Diagnosis and treatment of chronic obstructive pulmonary disease (COPD) based on elevated levels of extracellular H3 protein

09933435 ยท 2018-04-03

Assignee

Inventors

Cpc classification

International classification

Abstract

Provided is a method for diagnosing and/or staging COPD based on detection of one or more histone proteins. In some embodiments, the histone protein is an H3.3 protein comprising a post-translational modification. In some embodiments, the histone protein is H2B, H3, H3.3 or H4. Kits for practicing the methods of diagnosis and/or staging are provided as well. Further provided is a method for treating COPD.

Claims

1. A method of treating chronic obstructive pulmonary disease (COPD) in a patient in need of such treatment, the method comprising: (a) determining the level of extracellular H3 protein in a test sample of the patient; (b) comparing the level of extracellular H3 protein in the test sample with the level of extracellular H3 protein in a control sample; (c) determining an elevated level of extracellular H3 protein in the test sample as compared to the level of extracellular H3 protein in the control sample; and (d) administering a COPD treatment to the patient having the elevated level of extracellular H3 protein, wherein extracellular H3 protein comprises one or more of H3.1, H3.2, and H3.3.

2. The method of claim 1 wherein the control sample is from a healthy person without COPD.

3. The method of claim 1 wherein the control sample is from an ex-smoker without COPD.

4. The method of claim 1 wherein the control sample is from a GOLD 0 patient.

5. The method of claim 1 wherein the test sample is from the airway of the patient.

6. The method of claim 5 wherein the test sample comprises mucus plugs from the airway of the patient.

7. The method of claim 5 wherein the test sample comprises cell debris that was attached to the cilia of airway epithelial cells of the patient.

8. The method of claim 1 wherein the test sample comprises bronchoalveolar fluid of the patient.

9. The method of claim 1 wherein extracellular H3 protein is measured in a test sample comprising a biological fluid sample of the patient.

10. The method of claim 9 wherein the biological fluid is plasma or serum.

11. A method of treating chronic obstructive pulmonary disease (COPD) in a patient in need of such treatment comprising: administering a COPD treatment to a patient in which a test sample from the patient has been determined to contain an elevated level of extracellular H3 protein compared to the level of extracellular H3 in a control sample, wherein extracellular H3 protein comprises one or more of H3.1, H3.2, and H3.3.

12. The method of claim 11 wherein the control sample is from a healthy person without COPD, form an ex-smoker without COPD, or from a Global Initiative for Chronic Obstructive Lung Disease (GOLD) 0 patient.

13. The method of claim 11 wherein the test sample is from the airway of the patient.

14. The method of claim 13 wherein the test sample comprises mucus plugs from the airway of the patient.

15. The method of claim 13 wherein the test sample comprises cell debris that was attached to the cilia of airway epithelial cells of the patient.

16. The method of claim 11 wherein the test sample comprises bronchoalveolar fluid of the patient.

17. The method of claim 11 wherein extracellular H3 protein is measured in a test sample comprising a biological fluid sample of the patient.

18. The method of claim 17 wherein the biological fluid is plasma or serum.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) FIGS. 1A and 1B illustrate that H2B and H3 are elevated in COPD patients. FIG. 1A: Western blots were performed for H2B and H3 from individual subjects used to form the pooled samples. Bands were scanned densitometrically and band density was normalized to Lamin A/C band density. FIG. 1B: H3 levels were determined in GOLD 4 and GOLD 1, 2 and 3, non-smokers (never smoked), GOLD 0 (ex-smokers), smokers and patients with other lung inflammatory diseases (sarcoidosis (Sar), idiopathic pulmonary fibrosis (IPF), and pulmonary hypertension (PPH)) by ELISA.

(2) FIGS. 2A-2C illustrate H3.3 post-translational modification in COPD patients. FIG. 2A: Uniprot based H3.3 sequence (SEQ ID NO: 1) showing some of the post translationally modified residues identified by mass spectroscopy in COPD as compared to ex-smokers controls. See also Table 3. FIG. 2B: Identification of H3.3 peptide (aa 19-27 of SEQ ID No. 1; SEQ ID No. 32) containing K24Ac (H3.3K24Ac) using doubly charged precursor ion (m/z=441.60). FIG. 2C: Western blotting to confirm H3.3K24Ac and determine the extent of expression of this post-translational modification. Lamin A/C was used as an internal control.

