group VI atom,
wherein R.sub.1, R.sub.2, R.sub.3, and R.sub.4 are independently selected from the group consisting of H, D, O, halo, C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl, wherein the C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl may be optionally substituted with an atom or a group selected from the group consisting of halo, C.sub.1-4alkyl, CF.sub.3, and combinations thereof,
wherein R.sub.5, R.sub.6, R.sub.7, R.sub.8 and R.sub.10 are independently selected from the group consisting of no atom, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S),
wherein R.sub.9 and R.sub.11 are independently selected from the group consisting of H, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S),
wherein R is selected from the group consisting of H, D, O, halo, C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl, wherein the C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl may be optionally substituted with an atom or a group selected from the group consisting of halo, C.sub.1-4alkyl, CF.sub.3, and combinations thereof,
with the proviso that the compound is not
##STR00074##
or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
[0090] Another embodiment of the present invention is a compound having the formula (II)
##STR00075##
wherein a dashed line indicates the presence of an optional double bond,
wherein X is selected from the group consisting of S and Se,
wherein R.sub.1, R.sub.2, R.sub.3, and R.sub.4 are independently selected from the group consisting of H, D, O, halo, C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl, wherein the C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl may be optionally substituted with an atom or a group selected from the group consisting of halo, C.sub.1-4alkyl, CF.sub.3, and combinations thereof,
wherein R.sub.5 is selected from the group consisting of C.sub.1-4alkyl, C(O)NH, C(O), C(O)O, NH and O,
wherein R.sub.6, is -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S),
wherein R.sub.7 and R.sub.8 are independently selected from the group consisting of no atom, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S),
wherein R.sub.9 is selected from the group consisting of H, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S),
wherein R.sub.10 is selected from the group consisting of no atom and O,
wherein R.sub.11 is selected from the group consisting of O and -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S),
wherein R is selected from the group consisting of H, D, O, halo, C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl, wherein the C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl may be optionally substituted with an atom or a group selected from the group consisting of halo, C.sub.1-4alkyl, CF.sub.3, and combinations thereof, with the proviso that the compound is not
##STR00076##
or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
[0091] In one aspect of this embodiment the compound is
##STR00077##
or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
[0092] Another embodiment of the present invention is a compound having the formula (III)
##STR00078##
wherein X is selected from the group consisting of S and Se,
wherein R.sub.6, is selected from the group consisting of the group consisting of phenyl,
##STR00079##
wherein a wavy line indicates an attachment point to the molecule,
wherein R.sub.7 and R.sub.8 are independently selected from the group consisting of no atom, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S),
wherein R.sub.9 is selected from the group consisting of H, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S),
wherein R is selected from the group consisting of H, D, O, halo, C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl, wherein the C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl may be optionally substituted with an atom or a group selected from the group consisting of halo, C.sub.1-4alkyl, CF.sub.3, and combinations thereof, with the proviso that the compound is not
##STR00080##
or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
[0093] In one aspect of this embodiment the compound is selected from the group consisting of
##STR00081## ##STR00082## ##STR00083##
and combinations thereof.
[0094] Another embodiment of the present invention is a composition comprising a compound of the present invention and a pharmaceutically acceptable carrier, adjuvant or vehicle.
[0095] Another embodiment of the present invention is a pharmaceutically acceptable salt of a compound of the present invention.
[0096] Another embodiment of the present invention is a composition comprising a pharmaceutically acceptable salt of the present invention and a pharmaceutically acceptable carrier, adjuvant or vehicle.
[0097] Another embodiment of the invention is a kit comprising a compound or composition of the present invention and instructions for use.
[0098] In one aspect of this embodiment, the instructions for use are instructions for treating or ameliorating the effects of a neurodegenerative disorder in a subject. In another aspect of this embodiment, the instruction for use are instructions for treating or ameliorating the effects of a condition associated with increased protein disulfide isomerase (PDI) activity in a subject. In another aspect of this embodiment, the instructions for use are instructions for modulating PDI activity in a cell.
[0099] Another embodiment of the invention is a method for treating or ameliorating the effects of a neurodegenerative disorder in a subject in need thereof comprising administering to the subject an effective amount of a compound selected from the group consisting of formula (Ia)
##STR00084##
wherein a dashed line indicates the presence of an optional double bond,
wherein W, X, and Z are independently selected from the group consisting of C, N, S and O,
wherein Y is selected from the group consisting of C, N, Se, S and O, or another group VI atom,
wherein R.sub.1, R.sub.2, R.sub.3, and R.sub.4 are independently selected from the group consisting of H, D, O, halo, C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl, wherein the C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl may be optionally substituted with an atom or a group selected from the group consisting of halo, C.sub.1-4alkyl, CF.sub.3, and combinations thereof,
wherein R.sub.5, R.sub.6, R.sub.7, R.sub.8 and R.sub.10 are independently selected from the group consisting of no atom, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S),
wherein R.sub.9 and R.sub.11 are independently selected from the group consisting of H, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S),
wherein R is selected from the group consisting of H, D, O, halo, C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl, wherein the C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl may be optionally substituted with an atom or a group selected from the group consisting of halo, C.sub.1-4alkyl, CF.sub.3, and combinations thereof,
or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof;
formula (II)
##STR00085##
wherein a dashed line indicates the presence of an optional double bond,
wherein X is selected from the group consisting of S and Se,
wherein R.sub.1, R.sub.2, R.sub.3, and R.sub.4 are independently selected from the group consisting of H, D, O, halo, C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl, wherein the C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl may be optionally substituted with an atom or a group selected from the group consisting of halo, C.sub.1-4alkyl, CF.sub.3, and combinations thereof,
wherein R.sub.5 is selected from the group consisting of C.sub.1-4alkyl, C(O)NH, C(O), C(O)O, NH and O,
wherein R.sub.6, is -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S),
wherein R.sub.7 and R.sub.8 are independently selected from the group consisting of no atom, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S),
wherein R.sub.9 is selected from the group consisting of H, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S),
wherein R.sub.10 is selected from the group consisting of no atom and O,
wherein R.sub.11 is selected from the group consisting of O and -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S),
wherein R is selected from the group consisting of H, D, O, halo, C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl, wherein the C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl may be optionally substituted with an atom or a group selected from the group consisting of halo, C.sub.1-4alkyl, CF.sub.3, and combinations thereof,
or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof; and
##STR00086##
or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
[0100] Another embodiment of the invention is a method for treating or ameliorating the effects of a neurodegenerative disorder in a subject in need thereof comprising administering to the subject an effective amount of a composition of the invention.
[0101] In one aspect of the above embodiments the neurodegenerative disease is selected from the group consisting of Alzheimer's disease, Parkinson's disease, amyotrophic lateral sclerosis (ALS), Friedreich's ataxia, multiple sclerosis, Huntington's Disease, transmissible spongiform encephalopathy, Charcot-Marie-Tooth disease, dementia with Lewy bodies, corticobasal degeneration, progressive supranuclear palsy, and hereditary spastic paraparesis. In a preferred embodiment, the neurodegenerative disease is Huntington's Disease.
[0102] In one aspect of the above embodiments the subject is a mammal. In some aspects of this embodiment the mammal is selected from the group consisting of humans, veterinary animals, and agricultural animals. In another aspect of this embodiment the subject is a human.
[0103] In one aspect of the above embodiments the method further comprises co-administering to the subject an effective amount of one or more additional therapeutic agents. Preferably, the one or more additional therapeutic agents are selected from the group consisting of 5-hydroxytryptophan, Activase, AFQ056 (Novartis), Aggrastat, Albendazole, alpha-lipoic acid/L-acetyl carnitine, Alteplase, Amantadine (Symmetrel), amlodipine, Ancrod, Apomorphine (Apokyn), Arimoclomol, Arixtra, Armodafinil, Ascorbic acid, Ascriptin, Aspirin, atenolol, Avonex, baclofen (Lioresal), Banzel, Benztropine (Cogentin), Betaseron, BGG492 (Novartis Corp.), Botulinum toxin, Bufferin, Carbatrol, Carbidopa/levodopa immediate-release (Sinemet), Carbidopa/levodopa oral disintegrating (Parcopa), Carbidopa/levodopa/Entacapone (Stalevo), CERE-110: Adeno-Associated Virus Delivery of NGF (Ceregene), cerebrolysin, CinnoVex, citalopram, citicoline, Clobazam, Clonazepam, Clopidogrel, clozapine (Clozaril), Coenzyme Q, Creatine, dabigatran, dalteparin, Dapsone, Davunetide, Deferiprone, Depakene, Depakote ER, Depakote, Desmoteplase, Diastat, Diazepam, Digoxin, Dilantin, Dimebon, dipyridamole, divalproex (Depakote), Donepezil (Aricept), EGb 761, Eldepryl, ELND002 (Elan Pharmaceuticals), Enalapril, enoxaparin, Entacapone (Comtan), epoetin alfa, Eptifibatide, Erythropoietin, Escitalopram, Eslicarbazepine acetate, Esmolol, Ethosuximide, Ethyl-EPA (Miraxion), Exenatide, Extavia, Ezogabine, Felbamate, Felbatol, Fingolimod (Gilenya), fluoxetine (Prozac), fondaparinux, Fragmin, Frisium, Gabapentin, Gabitril, Galantamine, Glatiramer (Copaxone), haloperidol (Haldol), Heparin, human chorionic gonadotropin (hCG), Idebenone, Inovelon, insulin, Interferon beta 1a, Interferon beta 1b, ioflupane 1231 (DATSCAN), IPX066 (Impax Laboratories Inc.), JNJ-26489112 (Johnson and Johnson), Keppra, Klonopin, Lacosamide, L-Alpha glycerylphosphorylcholine, Lamictal, Lamotrigine, Levetiracetam, liraglutide, Lisinopril, Lithium carbonate, Lopressor, Lorazepam, losartan, Lovenox, Lu AA24493, Luminal, LY450139 (Eli Lilly), Lyrica, Masitinib, Mecobalamin, Memantine, methylprednisolone, metoprolol tartrate, Minitran, Minocycline, mirtazapine, Mitoxantrone (Novantrone), Mysoline, Natalizumab (Tysabri), Neurontin, Niacinamide, Nitro-Bid, Nitro-Dur, nitroglycerin, Nitrolingual, Nitromist, Nitrostat, Nitro-Time, Norepinephrine (NOR), Carbamazepine, octreotide, Onfi, Oxcarbazepine, Oxybutinin chloride, PF-04360365 (Pfizer), Phenobarbital, Phenytek, Phenytoin, piclozotan, Pioglitazone, Plavix, Potiga, Pramipexole (Mirapex), pramlintide, Prednisone, Primidone, Prinivil, probenecid, Propranolol, PRX-00023 (EPIX Pharmaceuticals Inc.), PXT3003, Quinacrine, Ramelteon, Rasagiline (Azilect), Rebif, ReciGen, remacemide, Resveratrol, Retavase, reteplase, riluzole (Rilutek), Rivastigmine (Exelon), Ropinirole (Requip), Rotigotine (Neupro), Rufinamide, Sabril, safinamide (EMD Serono), Salagen, Sarafem, Selegiline (1-deprenyl, Eldepryl), SEN0014196 (Siena Biotech), sertraline (Zoloft), Simvastatin, Sodium Nitroprussiate (NPS), sodium phenylbutyrate, Stanback Headache Powder, Tacrine (Cognex), Tamoxifen, tauroursodeoxycholic acid (TUDCA), Tegretol, Tenecteplase, Tenormin, Tetrabenazine (Xenazine), THR-18 (Thrombotech Ltd.), Tiagabine, Tideglusib, tirofiban, tissue plasminogen activator (tPA), tizanidine (Zanaflex), TNKase, Tolcapone (Tasmar), Tolterodine, Topamax, Topiramate, Trihexyphenidyl (formerly Artane), Trileptal, ursodiol, Valproic Acid, valsartan, Varenicline (Pfizer), Vimpat, Vitamin E, Warfarin, Zarontin, Zestril, Zonegran, Zonisamide, Zydis selegiline HCL Oral disintegrating (Zelapar), and combinations thereof.
