STABILIZATION OF RUBISCO ACTIVASE FOR ENHANCED PHOTOSYNTHESIS AND CROP YIELDS
20180094328 ยท 2018-04-05
Inventors
- Phani R. Pokkuluri (Westmont, IL, US)
- Marianne Schiffer (Downers Grove, IL, US)
- Andrej Joachimiak (Bolingbrook, IL, US)
- Rosemarie Wilton (Elmhurst, IL, US)
Cpc classification
C12N15/8261
CHEMISTRY; METALLURGY
Y02A40/146
GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
International classification
Abstract
A modified rubisco activase, wherein the modified rubisco activase has a melting temperature greater than that of wild type rubisco activase. Further aspects of the disclosure relate to an isolated polynucleotide encoding a modified rubisco activase and a recombinant expression system comprising the isolated polynucleotide. Still further aspects of the disclosure relate to a plant cell transfected with the recombinant expression system. Certain aspects of the disclosure relate to a genetically modified plant expressing the isolated polynucleotide encoding a modified rubisco activase.
Claims
1. A modified rubisco activase comprising a point mutation at one or more amino acid positions selected from 135, 163, and 262 based on the sequence of soy rubisco activase, wherein the modified rubisco activase has a melting temperature greater than about 30.4 C.
2. The modified rubisco activase of claim 1, wherein the point mutation at amino acid position 135 results in a substitution of R for the naturally occurring amino acid at this position, wherein the point mutation at amino acid position 163 results in a substitution of I for the naturally occurring amino acid at this position, and/or wherein the point mutation at amino acid position 262 results in a substitution of I for the naturally occurring amino acid at this position.
3. The modified rubisco activase of claim 1, wherein the modified rubisco activase comprises point mutations at acid positions 135, 163, and 262 based on the sequence of soy rubisco activase.
4. The modified rubisco activase of claim 1, wherein the rubisco activase is soy rubisco activase.
5. The modified rubisco activase of claim 2, wherein the point mutation is selected from M135R, M163I, and V262I.
6. The modified rubisco activase of claim 2, wherein the modified rubisco activase comprises point mutations at M135R, M163I, and V262I.
7. The modified rubisco activase of claim 1, wherein the rubisco activase is Miscanthus rubisco activase.
8. The modified rubisco activase of claim 7, wherein the modified rubisco activase has a melting temperature greater than about 39.8 C.
9. The modified rubisco activase of claim 7, wherein the point mutation is selected from M133R, L161I, and V260I based on the sequence of Miscanthus rubisco activase.
10. The modified rubisco activase of claim 7, wherein the modified rubisco activase comprises point mutations at M133R, L161I, and V260I based on the sequence of Miscanthus rubisco activase.
11. The modified rubisco activase of claim 1, wherein the modified rubisco activase has a melting temperature greater than about 34.5 C.
12. The modified rubisco activase of claim 1, wherein the modified rubisco activase has a melting temperature greater than about 34.9 C.
13. The modified rubisco activase of claim 1, wherein the modified rubisco activase has a melting temperature greater than about 38.8 C.
14. The modified rubisco activase of claim 1, wherein the modified rubisco activase has a melting temperature greater than about 42.8 C.
15. The modified rubisco activase of claim 1, wherein the modified rubisco activase has a melting temperature greater than about 44.0 C.
16. The modified rubisco activase of claim 1, wherein the modified rubisco activase has a melting temperature greater than about 44.4 C.
17. The modified rubisco activase of claim 1, wherein the modified rubisco activase has a melting temperature greater than about 46.0 C.
18. An isolated polynucleotide encoding the modified rubisco activase of claim 1.
19. A recombinant expression system comprising the isolated polynucleotide of claim 18.
20. A plant cell transfected with the recombinant expression system of claim 19.
21. A genetically modified plant expressing the isolated polynucleotide of claim 18.
22. The genetically modified plant of claim 21, wherein the genetically modified plant is a genetically modified Arabidospis.
23. The genetically modified plant of claim 21, wherein the genetically modified plant is a genetically modified soybean plant.
24. The genetically modified plant of claim 21, wherein the genetically modified plant is a genetically modified Miscanthus giganteus.