(3) FIG. 3 illustrates expression of H2B and H3 in lung tissue. Immunohistochemical analysis of the lungs of COPD subjects showing the presence of H2B and H3 extracellularly in the lumen of airway inside of the plug of mucus together with cell debris, and the free histones are attached to the cilia of the epithelial cells. Some monocyte cells, which have very dense staining in the nucleus but stain barely in the cytoplasm, were found in the parenchyma surrounding a clog of cells and nude nucleus. The bottom row of micrographs is expanded from the corresponding boxes in the middle row of micrographs.

(4) FIGS. 4A and 4B illustrate H3 in BALF and plasma of COPD patients. FIG. 4A: ELISA quantitation of H3 in bronchoalveolar fluid of subjects with moderately severe COPD (GOLD II) and ex-smokers controls. FIG. 4B: Western blots of H3 in plasma of subjects with severe COPD (GOLD IV) and ex-smoker controls.

(5) FIGS. 5A-5D illustrate that histones induce apoptosis in vitro in human bronchio-epithelial cells (HBEC) and correlate with increased apoptosis in COPD. FIG. 5A: Determination of the histone cytotoxicity in bronchio-epithelial primary cells using a mix of purified histones and measured by flow cytometry for annexin V staining. FIG. 5B: The effect of albumin on histone cytotoxicity (top); The effect of acetylation of histones on cytotoxicity (bottom). FIG. 5C: Measurement of time dependent caspase 7 activation by Western blotting of endoplasmic reticulum (ER) enriched and cytoplasmic fractions to determine the mechanism implicated in the cytotoxicity of histones. FIG. 5D: Measurement of H3 and apoptosis hallmarker caspase 3 cleavage in lung extracts of COPD and controls.

(6) FIGS. 6A and 6B illustrate that core histone proteins are elevated in COPD. FIG. 6A: Core histone proteins are elevated in COPD as demonstrated by SDS-PAGE of the pooled nuclear lung lysate from COPD GOLD IV (G IV) (n=5) and GOLD 0 (G0) controls (n=5). FIG. 6B: Bar-graph showing the similar distribution of the total proteins identified by mass spectroscopy in COPD GIV and Control G0.

DEFINITIONS

(7) As used herein, each of the following terms has the meaning associated with it in this section.

(8) The articles a and an are used herein to refer to one or to more than one (i.e. to at least one) of the grammatical object of the article. By way of example, an element means one element or more than one elements.

(9) The term about will be understood by persons of ordinary skill in the art and will vary to some extent depending on the context in which it is used. As used herein, about is meant to encompass variations of 20% or 10%, more preferably 5%, even more preferably 1%, and still more preferably 0.1%.

(10) The term in vitro method, as used herein, refers to a method carried out outside of a living organism as opposed to an in vivo method which is a method carried out inside or on a living organism.

(11) The term H3.3, as used herein, refers to Histone 3.3 and all isoforms and allelic variations thereof. (SEQ ID NO: 1) (FIG. 2A) (UniprotKB Accession No. P84243)

(12) The term H2A, as used herein, refers to Histone 2A and all isotypes, isoforms and allelic variations thereof. e.g. Histone 2A type 1 (SEQ ID NO: 2) (UniprotKB Accession No. P0C0S8)

(13) TABLE-US-00001 (SEQIDNO:2) 10203040 MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNY 50607080 AERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRII 90100110120 PRRLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK 130 TESHHKAKGK

(14) The term H2B, as used herein, refers to Histone 2B and all isotypes, isoforms and allelic variations thereof. e.g. Histone 2B type 1-A (SEQ ID NO: 3) (UniprotKB Accession No. Q96A08)

(15) TABLE-US-00002 (SEQIDNO:3) 10203040 MPEVSSKGATISKKGFKKAVVKTQKKEGKKRKRTRKESYS 50607080 IYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEAS 90100110120 RLAHYSKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAV TKYTSSK
or Histone 2B type F-S (Histone type F-S) (SEQ ID NO:4) (UniprotKB Accession No. P57053)