[0104] In one aspect of the above embodiments the compound is selected from the group consisting of
##STR00087## ##STR00088## ##STR00089##
and combinations thereof.
[0105] Another embodiment of the invention is a method for treating or ameliorating the effects of a condition associated with increased protein disulfide isomerase (PDI) activity in a subject in need thereof comprising administering to the subject an effective amount of a compound selected from the group consisting of formula (Ia)
##STR00090##
wherein a dashed line indicates the presence of an optional double bond,
wherein W, X, and Z are independently selected from the group consisting of C, N, S and O,
wherein Y is selected from the group consisting of C, N, Se, S and O, or another group VI atom,
wherein R.sub.1, R.sub.2, R.sub.3, and R.sub.4 are independently selected from the group consisting of H, D, O, halo, C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl, wherein the C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl may be optionally substituted with an atom or a group selected from the group consisting of halo, C.sub.1-4alkyl, CF.sub.3, and combinations thereof,
wherein R.sub.5, R.sub.6, R.sub.7, R.sub.8 and R.sub.10 are independently selected from the group consisting of no atom, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S),
wherein R.sub.9 and R.sub.11 are independently selected from the group consisting of H, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S),
wherein R is selected from the group consisting of H, D, O, halo, C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl, wherein the C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl may be optionally substituted with an atom or a group selected from the group consisting of halo, C.sub.1-4alkyl, CF.sub.3, and combinations thereof, or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof;
##STR00091##
wherein a dashed line indicates the presence of an optional double bond,
wherein X is selected from the group consisting of S and Se,
wherein R.sub.1, R.sub.2, R.sub.3, and R.sub.4 are independently selected from the group consisting of H, D, O, halo, C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl, wherein the C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl may be optionally substituted with an atom or a group selected from the group consisting of halo, C.sub.1-4alkyl, CF.sub.3, and combinations thereof,
wherein R.sub.5 is selected from the group consisting of C.sub.1-4alkyl, C(O)NH, C(O), C(O)O, NH and O,
wherein R.sub.6, is -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S),
wherein R.sub.7 and R.sub.8 are independently selected from the group consisting of no atom, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S),
wherein R.sub.9 is selected from the group consisting of H, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S),
wherein R.sub.10 is selected from the group consisting of no atom and O,
wherein R.sub.11 is selected from the group consisting of O and -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S),
wherein R is selected from the group consisting of H, D, O, halo, C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl, wherein the C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl may be optionally substituted with an atom or a group selected from the group consisting of halo, C.sub.1-4alkyl, CF.sub.3, and combinations thereof,
or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof; and
##STR00092##
or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
[0106] Another embodiment of the invention is a method for treating or ameliorating the effects of a condition associated with increased protein disulfide isomerase (PDI) activity in a subject in need thereof comprising administering to the subject an effective amount of a composition of the present invention.
[0107] In one aspect of the above embodiments the subject is a mammal. In some aspects of this embodiment the mammal is selected from the group consisting of humans, veterinary animals, and agricultural animals. In another aspect of this embodiment the subject is a human.
[0108] In one aspect of the above embodiments the condition is selected from the group consisting of a protein folding disorder, cancer, HIV, and a blood clot.
[0109] In one aspect of the above embodiments the compound is selected from the group consisting of
##STR00093## ##STR00094## ##STR00095##
and combinations thereof.
[0110] Another embodiment of the invention is a method of modulating PDI activity in a cell comprising administering to the subject an effective amount of a compound selected from the group consisting of formula (Ia)
##STR00096##
wherein a dashed line indicates the presence of an optional double bond,
wherein W, X, and Z are independently selected from the group consisting of C, N, S and O,
wherein Y is selected from the group consisting of C, N, Se, S and O, or another group VI atom,
wherein R.sub.1, R.sub.2, R.sub.3, and R.sub.4 are independently selected from the group consisting of H, D, O, halo, C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl, wherein the C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl may be optionally substituted with an atom or a group selected from the group consisting of halo, C.sub.1-4alkyl, CF.sub.3, and combinations thereof,
wherein R.sub.5, R.sub.6, R.sub.7, R.sub.8 and R.sub.10 are independently selected from the group consisting of no atom, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S),
wherein R.sub.9 and R.sub.11 are independently selected from the group consisting of H, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S),
wherein R is selected from the group consisting of H, D, O, halo, C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl, wherein the C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl may be optionally substituted with an atom or a group selected from the group consisting of halo, C.sub.1-4alkyl, CF.sub.3, and combinations thereof,
or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof;
formula (II)
##STR00097##
wherein a dashed line indicates the presence of an optional double bond,
wherein X is selected from the group consisting of S and Se,
wherein R.sub.1, R.sub.2, R.sub.3, and R.sub.4 are independently selected from the group consisting of H, D, O, halo, C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl, wherein the C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl may be optionally substituted with an atom or a group selected from the group consisting of halo, C.sub.1-4alkyl, CF.sub.3, and combinations thereof,
wherein R.sub.5 is selected from the group consisting of C.sub.1-4alkyl, C(O)NH, C(O), C(O)O, NH and O,
wherein R.sub.6, is -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S),
wherein R.sub.7 and R.sub.8 are independently selected from the group consisting of no atom, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S),
wherein R.sub.9 is selected from the group consisting of H, NR, N(R)C(O), C(O)NR, O, C(O), C(O)O, OC(O); N(R)SO2, SO2N(R), S, SO, SO2, -(optionally substituted C.sub.1-6 alkyl), -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S), C.sub.1-4 alkyl-(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S),
wherein R.sub.10 is selected from the group consisting of no atom and O,
wherein R.sub.11 is selected from the group consisting of O and -(optionally substituted mono- or polycyclic group containing 3 to 20 carbon atoms and optionally 1 to 4 heteroatoms selected from O, N and S),
wherein R is selected from the group consisting of H, D, O, halo, C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl, wherein the C.sub.1-6alkyl, C.sub.1-6alkyl-aryl, C.sub.1-6alkyl-heteroaryl, C.sub.1-6alkenyl, C.sub.1-6alkenyl-aryl, and C.sub.1-6alkenyl-heteroaryl may be optionally substituted with an atom or a group selected from the group consisting of halo, C.sub.1-4alkyl, CF.sub.3, and combinations thereof,
or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof; and
##STR00098##
or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
[0111] Another embodiment of the invention is a method of modulating PDI activity in a cell comprising administering to the subject an effective amount of a composition of the present invention.
[0112] In one aspect of the above embodiments the compound is selected from the group consisting of
##STR00099## ##STR00100## ##STR00101##
and combinations thereof.
[0113] Another embodiment of the invention is a method for treating or ameliorating the effects of a neurodegenerative disorder in a subject in need thereof comprising administering to the subject an effective amount of a compound selected from the group consisting of:
##STR00102## ##STR00103## ##STR00104##
combinations thereof, or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
[0114] Another embodiment of the invention is a method for treating or ameliorating the effects of a condition associated with increased protein disulfide isomerase (PDI) activity in a subject in need thereof comprising administering to the subject an effective amount of a compound selected from the group consisting of:
##STR00105## ##STR00106## ##STR00107##
combinations thereof, or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
[0115] Another embodiment of the invention is a method of modulating PDI activity in a cell comprising contacting the cell with an effective amount of a compound selected from the group consisting of:
##STR00108## ##STR00109## ##STR00110##
combinations thereof, or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof.
[0116] Another embodiment of the invention is a compound selected from the group consisting of:
##STR00111## ##STR00112## ##STR00113##
combinations thereof, or an N-oxide, crystalline form, hydrate thereof, or a pharmaceutically acceptable salt thereof. Compositions of the foregoing embodiments are also provided wherein one or more of the foregoing compounds are combined with a pharmaceutically acceptable carrier, adjuvant or vehicle.
[0117] In the various embodiments of the present invention, compounds may be recited as a group. It is to be understood that the present invention includes each individual compound alone or in any possible grouping of one, two, three or more compounds.
[0118] In the present invention, and as noted in the Examples, the residue numbering is based on the sequence of the mature PDI protein, dapeeedhvlvlrksnfaealaahkyllvefyapwcghckalapeyakaagklkaegseirlakvdateesdlaqqygvr gyptikffrngdtaspkeytagreaddivnwlkkrtgpaattlpdgaaaeslvessevavigffkdvesdsakqflqaaeaid dipfgitsnsdvfskyqldkdgvvlfkkfdegrnnfegevtkenlldfikhnqlplviefteqtapkifggeikthllflpksvsdyd gklsnfktaaesfkgkilfifidsdhtdnqrileffglkkeecpavrlitleeemtkykpeseeltaeritefchrflegkikphlmsq elpedwdkqpvkvlvgknfedvafdekknvfvefyapwcghckqlapiwdklgetykdheniviakmdstaneveavk vhsfptlkffpasadrtvidyngertldgfkkflesggqdgagddddledleeaeepdmeedddqkavkdel, (SEQ ID NO: 3) i.e., residue 1 of the mature PDI corresponds to residue 18 in the full length PDI. The first 17 amino acids in full length PDI are the signal sequence that is processed out to generate the mature PDI.