Description
BRIEF DESCRIPTION OF DRAWINGS
[0013]
[0014]
[0015]
[0016]
[0017]
DETAILED DESCRIPTION
[0018] Unless defined otherwise, all technical and scientific terms used herein have the same meanings as commonly understood by one of ordinary skill in the art to which this disclosure belongs. All nucleotide sequences provided herein are presented in the 5 to 3 direction. Although any methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present disclosure, particular, non-limiting exemplary methods, devices, and materials are now described. All technical and patent publications cited herein are incorporated herein by reference in their entirety. Nothing herein is to be construed as an admission that the disclosure is not entitled to antedate such disclosure by virtue of prior invention.
[0019] The practice of the present disclosure will employ, unless otherwise indicated, conventional techniques of tissue culture, immunology, molecular biology, microbiology, cell biology and recombinant DNA, which are within the skill of the art. See, e.g., Green and Sambrook eds. (2012) Molecular Cloning: A Laboratory Manual, 4th edition; the series Ausubel et al. eds. (2015) Current Protocols in Molecular Biology; the series Methods in Enzymology (Academic Press, Inc., N.Y.); MacPherson et al. (2015) PCR 1: A Practical Approach (IRL Press at Oxford University Press); MacPherson et al. (1995) PCR 2: A Practical Approach; McPherson et al. (2006) PCR: The Basics (Garland Science); Harlow and Lane eds. (1999) Antibodies, A Laboratory Manual; Greenfield ed. (2014) Antibodies, A Laboratory Manual; Freshney (2010) Culture of Animal Cells: A Manual of Basic Technique, 6th edition; Gait ed. (1984) Oligonucleotide Synthesis; U.S. Pat. No. 4,683,195; Hames and Higgins eds. (1984) Nucleic Acid Hybridization; Anderson (1999) Nucleic Acid Hybridization; Herdewijn ed. (2005) Oligonucleotide Synthesis: Methods and Applications; Hames and Higgins eds. (1984) Transcription and Translation; Buzdin and Lukyanov ed. (2007) Nucleic Acids Hybridization: Modern Applications; Immobilized Cells and Enzymes (IRL Press (1986)); Grandi ed. (2007) In Vitro Transcription and Translation Protocols, 2nd edition; Guisan ed. (2006) Immobilization of Enzymes and Cells; Perbal (1988) A Practical Guide to Molecular Cloning, 2nd edition; Miller and Calos eds, (1987) Gene Transfer Vectors for Mammalian Cells (Cold Spring Harbor Laboratory); Makrides ed. (2003) Gene Transfer and Expression in Mammalian Cells; Mayer and Walker eds. (1987) Immunochemical Methods in Cell and Molecular Biology (Academic Press, London); Lundblad and Macdonald eds. (2010) Handbook of Biochemistry and Molecular Biology, 4th edition; and Herzenberg et al. eds (1996) Weir's Handbook of Experimental Immunology, 5th edition.
[0020] All numerical designations, e.g., pH, temperature, time, concentration, and molecular weight, including ranges, are approximations which are varied (+) or () by increments of 1.0 or 0.1, as appropriate or alternatively by a variation of +/15%, or alternatively 10% or alternatively 5% or alternatively 2%. It is to be understood, although not always explicitly stated, that all numerical designations are preceded by the term about. It also is to be understood, although not always explicitly stated, that the reagents described herein are merely exemplary and that equivalents of such are known in the art.
Definitions
[0021] As used in the specification and claims, the singular form a, an and the include plural references unless the context clearly dictates otherwise. For example, the term a polypeptide includes a plurality of polypeptides, including mixtures thereof.
[0022] As used herein, the term comprising is intended to mean that the compositions and methods include the recited elements, but do not exclude others. Consisting essentially of when used to define compositions and methods, shall mean excluding other elements of any essential significance to the combination for the intended use. Thus, a composition consisting essentially of the elements as defined herein would not exclude trace contaminants from the isolation and purification method and pharmaceutically acceptable carriers, such as phosphate buffered saline, preservatives, and the like. Consisting of shall mean excluding more than trace elements of other ingredients and substantial method steps for administering the compositions disclosed herein. Embodiments defined by each of these transition terms are within the scope of this disclosure.