(16) TABLE-US-00003 (SEQIDNO:4) 10203040 MPEPAKSAPAPKKGSKKAVTKAQKKDGRKRKRSRKESYSV 50607080 YVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASR 90100110120 LPHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSAK
Other isotypes of H2B comprise: H2B type 2-E (UniprotKB Accession No. Q16778) H2B type 1-C/E/F/G/I (UniprotKB Accession No. P62807) H2B type 1-J (UniprotKB Accession No. P06899) H2B type 1-L (UniprotKB Accession No. Q99880) H2B type 1-D (UniprotKB Accession No. P58876) H2B type 1-O (UniprotKB Accession No. P23527) H2B type 1-B (UniprotKB Accession No. P33778) H2B type 1-H (UniprotKB Accession No. Q93079) H2B type 1-M (UniprotKB Accession No. Q99879) H2B type 1-N (UniprotKB Accession No. Q99877) H2B type 1-K (UniprotKB Accession No. O60814) H2B type F-M (UniprotKB Accession No. P0C1H6) H2B type 3-B (UniprotKB Accession No. Q8N257) H2B type 2-F (UniprotKB Accession No. Q5QNW6) H2B type 2-B (UniprotKB Accession No. Q64525) H2B type W-T (UniprotKB Accession No. Q7Z2G1)

(17) The term H3, as used herein, refers to Histone 3 and all isotypes, isoforms and allelic variations thereof. e.g. Histone 3.1 (Histone 3 type 1) (SEQ ID NO: 5) (UniprotKB Accession No. KB P68431)

(18) TABLE-US-00004 (SEQIDNO:5) 10203040 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPH 50607080 RYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK 90100110120 TDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI 130 MPKDIQLARRIRGERA
or Histone 3.2 (SEQ ID NO: 6) (UniprotKB Accession No. Q71DI3)

(19) TABLE-US-00005 (SEQIDNO:6) 10203040 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPH 50607080 RYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK 90100110120 TDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI 130 MPKDIQLARRIRGERA.

(20) The term H4, as used herein, refers to Histone 4 and all isotypes, isoforms and allelic variations thereof. (SEQ ID NO: 7) (UniprotKB Accession No. KB P62805)

(21) TABLE-US-00006 (SEQIDNO:7) 10203040 MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLAR 50607080 RGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK 90100 TVTAMDVVYALKRQGRTLYGFGG.

(22) As used herein, post-translational modification refers to any chemical modification of a polypeptide after it is produced. Commonly, a post-translational modification involves attaching at least one moiety to the polypeptide chain, however, post-translational modification can be cleavage of the polypeptide chain, proteolytic processing, the formation of disulfide bonds, and the like. Non-limiting examples of post-translational modifications include glycosylation, phosphorylation, acylation, acetylation, methylation, sulfonation, prenylation, isoprenylation, ubiquitination, biotinylation, formylation, citrullination, myristolation, ribosylation, sumoylation, gamma carboxylation, ADP-ribosylation, amidation, covalent attachment of flavin, covalent attachment of a heme moiety, covalent attachment of a nucleotide or nucleotide derivative, covalent attachment of a lipid or lipid derivative, covalent attachment of phosphatidylinositol, cross-linking, cyclization, demethylation, formation of covalent cross-links, formation of cystine, formation of pyroglutamate, CPI anchor formation, hydroxylation, iodination, methylation, nitrosylation, oxidation, proteolytic processing, racemization, selenoylation, sulfation, transfer-RNA mediated addition of amino acids to proteins such as arginylation, and the like. See, for instance, ProteinsStructure and Molecular Properties, 2.sup.nd Ed., T. E. Creighton, W.H. Freeman and Company, New York, 1993 and Wold, F., Posttranslational Protein Modifications: Perspectives and Prospects, pgs. 1-12 in Posttranslational Covalent Modification of Proteins, B. C. Johnson, Ed., Academic Press, New York, 1983; Seifter et al, (1990) Analysis for Protein Modifications and Nonprotein Cofactors, Methods Enzymol. 182:626-46 and Rattan et al. (1992) Protein Synthesis: Posttranslational Modifications and Aging, Ann. NY Acad. Sci. 663:48-62.

(23) As used herein, chronic obstructive pulmonary disease (COPD) refers to a chronic progressive lung disease. Chronic bronchitis and emphysema are non-limiting examples of COPD. COPD can be diagnosed by pulmonary function tests and/or chest X-rays in accordance with accepted clinical practice. Clinically relevant diagnostic tests include: FEV.sub.1 (the volume of air forcefully expired during the first second after taking a full breath); forced vital capacity (FVC; the total volume of air expired with maximal force); and flow-volume loops, which are simultaneous spirometric recordings of airflow and volume during forced maximal expiration and inspiration. Reductions of FEV.sub.1, FVC, and the ratio of FEV.sub.1/FVC are hallmarks of airflow limitation. See Merck Manual Online for Healthcare Professionals, Pulmonary Disorders, Chronic Obstructive Pulmonary Disorder, Introduction (downloaded from www(dot)merckmanuals(dot)com/professional/sec05/ch049/ch049a(dot)html on 19 Dec. 2010). Severity of disease can be assessed on the same criteria.