[0119] The following examples are provided to further illustrate certain aspects of the present invention. These examples are illustrative only and are not intended to limit the scope of the invention in any way.
EXAMPLES
Example 1
Materials and Methods
Cell Culture
[0120] PC12 mHTT.sup.Q103 cells were a gift from Erik S. Schweitzer (UCLA School of Medicine, Los Angeles, Calif.). These cells are stably transfected with the first exon of human HTT gene containing the pathogenic 103 CAG/CAA repeat expansion, under the control of the ecdysteroid promoter (Aiken et al., 2004). The plasmid also contains a Bombyx mori ecdysone receptor gene fused at N-terminal with VP16 transactivation domain (Suhr et al., 1998; Vilaboa et al., 2011). Addition of the ecdysone analog, tebufenozide, to the cell culture medium is used to initiate the transcription of mutant HTT (Aiken et al., 2004).
[0121] PC12 mHTT.sup.Q103 cells were cultured in DMEM containing 4.5 g/I glucose, 25 mM HEPES, sodium pyruvate, and no L-glutamine (Mediatech, cat. no. 15-018-CV), supplemented with 10% (v/v) Cosmic Calf serum, 2 mM L-glutamine, 100 units/mL of penicillin-streptomycin, and 0.5 mg/ml active geneticin. Cells were grown at 37 C., 9.5% CO.sub.2, and the medium was replaced with fresh medium every 2-3 days. To induce mHTT.sup.Q103 expression for experiments, tebufenozide, a gift from Lynne Moore and Fred H. Gage (The Salk Institute for Biological Studies, La Jolla, Calif.), was added to the medium at 200 nM final concentration from 1 mM stock in 85% ethanol.
High-Throughput Screen of LOC Library
[0122] LOC mother plates with compounds at 4 mg/ml were thawed and spun down (1000 rpm, 20 C., 1 min) prior to use. Biomek FX (Beckman Coulter) robotic liquid dispenser was used to handle all liquid transferring and mixing. Replica daughter plates (D1) were prepared by transferring 2 l of compound from the mother plate into 384-deep-well clear, round bottom, polypropylene plates (Grenier cat. no. 781270) containing 98 l of PC12 medium without selective agent geneticin to obtain compound concentrations at 80 l/ml in 2% DMSO. Two fold serial dilution was performed across five daughter plates by transferring 50 l of compounds (at 80 l/ml) from the D1 plate into 50 l of PC12 medium in daughter plate D2, mixing, and then repeating the process for the remaining three plates. Daughter plate D1 with compounds at 80 l/ml, daughter plate D3 with compounds at 20 l/ml and daughter plate D5 with compounds at 5 l/ml were then used for the screen. Assay plates were set up by seeding tebufenozide-induced PC12 mHTT.sup.Q103 cells into 384-well black, clear-bottom plates (Corning Inc. cat. no. 3712) at a density of 7,500 cells per well in 57 l PC12 medium without geneticin. Three microliters of compound from the daughter plates (D1, D3, and D5) were added to the assay plates for a final compound concentration of 4 l/ml, 1 l/ml, and 0.25 l/ml. Four wells containing uninduced PC12 mHTT.sup.Q103 cells and four wells containing medium only, were also included on each plate as controls. The assay plates were incubated at 37 C., 9.5% CO.sub.2 for 48 hours. Twenty microliters of 40% Alamar blue (Life Technologies cat. no. DAL1100) solution in PC12 medium was added to each well (1:10 final dilution) and the plates were incubated for an additional 12-24 hours at 37 C., 9.5% CO.sub.2. Alamar blue fluorescence was read on a fluorescence plate reader (PerkinElmer Victor3) with 530 nm excitation filter and 590 nm emission filter. Each compound concentration was tested in triplicate.
[0123] The follow-up testing of primary screen hits was performed in a similar way. Fresh powder stocks of primary hits were re-ordered from vendors, dissolved in DMSO and tested in a two-fold serial dilution across 10 wells in both tebufenozide-induced and uninduced PC12 mHTT.sup.Q103 cells. Dose-response curves were plotted as meanSD and fit to either four-parameter sigmoidal (for uninduced cells) or bell-shaped (induced) function using Prism (GraphPad Software).
Molecular Cloning, Protein Expression and Purification of PDIa
[0124] Sequence for the human catalytic PDI A1 a domain (PDIa) (SEQ ID NO: 3) was generated by PCR from Ultimate ORF Clone IOH9865 (Life Technologies) as an Nde I-BamH I fragment. The amplified a domain (amino acids 18-134 in the full length PDI sequence) was then subcloned into Nde I-BamH I sites of pET-15b vector (Novagen) containing the N-terminal His.sub.6 tag and confirmed by DNA sequencing (GeneWiz, Inc.).
[0125] The PDIa construct was transformed into Escherichia coli BL21-Gold (DE3) competent cells (Agilent Technologies) and grown at 37 C. in LB medium with 100 g/ml ampicillin until OD.sub.600 nm reached 0.5. Expression was induced with 0.5 mM IPTG at 37 C. for overnight (usually 12-15 hr). Cells were pelleted (4,000g, 20 minutes at 4 C.) and lysed by sonication in buffer containing 50 mM Tris-HCl, pH 8.0, 150 mM NaCl, 1 mM TCEP and 5 mM MgCl.sub.2. Cell lysate was then centrifuged at 12,000rpm for 30 minutes at 4 C. The supernatant was loaded onto a chromatography column containing Ni Sepharose 6 Fast Flow beads (GE Life Sciences) equilibrated with PDI Suspension Buffer (50 mM Tris-HCl, pH 8.0, 150 mM NaCl and 1 mM TCEP). The bound PDIa was eluted with 250 mM imidazole in the same buffer. Recombinant PDIa was further purified using gel filtration Superdex 100 column (GE Life Sciences) in a buffer containing 20 mM Tris-HCl, pH 8.0, 150 mM NaCl, 1 mM TCEP. The fractions containing PDIa were concentrated, flash frozen, and stored at 80 C. Protein concentration was determined using absorbance at 280 nm with molar extinction coefficient (E) 19940 M.sup.1 cm.sup.1 (for reduced PDIa with N-terminal His.sub.6 tag as calculated from amino acid sequence by ExPASy ProtParam). PDIa purity was verified by SDS-PAGE as more than 98% pure.
[0126] For NMR studies, uniformly .sup.15N-labeled PDIa protein with an N-terminal His.sub.6 tag was prepared. The PDIa construct was transformed into Escherichia coli BL21-Gold (DE3) competent cells (Agilent Technologies). Cells were grown at 37 C. in 1 L of M9 minimal medium supplemented with 2 mM MgSO.sub.4, 0.1 mM CaCl.sub.2, 100 g/ml ampicillin, 22.2 mM glucose, metals 44 solution, 30 mg nicotinic acid, 3 mg p-aminobenzoic acid, 0.3 mg biotin, 0.5 mg thiamine hydrochloride, and 0.6 g .sup.15NH.sub.4Cl as the sole nitrogen source. When OD.sub.600 nm reached 0.9, the temperature was reduced to 20 C. and protein expression was induced with 0.5 mM IPTG for overnight. Protein was purified as described above except the histidine tag was removed after size exclusion chromatography. Thrombin was added at 5 U/mg protein to cleave the N-terminal His.sub.6 tag. The reaction was allowed to proceed overnight at 4 C. The next day, protein solution was passed over Ni Sepharose 6 Fast Flow beads (GE Life Sciences) equilibrated with PDI Suspension Buffer and flow-through containing the .sup.15N-labeled PDIa protein without histidine tag was concentrated, and incubated with 5 mM TCEP overnight with gentle shaking at 4 C. The next day, the protein was dialyzed into MilliQ water, flash frozen and stored at 80 C. .sup.15N-labeled PDIa purity was verified by SDS-PAGE as more than 98% pure.
Isothermal Titration Calorimetry (ITC)
[0127] All ITC experiments were carried out at 25 C. on MicoCal Auto-ITC.sub.200 system (GE Healthcare). Reduced PDIa was dialyzed into ITC buffer (20 mM sodium phosphate buffer pH 7.8) and loaded into a sample cell at 40 M concentration. The compound solution was loaded into a syringe at 400 M in the same ITC buffer with a final DMSO concentration at 0.4% (v/v). ITC titration experiments were carried out at 25 C. with 19 injections, 2 l per injection, and 180 seconds between each injection. The reference cell power was set to 5 cal/sec. A control experiment was performed for each compound, where each compound was titrated into buffer to account for heat released due to dilution. This background was subtracted from test data before a final dissociation constant was obtained. Data were analyzed using a one-site binding model in Origin 7.1 software. The dissociation constant, K.sub.d, was calculated according to equation K.sub.d=1/K.sub.a. Gibbs free energy, G, was calculated from equation G=HTS. All other parameters, K.sub.a, n, H, S, were determined directly from the titration data.
[0128] For ITC experiments with 16F16 pre-treatment, 40 M PDIa (after dialysis into ITC buffer) was treated with 200 M 16F16 for 12-15 hours at 4 C. Next day the whole solution was loaded into the sample cell. LOC14 at 400 M in ITC buffer was loaded into syringe and titrated into PDIa+16F16 loaded cell. For control experiments, ITC buffer with 200 M 16F16 was used in the cell, while 400 M LOC14 in ITC buffer was used in the syringe.
Size-Exclusion Buffer Dialysis Experiments for Reversibility of Binding
[0129] Prior to dialysis, fluorescence emission spectra were recorded from 315 nm-550 nm wavelength with excitation at 280 nm on a Tecan Infinite 200 microplate reader. Fluorescence readings were carried out in a 384-well low volume, black bottom plate. Each well contained 40 l of either LOC14 (300 M), PDIa (20 M), or PDIa (20 M) treated with LOC14 (300 M) overnight. All samples were dissolved in buffer B (20 mM sodium phosphate buffer pH 7.8). After recording the initial fluorescence spectra, samples were then transferred to Amicon Ultra 10 kDa size exclusion filter spin columns for dialysis. 400 l of buffer B was added to the spin column, the samples were centrifuged for 8 minutes on a table top microcentrifuge (12,000 rpm, 4 C.), and afterwards the flow-through was transferred to a new tube. This step was repeated three more times with fresh buffer B. 40 l of the collected samples from the flow-through and the spin-column chamber were transferred to a new 384-well plate and the emission spectra recorded as described above.