[0023] The term protein, peptide and polypeptide are used interchangeably and in their broadest sense to refer to a compound of two or more subunit amino acids, amino acid analogs or peptidomimetics. The subunits may be linked by peptide bonds. In another embodiment, the subunit may be linked by other bonds, e.g., ester, ether, etc. The term enzyme as used herein refers to a specific type of protein that serves as a catalyst for a particular reaction.
[0024] A protein or peptide must contain at least two amino acids and no limitation is placed on the maximum number of amino acids which may comprise a protein's or peptide's sequence. As used herein the term amino acid refers to either natural and/or unnatural or synthetic amino acids, including glycine and both the D and L optical isomers, amino acid analogs and peptidomimetics. The amino acids may be numbered based on a reference sequence to designate their position in the protein or peptide.
[0025] As used herein the term amino acid refers to either natural and/or unnatural or synthetic amino acids, including, but not limited to, the twenty commonly occurring amino acids alanine (Ala or A), arginine (Arg or R), asparagine (Asn or N), aspartic acid (Asp or D), cysteine (Cys or C), glutamine (Gln or Q), glutamic acid (Glu or E), glycine (Gly or G), histidine (His or H), isoleucine (Ile or I), leucine (Leu or L), lysine (Lys or K), methionine (Met or M), phenylalanine (Phe or F), proline (Pro or P), serine (Ser or S), threonine (Thr or T), tryptophan (Trp or W), tyrosine (Tyr or Y), and valine (Val or V) and both the D or L optical isomers thereof, and amino acid analogs and peptidomimetics. The term amino acid is used herein in the conventional sense to refer to organic chemical moieties which comprise anamino group (NH.sub.2) and a carboxylic acid group (COOH). Amino acids may be further grouped based on their side chains, e.g. hydrophobic amino acids are those with hydrophobic side chains, including, but not limited to, alanine (A), isoleucine (I), leucine (L), valine (V), phenylalanine (F), tryptophan (W) or tyrosine (Y) and hydrophilic amino acids are those with charged or polar side chains, including, but not limited to, arginine (R), asparagine (N), aspartic acid (D), glutamine (Q), glutamic acid (E), histidine (H), lysine (K), serine (S), and threonine (T).
[0026] The terms polynucleotide and oligonucleotide are used interchangeably and refer to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides or analogs thereof. Polynucleotides can have any three-dimensional structure and may perform any function, known or unknown. The following are non-limiting examples of polynucleotides: a gene or gene fragment (for example, a probe, primer, EST or SAGE tag), exons, introns, messenger RNA (mRNA), transfer RNA, ribosomal RNA, RNAi, ribozymes, cDNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes and primers. A polynucleotide can comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs. If present, modifications to the nucleotide structure can be imparted before or after assembly of the polynucleotide. The sequence of nucleotides can be interrupted by non-nucleotide components. A polynucleotide can be further modified after polymerization, such as by conjugation with a labeling component. The term also refers to both double- and single-stranded molecules. Unless otherwise specified or required, any embodiment disclosed herein that is a polynucleotide encompasses both the double-stranded form and each of two complementary single-stranded forms known or predicted to make up the double-stranded form.
[0027] A polynucleotide is composed of a specific sequence of four nucleotide bases: adenine (A); cytosine (C); guanine (G); thymine (T); and uracil (U) for thymine when the polynucleotide is RNA. Thus, the term polynucleotide sequence is the alphabetical representation of a polynucleotide molecule. This alphabetical representation can be input into databases in a computer having a central processing unit and used for bioinformatics applications such as functional genomics and homology searching.
[0028] The term isolated or recombinant as used herein with respect to nucleic acids, such as DNA or RNA, refers to molecules separated from other DNAs or RNAs, respectively that are present in the natural source of the macromolecule as well as polypeptides. The term isolated or recombinant nucleic acid is meant to include nucleic acid fragments which are not naturally occurring as fragments and would not be found in the natural state. The term isolated is also used herein to refer to polynucleotides, polypeptides and proteins that are isolated from other cellular proteins and is meant to encompass both purified and recombinant polypeptides. In other embodiments, the term isolated or recombinant means separated from constituents, cellular and otherwise, in which the cell, tissue, polynucleotide, peptide, polypeptide, protein, antibody or fragment(s) thereof, which are normally associated in nature. For example, an isolated cell is a cell that is separated from tissue or cells of dissimilar phenotype or genotype. An isolated polynucleotide is separated from the 3 and 5 contiguous nucleotides with which it is normally associated in its native or natural environment, e.g., on the chromosome. As is apparent to those of skill in the art, a non-naturally occurring polynucleotide, peptide, polypeptide, protein, antibody or fragment(s) thereof, does not require isolation to distinguish it from its naturally occurring counterpart.
[0029] It is to be inferred without explicit recitation and unless otherwise intended, that when the present disclosure relates to a polypeptide, protein, polynucleotide or antibody, an equivalent or a biologically equivalent of such is intended within the scope of this disclosure. As used herein, the term biological equivalent thereof is intended to be synonymous with equivalent thereof when referring to a reference protein, antibody, fragment, polypeptide or nucleic acid, intends those having minimal homology while still maintaining desired structure or functionality. Unless specifically recited herein, it is contemplated that any polynucleotide, polypeptide or protein mentioned herein also includes equivalents thereof. In one aspect, an equivalent polynucleotide is one that hybridizes under stringent conditions to the polynucleotide or complement of the polynucleotide as described herein for use in the described methods. In another aspect, an equivalent antibody or antigen binding polypeptide intends one that binds with at least 70%, or alternatively at least 75%, or alternatively at least 80%, or alternatively at least 85%, or alternatively at least 90%, or alternatively at least 95% affinity or higher affinity to a reference antibody or antigen binding fragment. In another aspect, the equivalent thereof competes with the binding of the antibody or antigen binding fragment to its antigen tinder a competitive ELISA assay. In another aspect, an equivalent intends at least about 80% homology or identity and alternatively, at least about 85%, or alternatively at least about 90%, or alternatively at least about 95%, or alternatively 98% percent homology or identity and exhibits substantially equivalent biological activity to the reference protein, polypeptide or nucleic acid.
[0030] A polynucleotide or polynucleotide region (or a polypeptide or polypeptide region) having a certain percentage (for example, 80%, 85%, 90%, or 95%) of sequence identity to another sequence means that, when aligned, that percentage of bases (or amino acids) are the same in comparing the two sequences. The alignment and the percent homology or sequence identity can be determined using software programs known in the art. In certain embodiments, default parameters are used for alignment. A non-limiting exemplary alignment program is BLAST, using default parameters. In particular, exemplary programs include BLASTN and BLASTP, using the following default parameters: Genetic code=standard; filter=none; strand=both; cutoff=60; expect=10; Matrix=BLOSUM62; Descriptions=50 sequences; sort by=HIGH SCORE; Databases=non-redundant, GenBank+EMBL+DDBJ+PDB+GenBank CDS translations+SwissProtein+SPupdate+PIR. Details of these programs can be found at the following Internet address: ncbi.nlm.nih.gov/cgi-bin/BLAST. Sequence identity and percent identity were determined by incorporating them into clustalW (available at the web address: genome.jp, Bioinformatics Tools, last accessed on Jul. 14, 2016).
[0031] As used herein the term modified used to describe a protein that differs from the isolated wild type protein in at least one aspect: that it is produced artificially, e.g. through recombinant expression, mutagenesis, etc. A modified protein may comprise one or more mutations. Suitable mutations include insertions, deletions, substitutions, and/or frameshifts in the amino acid sequence of the protein. The term point mutation as used herein refers to a substitution at a single amino acid position in the amino acid sequence of the protein. A modified protein may comprise one or more point mutations.
[0032] The term recombinant expression system as used herein refers to a construct or vector designed to allow gene expression of a protein or peptide in a host cell. Recombinant expression systems generally employ a bacterial plasmid or viral vector. In addition to the gene to be expressed, such expression systems may comprise one or more regulatory polynucleotide sequences such as enhancers, inducers, or promoters that control the expression of the protein or peptide. Alternatively or in addition, such expression systems may comprise one or more detectable labels to assist in the purification of the protein or peptide. The appropriate recombinant expression system may be selected depending on the host cell, e.g. pMCSG81 for expression in E. coli. Further tags and/or other detectable labels (cleavable or non-cleavable) may be used at the C-terminus or N-terminus of the protein being expressed, e.g. a non-cleavable His.sub.6 tag at the C-terminus of the protein being expressed.