NMR Spectroscopy
[0130] The residue numbering in all HSQC spectra are based on the sequence of the mature PDI protein (SEQ ID NO: 3) i.e., residue 1 of the mature PDI corresponds to residue 18 in the full length PDI. The first 17 amino acids in full length PDI are the signal sequence that is processed out to generate the mature PDI.
[0131] The .sup.1H-.sup.15N HSQC spectra were performed on Bruker Avance III 500 Ascend (500 MHz) spectrometers at 300 K. The uniformly .sup.15N-labeled PDIa was dissolved at 50 M or 100 M in 90% H.sub.2O/10% D.sub.2O (v/v), pH 5.1. The .sup.1H carrier frequency was positioned at the water resonance. The .sup.15N carrier frequency was positioned at 115 ppm. The spectral width in the .sup.1H dimension was 7500 Hz and the width in .sub.1 (.sup.15N) dimension was 1824.6 Hz. Suppression of water signal was accomplished using the WATERGATE sequence. Heteronuclear decoupling was accomplished using GARP decoupling scheme.
[0132] The 3D NMR experiments were performed on a Bruker Avance 500 MHz spectrometer equipped with a 5 mm TXI cryogenic probe. The .sup.15N-NOESY-HSQC and .sup.15N-TOCSY-HSQC spectra were recorded at 300 K on the uniformly .sup.15N-labeled PDIa that was dissolved at 500 M in 90% H.sub.2O/10% D.sub.2O (v/v), pH 5.1. The proton carrier frequency was positioned at the water resonance. The .sup.15N carrier frequency was positioned at 118 ppm. The spectral width in the .sup.1H dimension was 7501.9 Hz and the width in .sub.2 (.sup.15N) dimension was 2027.3 Hz. Suppression of water signal was accomplished using the WATERGATE sequence. The .sup.15N-NOESY-HSQC was recorded using the mixing time of 150 msec. The .sup.15N-TOCSY-HSQC was recorded using the mixing time of 60 msec (Kemmink et al., 1995). All the data was processed and analyzed using TopSpin 3.1 (Bruker). The assignments were performed using Sparky (T. D. Goddard and D. G. Kneller, UCSF). The mean chemical shift difference for .sup.1H and .sup.15N (.sub.NH) was calculated using formula (Williamson, 2013):
Mouse Microsome Stability Assay
[0133] Test compound (0.5 M) was incubated at 37 C. for up to 45 minutes in 100 mM of potassium phosphate buffer (pH 7.4) containing microsomal protein (0.5 mg/mL) and an NADPH generating system (0.34 mg/mL -nicotinamide adenine dinucleotide phosphate (NADP), 1.56 mg/mL glucose-6-phosphate, and 1.2 units/mL glucose-6-phosphate dehydrogenase). At 0, 5, 15, 30 and 45 minute intervals, an aliquot was taken and quenched with acetonitrile (ACN) containing internal standard. No-cofactor controls at 45 minutes were prepared. Following completion of the experimentation, the samples were analyzed by LC-MS/MS. The half-life (t.sub.1/2) was calculated using the following equation: t.sub.1/2=0.693/k, where k is the elimination rate constant of test compounds obtained by fitting the data to the equation: C=initialexp (kt). Intrinsic clearance (CL.sub.int) was calculated as liver clearance from the half-life using the following equation: CL.sub.int=k(ml incubation/0.5 mg protein)(52.5 mg protein/g liver). Results were reported as peak area ratios of analyte to internal standard. The intrinsic clearance (CL.sub.int) was determined from the first order elimination constant by non-linear regression.
In Vitro Drug Metabolism Studies: Mouse Plasma Stability Assay
[0134] Test compound (1 M) was incubated at 37 C. for up to 120 minutes in mouse plasma. At 0, 15, 30, 60, and 120 minute intervals an 100 L aliquot was taken and quenched with 200 L acetonitrile (ACN) containing internal standard. Following completion of the experimentation, the samples were analyzed by LC-MS/MS. The half-life (t.sub.1/2) was calculated using the following equation: t.sub.1/2=0.693/k, where, k is the elimination rate constant of test compounds obtained by fitting the data to the equation: C=initialexp (kt). Results were reported as peak area ratios of analyte to internal standard.
In Vitro Drug Metabolism Studies: Mouse plasma protein binding assay
[0135] A test compound at the concentration of 2000 ng/mL in plasma was added into the sample chamber, and a dialysis buffer phosphate-buffered saline (PBS) was added into the buffer chamber, covering the unit with sealing tape and incubating for 4 hours at 37 C. at approximately 100 rpm on an orbital shaker. The incubation samples were taken from both plasma and buffer chamber at the end of the incubation, and then samples were analyzed by LC-MS/MS. Protein binding and free fraction percentage were determined using peak area ratio of analyte to internal standard. Fraction bound percent was calculated as: % Bound=100*(C.sub.plasmaC.sub.PBS)/C.sub.plasma. The fraction recovered percent was calculated as: % Recovery=(V.sub.PBS*C.sub.PBS+V.sub.plasma*C.sub.plasma)/(V.sub.plasma*C.sub.spike) where V.sub.PBS is Volume of PBS, V.sub.plasma is Volume of Plasma, C.sub.PBS is Drug concentration in PBS (Analyte/IS peak area ratio), C.sub.plasma is Drug concentration in plasma (Analyte/IS peak area ratio), C.sub.spike is Drug concentration in spiked plasma (Analyte/IS peak area ratio).
In Vitro Drug Metabolism Studies
[0136] The microsome stability assay, plasma stability assay, and plasma protein binding assay were each performed by Alliance Pharma, Inc. (Malvern, Pa.).
Liquid Chromatography-Mass spectrometry
[0137] Proteins were separated by one-dimensional SDS-PAGE electrophoresis and digested with trypsin as described previously (Cardinale et al., 2008). Peptides were separated with a NanoAcquity UPLC as described previously (Yang et al., 2014) except that Solvent B was increased in a 30 minute linear gradient between 5 and 40% and post-gradient cycled to 95% B for 7 min, followed by post-run equilibration at 5% B.
[0138] Spectra were recorded in sensitivity positive ion mode with a Synapt G2 quadrupole-time-of-flight HDMS mass spectrometer (Waters Corp). Spectra were acquired for the first 59 minutes of the chromatographic run. Source settings were capillary voltage (3.2 kV), extraction cone (4 V), sampling cone (30 V), and source temperature of 80 C. The cone gas N.sub.2 flow was 30 L/hour. Analyzer settings included quadrupole profile set at manual with mass 1 as 400 (dwell time 25%, ramp time 25%), mass 2 as 500 (dwell time 25%, ramp time 25%) and mass 3 as 600. A reference sprayer was operated at 500 nL/minute to produce a lockmass spectrum with Glu-1-Fibrinopeptide B (EGVNDNEEGFFSAR) (m/z 785.8426) leucine enkephalin (YGGFL) at m/z 556.2771 every 30 s.
[0139] Data were collected by data-dependent acquisition with a scan time of 0.25 seconds. A survey scan was conducted over the range of 300 to 2000 Da. Acquisition was performed in sensitivity mode and switched when individual ion counts exceeded 1000 count/second. MS/MS spectra were acquired over the range of 50 to 2000 m/z. A maximum of the five most intense ions were selected from a single MS survey scan. Return to MS survey scan was triggered when the intensity exceeded 60,000 counts/second or 3 seconds had elapsed. Charge state peak detection was enabled for +2, +3, and +4. Collision energy in the trap was ramped from 12 to 20 volts for low mass (300 Da) and 40 to 60 V for high mass (2000 Da).
[0140] Raw spectrum processing was performed with the PLGS software (Vers. 2.5, RC9). The electrospray survey was calibrated to a lock mass of Glu-1-Fibrinopeptide B at 785.8426 m/z, averaging three scans with a tolerance of 0.1 Da, adaptive background subtraction with slow algorithm deisotoping function with 30 iterations and a 3% threshold. MS/MS spectra were calibrated to singly-charged leucine enkephalin at m/z 556.2771 with the same settings as for the survey scan. Spectra were processed and exported as .pkl files that were then imported into the Mascot database search program (Vers. 2.3.02) (Matrix Science, London, UK.). Observed masses were searched with Mascot against the full NCBI nr protein database of Jan. 4, 2012 (16,826,875 sequences; 5,780,204,515 residues). In addition, a custom database was used with sequence of the protein disulfide isomerase construct used for the reaction. Decoy search was enabled and no taxonomic restriction and up to one missed trypsin cleavage with no fixed modifications. Charge states of +1, +2, or +3 were considered. Monoisotopic mass tolerance for precursor peptides was 10 ppm, and for products, 0.02 Da. Variable modifications included carbamidomethyl (C), oxidation (M) and a custom modification of C representing inhibitor 16F16 with a monoisotopic mass shift of 284.1160 Da and an elemental composition C (16) H (16) N (2) O (3).
[0141] All raw data files and DDA .pkl files were deposited in a public repository at www.chorusproject.org.
HD Brain Slice Assay
[0142] Brain slice explants were prepared and transfected as previously described (Reinhart et al., 2011). Briefly, brains were taken from postnatal day 10 CD Sprague-Dawley rat pups and cut into 250 m coronal slices on a vibratome (Vibratome Co., St. Louis, Mo.). Brain slices containing striatum and cortex were then placed in individual wells of 12-well plates atop culture medium set in 0.5% agarose and maintained at 32 C. under 5% CO.sub.2. Co-transfection with YFP and Htt exon-1 containing a 73 polyglutamine repeat was done using a biolistic device (Bio-Rad Helios Gene Gun, Hercules, Calif.). Positive controls were transfected with YFP only or treated with a combination of 50 M KW-6002 (istradefylline) and 50 M SP600125. Negative control brain slices were treated with 0.1% DMSO carrier only. Striatal medium spiny neurons (MSNs) expressing YFP were visualized under fluorescence microscopy and identified based on their location within brain slices and their characteristic morphology. MSNs exhibiting normal-sized cell bodies, and even and continuous expression of YFP in at least 2 discernible primary dendrites at least 2 cell body diameters long were scored as healthy.