[0033] The term plant as used herein refers to a multicellular eukaryote of the kingdom Plantae. A plant cell refers to cells characteristically found in plants characterized by the presence of a cell wall comprising cellulose and the presence of plastids, e.g. choloroplasts. The term genetically modified is used to describe a plant whose genetic material has been artificially altered, e.g. by transfection of a recombinant expression system into one or more of its cells, mutagenesis, etc.
Modes of Carrying Out the Disclosure
[0034] The present disclosure relates generally to a modified rubisco activase. Rubisco activase is an enzyme found in plants that is responsible for the activation of rubiscothe first enzyme in the carbon fixation pathway of photosynthesis in plants.
[0035] The sequence of rubisco activase for a variety of plant species, e.g. C6T859 (>gi|290766491|gb|ADD60248.1|beta-form rubisco activase [Glycine max]). The AAA+ domain houses its ATP hydrolysis function. See Stotz M. et al. Structure of green-type Rubisco activase from tobacoo. Nature Str Mol Biol. 18:1366-70 (2011). The canoncial sequence of soy rubisco activase is:
TABLE-US-00001 MAASVSTVGAVNRALLNLNGSGAGASAPSSAFFGTSLKKVIASRVPNSKV SGGSFKIVAVEEKKEIEETQQTDKDRWKGLAYDISDDQQDITRGKGLVDS LFQAPQDAGTHYAVMSSYEYLSTGLRQYLDNKMDGFYIAPAFMDKLVVHI SKNFMTLPNIKVPLILGIWGGKGQGKSFQCELVFAKMGINPINMSAGELE SGNAGEPAKLIRQRYREAADMIKKGKMCALFINDLDAGAGRLGGTTQYTV NNQMVNATLMNIADNPTNVQLPGMYNKEENPRVPIIVIGNDFSTLYAPLI RDGRMEKEYWAPTREDRIGVCTGIFRTDGIPEQDIVKLVDTFPGQSIDFF GALRARVYDDEVRKWISGVGVDSVGKKLVNSKDGPPTFEQPKMTLEKLLL YGNMLVQEQENVKRVQLADKYLNEAALGNANEDAIQRGTFFQS
[0036] The italicized, underlined segment above is the chloroplast transit peptide, which is removed in the mature protein sequence. The amino acid numbering referred to herein corresponds to the mature protein sequence (without the chloroplast transit peptide).
[0037] The bolded, underlined segment above is the AAA+ domain of this enzyme. The AAA+ domain is defined as amino acids 68-360 in Arabidopsis thaliana. See
[0038] In some embodiments, the modified rubisco activase comprises one or more mutations in the AAA+ domain of the enzyme. In some embodiments, the rubisco activase comprises a point mutation at one or more amino acid positions selected from 135, 163, and 262 based on the soy rubisco activase sequence provided herein above. In some embodiments, the modified rubisco activase comprises point mutations at one, two, or all three amino acid positions. In some embodiments, the rubisco activase comprises one or more point mutations selected from M135R, M163I, and V262I.
[0039] The positions of mutations in the soy rubisco activase disclosed herein can be used to determine suitable point mutation sites in other rubisco activase. For example, the canonical sequence of the corresponding protein in Miscanthus giganteus (Miscanthus rubisco activase) is:
TABLE-US-00002 MAAAFSSTVGAPASTPSRSSFLGKKLNKQQVSAAAVNYHGKSSSSAANRF KVMAAKEVDETKETDGDRWKGLAFDISDDQQDITRGKGMIDSLFQAPMGD GTHVAVLSSYDYISQGQKTYSMDNTMDGFYIARGFMDKLVVHLSKNFMKL PNIKVPLILGIWGGKGQGKSFQCELVFAKMGIIPIMMSAGELESGNAGEP AKLIRQRYREAADLISKGEMSCLFINDLDAGAGRMGGTTQYTVNNQMVNA TLMNIADNPTNVQLPGMYNKVDNARVPIIVTGNDFSTLYAPLIRDGRMEK FYWAPTREDRIGVCKGIFRTDGVDEEHVVQLVDTFPGQSIDFFGALRARV YDDEVRRWVAETGVENIAKKLVNSKDGPPTFEQPKMTIEKLLEYGHMLVA EQENVKRVQLADKYLNEAALGAANEDAMKTGNFFK
[0040] As with the soybean rubisco activase sequence, the italicized, underlined segment above is the chloroplast transit peptide, which is removed in the mature protein sequence. The amino acid numbering referred to herein corresponds to the mature protein sequence (without the chloroplast transit peptide). The bolded, underlined segment above is the AAA+ domain of this enzyme.