Example 2
Compound Synthesis
[0143] All commercial reagents were used without further purification. All solvents used were reagent or HPLC grade. All reactions were carried out in flame-dried glassware under a nitrogen atmosphere. Chemical yields refer to isolated, spectroscopically pure compounds. Proton (.sup.1H) and carbon (.sup.13C) NMR spectra were recorded on a Bruker Avance III 400 or 500 MHz spectrometer at ambient temperature. Chemical shifts were recorded in parts per million relative to residual solvent CDCl.sub.3 (1H, 7.26 ppm; .sup.13C, 77.16 ppm). Multiplicities were reported as follows: s=singlet, d=doublet, t=triplet, q=quartet, m=multiplet, comp m=complex multiplet, td=triplet of doublets.
2-((4-(cyclopropanecarbonyl)piperazin-1-yl)methyl)benzo[d]isothiazol-3(2H)-one (LOC14)
[0144] ##STR00114##
[0145] Methanol (1 mL) and a 38% solution of formaldehyde in water (75 L 1.2 eq.) were combined and stirred at room temperature. 1,2-Benzisothiazol-3(2H)-one (98 mg, 1 eq.) and 1-(cyclopropylcarbonyl)piperazine (92 L, 1 eq.) were then added and the solution was allowed to stir at room temperature until white solids precipitated, about one hour. These solids were collected via vacuum filtration and recrystallized from ethyl acetate and hexanes providing LOC14 (91 mg, 44%) as a white powder. .sup.1H NMR (400 MHz, CDCl.sub.3) 8.037 (d, J=8 Hz, 1H), 7.63 (t, J=7.2 Hz, 1H), 7.55 (d, J=8 Hz, 1H), 7.397 (t, J=7.2 Hz, 1H), 4.73 (s, 1H), 3.67 (bs, 4H), 2.73 (bs, 4H), 1.67 (m, 1H), 0.96 (m, 2H), 0.74 (m, 2H); .sup.13C NMR (500 MHz, CDCl.sub.3) 172.0, 166.3, 141.1, 132.2, 126.9, 125.6, 124.7, 120.4, 65.7, 50.7, 50.2, 45.4, 42.1, 11.0, 7.5. LRMS (APCI+): calculated for (C.sub.16H.sub.19N.sub.3O.sub.2S) 317.4 g/mol, found m/z (relative intensity %): 317.07 (M.sup.+, 1%), 309.10 (1%), 302.90 (1%), 269.16 (4%), 184.15 (10%), 167.19 (4%), 155.18 (100%), 152.08 (100%), 122.12 (6%). This mass fragmentation pattern was consistent with the properties reported for Mannich bases (Idhayadhulla et al., 2011; Holla et al., 1998; Fuchslueger et al., 1999). The identity of LOC14 as a single compound under non-ionizing conditions was verified by thin layer chromatography in 10% MeOH/90% Dichloromethane, showing a single spot with an Rf of 0.5 upon iodine visualization and by NMR (see
2-((4-(cyclopropanecarbonyl)piperazin-1-yl)methyl)benzo[d]isoxazol-3(2H)-one (Oxy-LOC14)
[0146] ##STR00115##
[0147] Methanol (1 mL) and a 38% solution of formaldehyde in water (75 L 1.2 eq.) were combined and stirred at room temperature. 3-hydroxybenzisoxazole (87 mg, 1 eq.) and 1-(cyclopropylcarbonyl)piperazine (92 L, 1 eq.) were then added and the solution was allowed to stir at room temperature for one hour. Precipitation of a white solid was induced by sonication. These solids were collected via vacuum filtration and recrystallized from ethyl acetate and hexanes providing Oxy-LOC14 (101 mg, 52%) as a white powder. .sup.1H NMR (400 MHz, CDCl.sub.3) 7.83 (d, J=8 Hz, 1H), 7.64 (t, J=6 Hz, 1H), 7.30 (t, J=8 Hz, 1H), 7.23 (d, J=8.4 Hz, 1H), 4.93 (s, 2H), 3.68 (bs, 4H), 2.78 (bs, 4H), 1.67 (m, 1H), 0.95 (m, 2H), 0.74 (m, 2H); .sup.13C NMR (500 MHz, CDCl.sub.3) 171.9, 163.4, 160.3, 133.69, 124.5, 123.6, 115.94, 110.0, 67.136, 50.5, 50.0, 45.3, 42.0, 10.8, 7.42.
tert-butyl 4-((3-oxobenzo[d]isothiazol-2(3H)-yl)methyl)piperazine-1-carboxylate
[0148] ##STR00116##
[0149] To a solution of 37% aq. formaldehyde (75 uL) in MeOH (1 mL) was added benzoisothiazol-3-one (98 mg, 0.65 mmol) and tert-butyl piperazine-1-carboxylate (121 mg, 0.65 mmol). After 18 hours the solution was cooled to 0 C. and water was added. The resulting precipitate was filtered, washed with water and dried in vacuo to give the title compound as a white powder (157 mg, 69% yield). .sup.1H NMR (500 MHz, CDCl.sub.3) 8.03 (d, 1H), 7.62 (t, 1H), 7.54 (d, 1H), 7.40 (t, 1H), 4.71 (s, 2H), 3.45 (bds, 4H), 2.67 (bds, 4H), 1.43 (s, 9H). .sup.13C NMR (500 MHz, CDCl.sub.3) 166.5, 154.9, 141.4, 132.4 127.2, 125.8, 125.1, 120.7, 80.1, 66.1, 50.6, 28.7.
2,2-(piperazine-1,4-diylbis(methylene))bis(benzo[d]isothiazol-3(2H)-one)
[0150] ##STR00117##
[0151] To a solution of 37% aq. formaldehyde (1 mL) in EtOH (19.5 mL) was added benzoisothiazol-3-one (98 mg, 0.65 mmol) and piperazine (56 mg, 0.65 mmol). The reaction mixture was heated at 80 C. for 12 hours then allowed to cool to room temperature. After 3 days the white precipitate was collected by centrifugation and dried in vacuo to give the title compound as a white powder (75 mg, 28% yield). .sup.1H NMR (400 MHz, CDCl.sub.3) 8.03 (d, 2H), 7.60 (t, 2H), 7.52 (d, 2H), 7.39 (t, 2H), 4.69 (s, 4H), 2.77 (bds, 8H). .sup.13C NMR (500 MHz, CDCl.sub.3) 166.5, 141.5, 132.3, 127.1, 125.7, 125.2, 120.6, 66.0, 50.5.
5-chloro-2-((4-(cyclopropanecarbonyl)piperazin-1-yl)methyl)benzo[d]isothiazol-3(2H)-one
[0152] ##STR00118##
[0153] To a solution of 37% aq. formaldehyde (15 uL) in MeOH (1 mL) was added 5-chlorobenzoisothiazol-3-one (25 mg, 0.13 mmol) and cyclopropyl(piperazin-1-yl)methanone (20 mg, 0.13 mmol). The resulting suspension was stirred for several days, cooled to 0 C. and resulting precipitate was filtered to give the title compound as a white powder (35.6 mg, 78% yield). .sup.1H NMR (400 MHz, CDCl.sub.3) 8.00 (d, 1H), 7.59 (dd, 1H), 7.48 (d, 2H), 4.72 (s, 2H), 3.68 (bds, 4H), 2.73 (bds, 4H), 1.68 (m, 1H), 0.96 (m, 1H), 0.74 (m, 1H).
2,2-methylenebis(benzo[d]isothiazol-3(2H)-one)
[0154] ##STR00119##
[0155] To a solution of 37% aq. formaldehyde (24 uL) in MeOH (1 mL) was added benzoisothiazol-3-one (32 mg, 0.21 mmol). After several days the reaction mixture was cooled to 0 C. and the crystalline material collected to give the title compound. .sup.1H NMR (500 MHz, CDCl.sub.3) 8.00 (d, 2H), 7.60 (t, 2H), 7.51 (d, 2H), 7.37 (t, 2H), 5.37 (s, 4H).
4-((benzo[d]isothiazol-3-yloxy)methyl)piperidine-1-carboxylate
[0156] ##STR00120##
[0157] To benzoisothiazol-3-one (27 mg, 0.18 mmol) and 60% NaH in oil (9 mg, 0.22 mmol) was added anhydrous DMF. After gas evolution ceased, tert-butyl 4-(bromomethyl)piperidine-1-carboxylate (50 mg, 0.18 mmol) was added. After 72 h, the solution was diluted with EtOAc and washed with water and aq. NaHCO.sub.3. Concentration in vacuo gave a colorless oil (59 mg). Silica gel chromatography (hexane:EtOAc) gave the title compound as a solid (40 mg, 64% yield). 1H NMR (400 MHz, CDCl.sub.3) 7.95 (d, 1H), 7.77 (d, 2H), 7.52 (t, 1H), 7.38 (t, 1H), 4.40 (d, 2H), 4.16 (m, 2H), 2.77 (m, 2H), 2.09 (m, 1H), 1.85 (m, 2H), 1.47 (s, 9H), 1.33 (m, 2H). .sup.13C NMR (400 MHz, CDCl.sub.3) 163.4, 155.2, 152.0, 129.0, 125.7, 124.7, 123.3, 120.5, 79.8, 73.0, 43.8, 36.3, 29.1, 28.8.
##STR00121## ##STR00122##
General Procedure a (Used for all Compounds Except 849A)
[0158] 0.992 mmol of 1,2,-benzoisothiazol-1-one were combined with 1 mL of methanol and 116 uL (1.19 mmol; 1.2 eq) of a 37% solution of formaldehyde in water. Suspended solids were dissolved into solution with brief heating. To this solution was added 0.992 mmol of the corresponding secondary amine. The resulting solution was let stir at room temperature overnight or until solids formed. Any residual solvent was removed under reduced pressure, and solids were induced to precipitate from a mixture of ethyl acetate and hexanes.
General Procedure B (849A)
[0159] 0.992 mmol of 1,2,-benzoisothiazol-1-one were combined with 1 mL of methanol and 116 uL (1.19 mmol; 1.2 eq) of a 37% solution of formaldehyde in water. Suspended solids were dissolved into solution with brief heating. To this solution was added 0.992 mmol of the corresponding secondary amine. The solution was left to stir overnight. Solvent was removed under reduced pressure, leaving an oil. This oil was purified on a silica column by running a gradient of 0410% methanol in dichloromethane.