[0041] The corresponding Miscanthus protein can be modified to have a point mutation at one or more amino acid positions selected from 135, 163, and 262 based on the soy rubisco activase sequence provided herein above. Based on alignment to soy rubisco activase (
[0042] In both cases, the sequence numbers for the point mutations were determined from the N-terminal residue of each mature protein (i.e., chloroplast transit peptide sequence deleted). The numbers vary slightly because of differences in the N-terminal residues between soy rubisco activase and the corresponding Miscanthus protein. The corresponding mutations in other rubisco activase sequences, including but not limited to those listed in
[0043] Aspects of the disclosure relate to a modified rubisco activase with a melting temperature greater than that of wild type rubisco activase; thus, a heat-stable rubisco activase.
[0044] Melting temperature can be measured thermofluor assay (also referred to as Differential Scanning Fluorimetry assay) using Sypro orange dye. See Vedadi et al. Chemical screening methods to identify ligands that promote protein stability, protein crystallization, and structure determination. PNAS, 103, 15835-15840 (2006); Niesen et al. The use of differential scanning fluorimetry to detect ligand interactions that promote protein stability. Nat Protoc. 2, 2212-21 (2007).
[0045] In some embodiments, the modified rubisco activase has a melting temperature greater than about 30.4 C., 34.5 C., 34.9 C., 38.8 C., 39.8 C., 42.8 C., 44.4 C., or 46.0 C. In some embodiments, the rubisco activase has a melting temperature at least about 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, or 14 C. greater than the melting temperature of wild type rubisco activase.
[0046] Further aspects of the disclosure relate to an isolated polynucleotide encoding a modified rubisco activase disclosed herein. Methods of determining the isolated polynucleotide sequence of a given protein or peptide are well understood.
[0047] The isolated polynucleotide may be comprised in a recombinant expression system. In some embodiments, the recombinant expression system may be codon optimized or otherwise altered to enhance expression, e.g. through the inclusion of one or more regulatory polynucleotide sequences.
[0048] A non-limiting exemplary expression system may be pMCSG81 (vector).
[0049] A plant cell may be transfected with the recombinant expression system. Techniques for transfection of recombinant expression system are selected based on the host cell used. Non-limiting exemplary methods of transfection tailored to plant cells include using a bacterial or viral vector (e.g. via Agrobacterium tumefaceins transfection, described in Kurek et al. The Plant Cell (2007) 19:3230-3241).
[0050] Certain aspects of the disclosure relate to a genetically modified plant expressing the isolated polynucleotide encoding a modified rubisco activase disclosed herein. Non-limiting examples of plants that may be genetically modified include: Arabidospis, soybean, Miscanthus giganteus plant, and those plants with rubisco activase sequences listed in
Example 1Generation of Heat-Stable Modified Rubisco Activase
[0051] Soybean Rubisco Activase AAA+ domain was first cloned in a vector and amino acid substitutions were performed using standard mutagenesis methods. (QuikChange site directed mutagenesis kits from Agilent Technologies). Primers used in this process are provided herein below:
TABLE-US-00003 PrimersforcloningintopMCSG81 (withC-termHis-Tag,non-cleavable): p81SS-F GGAGTAAAGATAATGGCAGTGGAGGAGAAAAAAGAGATTGAAG p8155-R GTGATGGTGATGATGTGATTGAAAGAATGTGCCACGTTGGATT p815SAAA-F GGAGTAAAGATAATGCTGGATAACAAAATGGATGGTTTTTACATTGCT p81SSAAA-R GTGATGGTGATGATGTTTATCTGCCAGTTGCACGCGTTTAACA MutagenicPrimersforconstructingsite-directed mutants:Targetcodonisunderlinedandbase changesareboldedanditalicized M135RF(inforwardprimer) GGGTATCAATCCAATTCGGATGAGTGCTGGAGAACTCG M135RR CGAGTTCTCCAGCACTCATCCGAATTGGATTGATACCC M163IF CCGGGAAGCAGCCGATATCATTAAGAAAGGAAAAATG M163IR CATTTTTCCTTTCTTAATGATATCGGCTGCTTCCCGG V262IF CGTGAAGATCGTATTGGTATCTGTACAGGTATTTTC CGCAC V262IR GTGCGGAAAATACCTGTACAGATACCAATACGATCT TCACG
[0052] A total of 48 full length soybean rubisco activase mutants were generated and analyzed for heat stability relative to wild type full length soybean rubisco activase.
[0053] Three individual mutants, each comprising a single point mutation, demonstrated melting temperature increases between 4.1-8.4 C. relative to wild type rubisco activase (Table 1). Further, a triple mutant comprising all three point mutations had a melting temperature increase of 14 C. (Table 1;
TABLE-US-00004 TABLE 1 Protein Tm ( C.) Tm ( C.) WT 30.4 M135R 38.8 8.4 M163I 34.9 4.5 V262I 34.5 4.1 Triple mutant 44.4 14
[0054] Rubisco activase from Miscanthus giganteus was cloned and expressed with the intention of transferring the stability mutations observed in the soybean rubisco activase. The Miscanthus rubisco activase (short form) was produced as both the full-length protein and the corresponding AAA+ domain, as described for the soybean rubisco activase. Not to be bound by theory, the Miscanthus rubisco activase is believed to have a higher stability compared to the corresponding soybean protein. The candidate stability mutants in the Miscanthus sequence are M133R, L161I and V260I. These mutations were incorporated using site-directed mutagenesis and the melting temperatures were assessed.
[0055] The Miscanthus rubisco activase (short form), codon optimized (stop codon in lower case) nucleic acid sequence is:
TABLE-US-00005 GCAGCCAAAGAAGTGGACGAAACAAAAGAAACTGATGGTGATCGTTGGAA AGGCCTTGCGTTTGATATTAGTGATGACCAACAAGATATTACTCGTGGTA AAGGCATGATTGATTCTTTATTTCAAGCACCTATGGGTGACGGAACGCAC GTTGCAGTTTTATCTTCTTACGATTATATTTCCCAAGGTCAAAAAACATA TTCAATGGATAATACTATGGACGGCTTTTATATTGCGCGCGGTTTTATGG ATAAACTCGTGGTTCATCTCAGCAAAAATTTTATGAAACTTCCAAACATT AAAGTACCGTTAATCCTGGGCATTTGGGGAGGAAAAGGTCAAGGCAAATC ATTTCAATGTGAATTAGTATTTGCGAAAATGGGGATTATTCCAATTATGA TGTCTGCAGGCGAATTAGAAAGCGGGAATGCGGGCGAACCAGCTAAACTT ATCCGTCAGCGTTATCGTGAAGCGGCTGATTTAATCTCAAAAGGCAAAAT GTCGTGTCTCTTTATCAATGATTTAGATGCGGGCGCTGGACGTATGGGCG GGACGACTCAATATACTGTTAACAATCAAATGGTGAACGCTACCCTGATG AATATTGCTGATAACCCTACGAATGTACAATTACCTGGCATGTATAACAA AGTTGATAACGCACGCGTACCGATTATTGTCACTGGTAACGATTTTAGCA CCCTTTACGCACCCCTTATTCGTGACGGTCGCATGGAAAAATTTTATTGG GCACCAACTCGGGAGGATCGCATCGGAGTTTGTAAAGGCATTTTTCGGAC TGATGGTGTTGATGAGGAACATGTTGTGCAATTAGTGGATACGTTCCCTG GTCAAAGTATTGATTTCTTCGGCGCCCTCCGCGCTCGTGTGTATGACGAC GAAGTACGCCGCTGGGTCGCAGAAACTGGTGTTGAAAATATCGCCAAAAA ATTAGTAAATTCCAAAGACGGCCCCCCTACTTTCGAACAACCTAAAATGA CTATTGAAAAATTATTAGAATATGGTCACATGCTGGTAGCAGAACAAGAA AACGTTAAACGCGTACAACTTGCCGATAAATACTTGAATGAAGCAGCACT TGGAGCAGCTAACGAAGATGCGATGAAAACTGGAAATTTTTTTAAAtaa
The corresponding amino acid sequence is:
TABLE-US-00006 AAKEVDETKETDGDRWKGLAFDISDDQQDITRGKGMIDSLFQAPMGDGT HVAVLSSYDYISQGQKTYSMDNTMDGFYIARGFMDKLVVHLSKNFMKLP NIKVPLILGIWGGKGQGKSFQCELVFAKMGIIPIMMSAGELESGNAGEP AKLIRQRYREAADLISKGKMSCLFINDLDAGAGRMGGITQYTVNNQMVN ATLMNIADNPINVQLPGMYNKVDNARVPIIVTGNDFSTLYAPLIRDGRM EKFYWAPTREDRIGVCKGIFRTDGVDEEHVVQLVDTFPGQSIDFFGALR ARVYDDEVRRWVAETGVENIAKKLVNSKDGPPTFEQPKMTIEKLLEYGH MLVAEQENVKRVQLADKYLNEAALGAANEDAMKTGNEFK