Spectral Data
[0160] 8-32A .sup.1H NMR (400 MHz, Chloroform-d) b 8.03 (dt, J=7.9, 1.0 Hz, 1H), 7.60 (ddd, J=8.2, 7.0, 1.3 Hz, 1H), 7.53 (dt, J=8.1, 1.0 Hz, 1H), 7.38 (ddd, J=8.0, 7.0, 1.1 Hz, 1H), 4.67 (s, 2H), 2.88-2.41 (m, 4H), 1.60 (p, J=5.7 Hz, 8H), 1.44 (tq, J=8.5, 5.4, 4.4 Hz, 2H).
[0161] 8-32B .sup.1H NMR (300 MHz, Chloroform-d) b 8.02 (dt, J=7.9, 1.0 Hz, 1H), 7.60 (ddd, J=8.2, 7.0, 1.3 Hz, 1H), 7.53 (dt, J=8.1, 1.0 Hz, 1H), 7.38 (ddd, J=8.0, 6.9, 1.2 Hz, 1H), 4.69 (s, 2H), 2.76 (t, J=4.9 Hz, 4H), 2.45 (s, 4H), 2.28 (s, 3H).
[0162] 8-32C .sup.1H NMR (400 MHz, Chloroform-d) b 8.03 (dt, J=7.9, 1.0 Hz, 1H), 7.62 (ddd, J=8.2, 7.1, 1.3 Hz, 1H), 7.54 (dt, J=8.1, 0.9 Hz, 1H), 7.40 (ddd, J=8.0, 7.0, 1.1 Hz, 1H), 4.70 (s, 2H), 3.13-2.94 (m, 4H), 2.75-2.60 (m, 4H).
[0163] 8-32D .sup.1H NMR (400 MHz, Chloroform-d) 8.03 (dt, J=7.9, 1.3, 0.8 Hz, 1H), 7.60 (ddd, J=8.2, 7.0, 1.3 Hz, 1H), 7.54 (dt, J=8.0, 1.0 Hz, 1H), 7.39 (ddd, J=8.0, 7.0, 1.1 Hz, 1H), 4.69 (s, 2H), 3.50 (d, J=6.3 Hz, 2H), 3.11-2.99 (m, 2H), 2.40 (td, J=11.7, 2.6 Hz, 2H), 1.75 (d, J=12.2 Hz, 2H), 1.53-1.43 (m, 1H), 1.30 (qd, J=12.1, 4.0 Hz, 2H).
[0164] 8-36C .sup.1H NMR (300 MHz, DMSO-d.sub.6) 7.95 (dt, J=8.1, 0.9 Hz, 1H), 7.86 (dt, J=7.7, 1.0 Hz, 1H), 7.69 (ddd, J=8.2, 7.1, 1.3 Hz, 1H), 7.43 (ddd, J=8.0, 7.1, 1.0 Hz, 1H), 4.61 (s, 2H), 4.57 (d, J=4.2 Hz, 1H), 3.52-3.36 (m, 1H), 2.82 (dd, J=11.0, 5.3 Hz, 2H), 2.41-2.29 (m, 2H), 1.71 (dd, J=13.1, 4.1 Hz, 2H), 1.50-1.30 (m, 2H).
[0165] 8-36D .sup.1H NMR (300 MHz, Chloroform-d) 8.03 (dt, J=7.8, 1.0 Hz, 1H), 7.61 (ddd, J=8.2, 6.9, 1.3 Hz, 1H), 7.54 (dt, J=8.1, 1.0 Hz, 1H), 7.39 (ddd, J=8.0, 6.9, 1.2 Hz, 1H), 4.67 (s, 2H), 4.43 (s, 1H), 3.45 (s, 1H), 2.95 (dd, J=10.2, 5.9 Hz, 2H), 2.49 (td, J=11.5, 2.7 Hz, 2H), 1.99-1.85 (m, 2H), 1.68 (s, 2H), 1.42 (s, 10H).
[0166] 8-38A .sup.1H NMR (400 MHz, Chloroform-d) 8.28 (d, J=4.7 Hz, 2H), 8.03 (ddd, J=7.9, 1.3, 0.8 Hz, 1H), 7.61 (ddd, J=8.2, 7.0, 1.2 Hz, 1H), 7.53 (dt, J=8.1, 0.9 Hz, 1H), 7.39 (ddd, J=8.1, 7.1, 1.1 Hz, 1H), 6.46 (t, J=4.7 Hz, 1H), 4.75 (s, 2H), 3.93-3.79 (m, 4H), 2.84-2.73 (m, 4H).
[0167] 8-38B .sup.1H NMR (400 MHz, Chloroform-d) 8.06-8.02 (m, 1H), 7.87-7.83 (m, 2H), 7.62 (ddd, J=8.3, 7.1, 1.3 Hz, 1H), 7.54 (dt, J=8.1, 0.9 Hz, 1H), 7.40 (ddd, J=8.1, 7.1, 1.0 Hz, 1H), 6.87-6.82 (m, 2H), 4.76 (s, 2H), 3.41-3.34 (m, 4H), 2.90-2.83 (m, 4H), 2.50 (s, 3H).
[0168] 8-49A .sup.1H NMR (400 MHz, Chloroform-d) b 8.04-8.00 (m, 1H), 7.59 (ddd, J=8.2, 6.9, 1.3 Hz, 1H), 7.54 (dt, J=8.1, 1.0 Hz, 1H), 7.37 (ddd, J=8.0, 6.9, 1.3 Hz, 1H), 4.66 (s, 2H), 3.73-3.66 (m, 5H), 2.73-2.66 (m, 5H).
2-benzylbenzo[d]isothiazol-3(2H)-one
[0169] ##STR00123##
[0170] 1,2-benzisothiazol-3(2H)-one (1.0 eq, 2.5 mmol, 378 mg), Benzylbromide (2.0 eq, 5.0 mmol, 855 mg, 595 L) were dissolved in tetrahydrofuran (5 mL), potassium carbonate (2.5 eq, 6.25 mmol, 864 mg) was added and the mixture was stirred overnight. The solvent was evaporated and the residue partitioned between water and ethyl acetate. The layers were separated and the aqueous layer was extracted with ethyl acetate (25.0 mL). The combined organic layer was dried with magnesium sulfate, filtered and the solvent evaporated. The crude product was purified by column chromatography on silica (0-60% ethyl acetate/n-hexanes) to give 2-benzylbenzo[d]isothiazol-3(2H)-one (415 mg, 69% yield) as a colorless oil that crystallized upon standing. The spectroscopic data matched those reported in literature. (Correa et al., 2006)
3-oxo-N-phenylbenzo[d]isothiazole-2(3H)-carboxamide
[0171] ##STR00124##
[0172] Aniline (1.0 eq, 0.5 mmol, 47 mg, 46 L) was dissolved in dichloromethane (5 mL) and triethylamine was added (10.0 eq, 5.0 mmol, 506 mg, 693 L). The resulting solution was added dropwise to a solution of triphosgene (1.0 eq, 0.5 mmol, 148 mg) in dichloromethane (5 mL) and the reaction mixture was stirred for 5 minutes at room temperature. The reaction mixture was added dropwise to a solution of 1,2-benzisothiazol-3(2H)-one (1.0 eq, 0.5 mmol, 76 mg) in tetrahydrofuran (2.0 mL). After stirring at room temperature overnight, the solvent was evaporated. Upon addition of acetone (3 mL) and water (3.5 mL) the product precipitated and was filtered off. After drying overnight 3-oxo-N-phenylbenzo[d]isothiazole-2(3H)-carboxamide (103 mg, 76% yield) was isolated as a pale yellow solid. The spectroscopic data matched those reported in literature. (Liu et al., 2013)
[0173] The other listed compounds disclosed herein are synthesized in a similar fashion or obtained as described herein.
Example 3
High Throughput Screen Identifies Small Molecule Inhibitors of PDI
[0174] Using a phenotypic high throughput screening approach, a small-molecule, neuroprotective compound 16F16 was previously identified (Hoffstrom et al., 2010). The alpha-chloro ketone moiety on this molecule made it likely an irreversible inhibitor and this property aided subsequent pull-down experiments that identified PDI as its target. Modulation of PDI by 16F16 was beneficial in an in vitro model of AD using rat corticostriatal brain slices expressing amyloid precursor protein, which is processed in situ to A peptides centrally implicated in the amyloid-cascade hypothesis of AD. However, the reactive alpha-chloro ketone group and irreversible inhibition of PDI by 16F16 prompted us to search for compounds that were reversible inhibitors with improved properties that were suitable for in vivo studies.
[0175] To identify neuroprotective PDI modulators with attractive pharmaceutical properties, a library with lead-optimized compounds was assembled (Cantley et al., 2014; Dixon et al., 2012). Initially, a database of 3,372,615 commercially available small molecules (from Asinex, Life Chemicals, Enamine, TimTec, InterBioScreen and Chembridge suppliers) was compiled and stringently filtered computationally. The compounds were filtered to adhere to the Lipinski rule of five (Lipinski et al., 2001) and a molecular weight minimum of 235; compounds with noxious or reactive properties and water solubility less than 0.5 mM were eliminated. Strong emphasis was placed on compounds suitable for lead development; therefore potential nonspecific binders that might be acting as cationic and nonionic detergents were removed. Scaffolds with more than five rotatable bonds and a topological polar surface area larger than 70 .sup.2 were eliminated to improve the likelihood of blood-brain barrier penetration. As a final step, the compounds were clustered based on their Tanimoto coefficient and only a diverse subset was purchased. The final lead optimized compound (LOC) library contained 9,719 unique small molecules.
[0176] A cascade of two assays was used, involving both a phenotypic high-throughput screening (HTS) assay and an in vitro PDI reductase assay, to identify neuroprotective PDI-inhibiting compounds. (
[0177] Because neuroprotection of PC12 mHTT.sup.Q103 cells can occur via additional pathways other than PDI modulation, e.g., caspase inhibition, the hits from the cell-based assay were screened for inhibition of PDI's reductase activity using insulin and the recombinant catalytic a domain of human PDI A1 (referred to as PDIa), which can perform the same catalytic oxidation and reduction reactions as full length PDI with one inactive domain (Darby & Creighton, 1995). In this insulin aggregation assay (Xu et al., 2012; Jasuja et al., 2012; Khan et al., 2011; Smith et al., 2004), PDIa reduced the two disulfide bonds between the - and -chains of insulin, causing the -chain to aggregate and precipitate, resulting in an increase in absorbance at 650 nm. Out of eight hit compounds from the cell culture screen, two, LOC14 and LOC6, were able to almost completely inhibit PDIa enzymatic activity (
[0178] From these stages of screening, LOC14 emerged as the most potent small molecule that could both rescue PC12 mHTT.sup.Q103 cells and inhibit PDIa reductase activity; therefore LOC14 was selected as a lead compound for further analyses.