[0056] The following primers were used for cloning this sequence into pMCSG81:
TABLE-US-00007 38551_Full_p81-F GGAGTAAAGATAATGGCAGCCAAAGAAGTGGACGAAACAAAA 38551_AAA_p81-F GGAGTAAAGATAATGTCAATGGATAATACTATGGACGGCTTTTATATTG 38551_Full_p81-R GTGATGGTGATGATGTTTAAAAAAATTTCCAGTTTTCATCGCATCTTCG TTA 38551_AAA_p81-R GTGATGGTGATGATGTTTATCGGCAAGTTGTACGCGTTTAACG
[0057] The mutations corresponding to those in soybean rubisco activase were determined by aligning the sequences (
[0058] Mutagensis was accomplished using the following primers to introduce the stability mutations. The capitalized bases are those base changes required to change the corresponding amino acid.
TABLE-US-00008 Forwardprimers: M133R(F) ggggattattccaattCGgatgtctgcaggcgaattag L1611(F) cgttatcgtgaagcggctgatAtCatctcaaaaggcaaaatgtc V2601(F) ggaggatcgcatcggaAtttgtaaaggcatttttcgg Reverseprimers: M133R(R) ctaattcgcctgcagacatcCGaattggaataatcccc L1611(R) gacattttgccttttgagatGaTatcagccgcttcacgataacg V2601(R) ccgaaaaatgcctttacaaaTtccgatgcgatcctcc
[0059] The melting temperature was measured using Differential Scanning Flourimetry (Thermofluor assay) on small scale protein isolated and partially purified using Ni2+ bead sand are shown in the Table 2 below.
TABLE-US-00009 TABLE 2 Protein Tm ( C.) Tm ( C.) WT 39.8 M133R 44.0 4.2 L161I V260I 42.8 3.0 Triple mutant 46.0 6.2
Example 2Production of Modified Rubisco Activase and Assessment
[0060] Modified rubisco activases of Table 1 are produced using a recombinant expression system.
[0061] The proteins were subjected to ATP hydrolysis activity assay, which measures the ATP hydrolysis part of the rubisco activase function. Without the ATP hydrolysis activity, rubisco activase cannot activate rubisco; thus, successful ATP hydrolysis indicates that the ATP hydrolysis part of rubisco activase function is maintained by the mutants (
[0062] This is repeated for the rubisco activases of Table 2 and the stability mutants for Miscanthus.
[0063] Rubisco activase assay (e.g. Barta et al. (2011) Chapter 29, Photosynthesis Research Protocols, Methods in Molecular Biology, vol. 684, DOI 10.1007/978-1-60761-925-3_29; Scales et al. Photosynth Res (2014) 119:355-365, DOI 10.1007/s11120-013-9964-5) is carried out to assess rubisco activase function.
Example 3Assessment of Modified Rubisco Activase Effect on Plant Growth
[0064] Rubisco activase is transfected into A. thaliana and tobacco and assessed for its effect on plant growth. See, generally, Kurek et al. The Plant Cell (2007) 19:3230-3241. The plant growth characteristics of plants transfected with wild type rubisco activase versus the stability mutants are compared.