Example 4
LOC14 Binds with Nanomolar Affinity to PDI
[0179] To confirm the compound's identity, LOC14 was resynthesized (Materials and Methods and
[0180] The binding mode of LOC14 to PDIa was next investigated using isothermal titration calorimetry (ITC). ITC measures the heat released or absorbed during a biomolecular interaction. It is a direct analytical method for determining the binding and thermodynamic parameters, such as reaction stoichiometry (n), binding constants (K.sub.a and K.sub.d), enthalpy (H), entropy (S), and free energy (G) of an interaction.
[0181] Calorimetric titration of LOC14 against PDIa showed an exothermic binding (
[0182] To test if the sulfur atom on LOC14 is important for interaction with the protein, an isoxazolone analog of LOC14 was synthesized, termed Oxy-LOC14 (Materials and Methods) and its binding affinity to PDIa tested. Oxy-LOC14 had a 35-fold loss in binding affinity compared to LOC14 and a K.sub.d of 2,433764 nM by ITC (
Example 5
LOC14 is a Reversible Modulator of PDI
[0183] The importance of the sulfur atom on LOC14 suggested that it might be binding covalently to the active site of PDIa, which contained two cysteines with reactive thiol groups. To investigate the mode of binding further and to determine whether the binding was reversible or irreversible, the fluorescence of the LOC14-PDIa complex was analyzed before and after buffer dialysis. LOC14 had a distinct emission spectrum when excited at 280 nm that is different than the emission of PDIa alone, or from the LOC14-PDIa complex (
[0184] To investigate the mode of binding further and to determine whether the binding was reversible or irreversible, the recovery of enzymatic activity of PDIa after dilution of pre-formed concentrated PDIa-LOC14 complexes was analyzed. LOC14 (750 M) was incubated with a concentrated solution of PDIa (500 M). The mixture was then diluted 100-fold and PDI's enzymatic activity was measured in the insulin reduction assay. As a control, the same procedure was also performed on the sample containing an irreversible inhibitor, 16F16 (16F16 at 750 M and PDIa at 500 M). Without dilution, concentrated 16F16 (750 M) (
Example 6
LOC14 Binds Adjacent to the Active Site and Oxidizes PDI
[0185] To identify residues on PDIa involved with the LOC14 interaction, .sup.1H-.sup.15N heteronuclear single quantum correlation (HSQC) binding studies were performed on the uniformly .sup.15N-labeled PDIa with and without LOC14. .sup.1H-.sup.15N HSQC spectra displays directly bonded NH resonance peaks from each amino acid in a protein. Upon ligand binding, the perturbations in the local environment induced a change in the chemical shift of the resonance peaks. Only the residues that were either involved in the binding site or in the conformational change of the protein upon compound binding were perturbed (Williamson, 2013). Knowing the resonance assignments is beneficial when mapping the binding site from chemical shift perturbation data.
[0186] The resonance assignments of oxidized PDIa have been previously determined (Kemmink et al., 1995); however, the resonances for the reduced form of the protein were not known. By matching the conditions reported by Kemmink et al., the assignments of unaltered residues in the oxidized protein were able to be efficiently transferred to the peaks of .sup.1H-.sup.15N HSQC spectrum of reduced PDI protein. To validate the assignments .sup.15N-TOCSY-HSQC and .sup.15N-NOESY-HSQC were performed (
[0187] The resulting HSQC spectrum with one-to-one molar equivalence ratio (PDIa to LOC14) upon LOC14 binding is shown in
[0188] Furthermore, it was observed that the majority of the peaks that were shifting were undergoing a slow exchange upon compound titration. This was evident upon an observable decrease in peak intensity and then either an abrupt appearance in a new location or a complete disappearance of the peaks all together (
[0189] Closer examination of HSQC spectrum of reduced PDIa liganded to LOC14 revealed that upon compound binding, PDIa adopts an oxidized conformation. This was evident by the perfect overlay between the HSQC spectrum of oxidized protein alone and the HSQC spectrum of reduced PDIa liganded with LOC14 (
[0190] Mapping the residues with the most significant chemical shift change (
[0191] Calorimetric titration of LOC14 against oxidized PDIa showed a loss in binding affinity (compared to LOC14 titration into reduced PDIa) (
Example 7
LOC14 Binds to a Different Site than 16F16
[0192] Based on the mapped binding site from the NMR studies and the fact that sulfur atom was essential to retain tight binding of LOC14 to the protein, it was next examined whether LOC14 was binding to the two cysteines in the protein, C36 and C39, both in the active site.
[0193] Previously, 16F16 was reported to function as an irreversible inhibitor of PDI A1 and PDI A3 proteins (Hoffstrom et al., 2010). The compound 16F16 contains a chloroacetyl group that covalently modifies free cysteine thiols. To confirm the likely covalent nature of the interaction and identify the cysteines on PDIa modified by 16F16, LC-MS/MS fragmentation was performed. Compound 16F16 selectively bound to the only cysteines in the PDIa protein and it was able to covalently modify both C36 and C39 (
[0194] Additionally, the thermodynamic parameters plot (
[0195] The different mode of binding to PDIa between these small-molecule modulators is also supported by NMR .sup.1H-.sup.15N HSQC data (
Example 8
LOC14 can Protect Medium Spiny Neurons from Neurotoxicity Induced by Mutant Huntingtin Protein
[0196] Having elucidated aspects of the biophysical mechanism of action of LOC14 binding to PDI, the next exploration concerned whether LOC14 would be a good candidate for in vivo studies. The activity of LOC14 in an organotypic postnatal brain slice model was examined for HD focusing on the medium spiny neurons (MSN) of the striatum (Reinhart et al., 2011). MSNs are the first population of neurons to degenerate in patients with HD and are the most vulnerable to the toxicity associated with mutant huntingtin dysfunction. Rat corticostriatal brain slice explants were co-transfected with YFP and the first exon of mutant HTT gene (mHTT-Q73) to induce neurodegeneration, and then treated with LOC14. In the absence of LOC14, very few healthy MSNs remained, as assessed by the lack of normal sized and shaped cell bodies, absence of long primary dendrites, and lack of continuous expression of YFP throughout the cell (
Example 9
LOC14 is Metabolically Stable Compound for In Vivo Studies
[0197] Next, metabolic in vitro stability studies were performed with LOC14 to determine its suitability for in vivo studies. LOC14 showed high stability in mouse liver microsomes, had a low intrinsic clearance value of less than 0.5 ml/min/g, and a half-life of more than 90 minutes (Table 1,
TABLE-US-00001 TABLE 1 Intrinsic clearance of LOC14 in mouse liver microsomes. Intrinsic Clearance Elimination rate Half-life (CL.sub.int), mL/min/g Compound constant (k) (t.sub.1/2), min liver LOC14 0.0016 438.7 0.17 7-Ethoxycoumarin 0.2341 3.0 24.58
[0198] Compound concentration was 0.5 M. 7-Ethoxycoumarin, a substrate of cytochrome P450 enzymes, was used as a control.
TABLE-US-00002 TABLE 2 Stability of LOC14 in mouse plasma. % Remaining Elimination rate Half-life after 2-hour Compound constant (k) (t.sub.1/2), hours incubation LOC14 0.0049 2.4 49.9 Enalapril 0.0201 0.6 4.3
[0199] Compound concentration was 1.0 M. Enalapril, which undergoes degradation in plasma, was used as a control compound.
TABLE-US-00003 TABLE 3 LOC14 plasma protein binding. Compound % Bound % Recovery LOC14 18.76 4.09 113.81 0.76 Warfarin 94.21 0.10 109.50 3.54
[0200] Compound concentration was 2000 ng/mL. Warfarin, an anticoagulant, was used as a control compound. Data are shown as meanSD (n=3).
Example 10
LOC14 can Protect Cortical Neurons from Neurodegeneration Induced by Tau
[0201] Next, whether LOC14 could be neuroprotective in additional models of neurodegenerative diseases was explored. It was found in fact that LOC14 is strongly and reproducibly neuroprotective in a tau-mediated neurodegeneration assay (
Example 11
In Vivo Pharmacokinetic Study with LOC14
[0202] Showing promising in vitro metabolic properties, LOC14 was tested in a single-dose pharmacokinetic (PK) study. This was a pilot study to evaluate the ability of LOC14 to traverse the blood-brain barrier (BBB). In this study, LOC14 was administered via two routes, intravenously (
Example 12
Design and Evaluation of LOC14 Analogs
[0203] Next, LOC14 analogs were designed and synthesized as described in the synthetic schemes. The analogs were evaluated for their binding to PDIa using isothermal titration calorimetry (ITC). The Kd values are given in Table 4. Next, the analogs were tested for their ability to rescue PC12 cells from mHTT.sup.Q103 induced cell death in a dose-dependent manner.
TABLE-US-00004 TABLE 4 Analysis of LOC14 Analogs. Our ID Name Structure MW Solubility ITC LOC14 MMG509 MMG524 MMG821 MMG828
Example 13
Design and Evaluation of Additional LOC14 Analogs
[0204] Additional LOC14 analogs were designed and synthesized as described in the synthetic schemes or as would be known by one skilled in the art. The analogs were evaluated for their binding to PDIa using isothermal titration calorimetry (ITC). The analogs were further evaluated using an Insulin Assay (either active or inactive) and a Cell Viability Assay. Next, the analogs were tested for their ability to rescue PC12 cells from mHTT.sup.Q103 induced cell death in a dose-dependent manner. The data are presented in Table 5 below.
TABLE-US-00005 TABLE 5 Analysis of LOC14 Analogs (Complete List). Insulin Cell Viability Our ID Name Structure MW Solubility Assay ITC Assay Assay LOC14 MMG524
Example 14
LOC14 and its Analogs are Reversible, Neuroprotective, Nanomolar Modulators of PDI
[0205] In this study, LOC14 and its analogs were identified and characterized as the first reversible, neuroprotective, nanomolar modulators of PDI. It was found that LOC14 reversibly binds to a region adjacent to the active site of PDI, induces the protein to adopt an oxidized conformation, and inhibits its reductase activity. A possible mechanism of inhibition is shown in
[0206] This is the first report that oxidation of PDI activity is neuroprotective. One possible explanation has to do with PDI's binding protein ER oxidoreductin 1 (Ero1). During protein folding, PDI cycles between oxidized and reduced disulfide states. When it forms a disulfide bond with a substrate protein, its own catalytic site becomes reduced. In vitro, PDI can be oxidized by GSSG, but in vivo the protein Ero1 is needed to accomplish this task. Ero1 is a flavin-adenine-dinucleotide-(FAD)-bound protein that takes electrons from re-oxidized PDI and passes them onto molecular oxygen as a terminal acceptor, in the process creating hydrogen peroxide and thus generating reactive oxygen species (ROS). By oxidizing PDI with LOC14, Ero1 can be bypassed, reducing the generation of ROS and hence providing neuroprotection. This is consistent with previous findings that reported that overexpression of PDI is toxic in neuron-like PC12 cells, but can be protected from this overexpression toxicity with the irreversible PDI inhibitor 16F16 (Hoffstrom et al., 2010). By increasing the level of PDI production, one would increase Ero1 oxidation of PDI, leading to increased ROS generation. It is possible that irreversible PDI inhibitors covalently bound to the active site cysteines, prevent the Ero1-PDI interaction, and thus oxidation.
[0207] To our knowledge, this is the first compound reported to date that binds reversibly to PDI with low nanomolar affinity and causes protection in neuronal cells and tissue. Inhibition of PDI activity causing neuroprotection has not been validated yet in in vivo mouse models of neurodegeneration, due to the lack of drug-like inhibitors with low cytotoxic properties. Previously reported PDI inhibitors that are cell permeable bind covalently and irreversibly to PDI. Ultimately, this type of binding completely inactivates the protein, can be non-selective, and can result in haptenization, causing unpredicted idiosyncratic toxicity from the immune system in vivo leading to liver failure and blood disorders. The reversible modulation of PDI with LOC14 overcomes these challenges. LOC14 forms covalent, but reversible, bonds with the protein, ultimately acting like a non-covalent inhibitor (because of its potent, but reversible, effects on the protein). Thus, in vivo, LOC14 may not result in idiosyncratic toxicities. Furthermore, LOC14 showed high stability in liver microsomes and blood plasma, making it a promising candidate for future in vivo work.
[0208] The catalytic a domain of PDI A1 was used as a prototype of the redox reactions that the PDI family of proteins catalyze. The N-terminal cysteine of the a domain in PDI A1 is less reactive than the N-terminal cysteine of the a domain of PDI A1, and both have lower hyper-activity than the catalytic cysteines in PDI A3 (ERp57). Thus, it is very likely that LOC14 will react and oxidize both catalytic domains of PDI A1 and PDI A3. Previously, it was reported that both PDI A3 and PDI A1 proteins (Hoffstrom et al., 2010) (and possibly PDI A4 and PDI A6 (Ge et al., 2013)) were the target of 16F16. Since numerous PDI family members reside in the ER and their distinct roles are still unclear, it is possible that modulation of the whole family by LOC14 is neuroprotective.
[0209] In summary, a new scaffold, LOC14, was identified for reversible inhibition of PDI's reductase activity. This compound, although targeting similar residues of PDI as the irreversible inhibitor 16F16, forces the protein to adopt a different conformation that resembles the native oxidized form. LOC14 has improved solubility, potency and in vitro metabolism properties compared to other reported PDI inhibitors, and it protects neuron-like PC12 cells as well as bona fide striatal MSNs from mutant huntingtin toxicity. Validating PDI as a target for neurodegenerative disorders may open new therapeutic strategies to treat and understand these diseases.
DOCUMENTS
[0210] Aiken C T, Tobin A J, & Schweitzer E S (2004) A cell-based screen for drugs to treat Huntington's disease. Neurobiol Dis 16(3):546-555. [0211] Atkin J D, et al. (2008) Endoplasmic reticulum stress and induction of the unfolded protein response in human sporadic amyotrophic lateral sclerosis. Neurobiol Dis 30(3):400-407. [0212] Barbouche R, Miquelis R, Jones I M, & Fenouillet E (2003) Protein-disulfide isomerase-mediated reduction of two disulfide bonds of HIV envelope glycoprotein 120 occurs post-CXCR4 binding and is required for fusion. J Biol Chem 278(5):3131-3136. [0213] Cantley A M, et al. (2014) Small Molecule that Reverses Dexamethasone Resistance in T-cell Acute Lymphoblastic Leukemia (T-ALL). ACS Med Chem Lett 5(7):754-759. [0214] Cardinale C J, et al. (2008) Termination factor Rho and its cofactors NusA and NusG silence foreign DNA in E. coli. Science 320(5878):935-938. [0215] Cho J, Furie B C, Coughlin S R, & Furie B (2008) A critical role for extracellular protein disulfide isomerase during thrombus formation in mice. J Clin Invest 118(3):1123-1131. [0216] Colla E, et al. (2012) Endoplasmic reticulum stress is important for the manifestations of alpha-synucleinopathy in vivo. J Neurosci 32(10):3306-3320. [0217] Darby N J & Creighton T E (1995) Functional properties of the individual thioredoxin-like domains of protein disulfide isomerase. Biochemistry 34(37):11725-11735. Dixon S J, et al. (2012) Ferroptosis: an iron-dependent form of nonapoptotic cell death. Cell 149(5):1060-1072. [0218] Fuchslueger U, Socher G, Grether H J, & Grasserbauer M (1999) Capillary supercritical fluid chromatography/mass spectrometry of phenolic mannich bases with dimethyl ether modified ethane as the mobile phase. Anal Chem 71(13):2324-2333. [0219] Garbi N, Tanaka S, Momburg F, & Hammerling G J (2006) Impaired assembly of the major histocompatibility complex class I peptide-loading complex in mice deficient in the oxidoreductase ERp57. Nat Immunol 7(1):93-102. [0220] Ge J, et al. (2013) Small molecule probe suitable for in situ profiling and inhibition of protein disulfide isomerase. ACS Chem Biol 8(11):2577-2585. [0221] Hashida T, Kotake Y, & Ohta S (2011) Protein disulfide isomerase knockdown-induced cell death is cell-line-dependent and involves apoptosis in MCF-7 cells. J Toxicol Sci 36(1):1-7. [0222] Hoffstrom B G, et al. (2010) Inhibitors of protein disulfide isomerase suppress apoptosis induced by misfolded proteins. Nat Chem Biol 6(12):900-906. [0223] Holla B S, Shivananda M K, Shenoy M S, & Antony G (1998) Studies on arylfuran derivatives. Part VII. Synthesis and characterization of some Mannich bases carrying halophenylfuryl moieties as promising antibacterial agents. Farmaco 53(8-9):531-535. [0224] Idhayadhulla A, Surendra Kumar R, Abdul Nasser A J, & Manilal A (2011) Synthesis and antimicrobial activity of some new Mannich base derivatives. J. Chem. Pharm. Res. 3(4):904-911. [0225] Jasuja R, et al. (2012) Protein disulfide isomerase inhibitors constitute a new class of antithrombotic agents. J Clin Invest 122(6):2104-2113. [0226] Karala A R & Ruddock L W (2010) Bacitracin is not a specific inhibitor of protein disulfide isomerase. FEBS J 277(11):2454-2462. [0227] Kemmink J, Darby N J, Dijkstra K, Scheek R M, & Creighton T E (1995) Nuclear magnetic resonance characterization of the N-terminal thioredoxin-like domain of protein disulfide isomerase. Protein Science 4(12):2587-2593. [0228] Khan M M, et al. (2011) Discovery of a small molecule PDI inhibitor that inhibits reduction of HIV-1 envelope glycoprotein gp120. ACS Chem Biol 6(3):245-251. Koivu J, et al. (1987) A single polypeptide acts both as the beta subunit of prolyl 4-hydroxylase and as a protein disulfide-isomerase. J Biol Chem 262(14):6447-6449. [0229] Lipinski C A, Lombardo F, Dominy B W, & Feeney P J (2001) Experimental and computational approaches to estimate solubility and permeability in drug discovery and development settings. Adv Drug Deliv Rev 46(1-3):3-26. [0230] Lovat P E, et al. (2008) Increasing melanoma cell death using inhibitors of protein disulfide isomerases to abrogate survival responses to endoplasmic reticulum stress. Cancer Res 68(13):5363-5369. [0231] Reinhart P H, et al. (2011) Identification of anti-inflammatory targets for Huntington's disease using a brain slice-based screening assay. Neurobiol Dis 43(1):248-256. [0232] Smith A M, et al. (2004) A high-throughput turbidometric assay for screening inhibitors of protein disulfide isomerase activity. J Biomol Screen 9(7):614-620. [0233] Suhr S T, Gil E B, Senut M C, & Gage F H (1998) High level transactivation by a modified Bombyx ecdysone receptor in mammalian cells without exogenous retinoid X receptor. Proc Natl Acad Sci USA 95(14):7999-8004. [0234] Vilaboa N, Boellmann F, & Voellmy R (2011) Gene Switches for Deliberate Regulation of Transgene Expression: Recent Advances in System Development and Uses. Journal of genetic syndrome & gene therapy 2(3): 107. [0235] Wetterau J R, Combs K A, Spinner S N, & Joiner B J (1990) Protein disulfide isomerase is a component of the microsomal triglyceride transfer protein complex. J Biol Chem 265(17):9800-9807. [0236] Williamson M P (2013) Using chemical shift perturbation to characterise ligand binding. Prog Nucl Magn Reson Spectrosc 73:1-16. [0237] Xu S, et al. (2012) Discovery of an orally active small-molecule irreversible inhibitor of protein disulfide isomerase for ovarian cancer treatment. Proc Natl Acad Sci USA 109(40):16348-16353. [0238] Yang W S, et al. (2014) Regulation of ferroptotic cancer cell death by GPX4. Cell 156(1-2):317-331. [0239] Yoo B C, et al. (2002) Overexpressed protein disulfide isomerase in brains of patients with sporadic Creutzfeldt-Jakob disease. Neurosci Lett 334(3):196-200. [0240] Zhang J H, Chung T D, & Oldenburg K R (1999) A Simple Statistical Parameter for Use in Evaluation and Validation of High Throughput Screening Assays. J Biomol Screen 4(2):67-73.
[0241] All patents, patent applications, and publications cited above are incorporated herein by reference in their entirety as if recited in full herein.
[0242] The invention being thus described, it will be obvious that the same may be varied in many ways. Such variations are not to be regarded as a departure from the spirit and scope of the invention and all such modifications are intended to be included within the scope of the following claims.