(24) GOLD is the abbreviation for the Global Initiative for Chronic Obstructive Lung Disease. GOLD classifications designate the severity of disease for COPD patients as shown in Table 1.

(25) TABLE-US-00007 TABLE 1 GOLD classification Description Criteria 0 At-risk of COPD I Mild COPD FEV.sub.1/FVC < 0.7 FEV.sub.1 80% predicted II Moderate COPD FEV.sub.1/FVC < 0.7 50% FEV1 < 80% predicted III Severe COPD FEV.sub.1/FVC < 0.7 30% FEV1 < 50% predicted IV Very severe COPD FEV.sub.1/FVC < 0.7 FEV1 < 30% predicted or FEV1 < 50% predicted with chronic respiratory failure GOLD I-IV are also known as GOLD 1-4, respectively.

(26) As used herein, severity of COPD refers generally to the extent of airflow limitation and optionally to associated symptoms such as chronic coughing and sputum production, as clinically defined parameters. The GOLD classifications are exemplary for classifying COPD severity.

(27) Increased severity of COPD is used herein to refer to an increase in airflow limitation (e.g., increased limitation in airflow) and optionally to worsening of associated symptoms such as chronic coughing and sputum production in a COPD patient relative to a normal reference, or relative to the subject at an earlier point in time. An exemplary normal reference can be a non-smoker or an ex-smoker who does not have clinical evidence of COPD, or a population of non-smokers and/or ex-smokers who do not have clinical evidence of COPD. The normal reference can be representative of the patient with regard to approximate age, age group, body-mass index (BMI), gender and/or other parameters.

(28) At risk for developing COPD refers to a subject having one or more risk factors for COPD. Risk factors known in the art include, but are not limited to, a history of tobacco smoking; long term exposure to one or more of organic dust, inorganic dust, chemical fumes, smoke such as from burning biomass or coal, gases, vapors and mists; and .sub.1-antitrypsin deficiency.

(29) As used herein, the term subject or patient refers to any animal (e.g., a mammal) including, but not limited to, humans and non-human primates, at risk for developing COPD or diagnosed with COPD. Typically, the terms subject and patient are used interchangeably herein in reference to a human subject.

(30) As used herein, a normal subject or control subject refers to a subject that does not manifest clinical symptoms of COPD.

(31) As used herein, a normal reference refers to a normal subject or to a population of normal subjects.

(32) Increased susceptibility of developing COPD is used herein to refer to an increase in the likelihood or possibility of a subject developing COPD relative to a normal reference, or relative to the subject at an earlier point in time. An exemplary normal reference can be a non-smoker or an ex-smoker who does not have clinical evidence of COPD, or a population of non-smokers and/or ex-smokers who do not have clinical evidence of COPD. The normal reference can be representative of the patient with regard to approximate age, age group, body mass index (BMI), gender and/or other parameters.

(33) Sample or test sample as used herein means a biological material isolated from an individual. The test sample may contain any biological material suitable for detecting the desired biomarkers, and may comprise cellular and/or non-cellular material obtained from the individual. The sample or test sample may comprise a biological fluid, blood, plasma or serum.

(34) As used herein, a detector molecule is a molecule that may be used to detect a compound of interest. Non-limiting examples of a detector molecule are molecules that bind specifically to a compound of interest, such as, but not limited to, an antibody, a cognate receptor or binding partner, an aptamer, and a small molecule.

(35) By the term specifically binds, as used herein with respect to a detector molecule such as an antibody, is meant a detector molecule that recognizes a specific binding partner, such as an antigen, but does not substantially recognize or bind other molecules in a sample. For instance, in a sample containing H2A, an antibody that specifically binds to H2A does not substantially recognize or bind to other molecules in the sample.

(36) The term antibody, as used herein, refers to an immunoglobulin molecule which is able to specifically bind to a specific epitope on an antigen. Antibodies can be intact immunoglobulins derived from natural sources or from recombinant sources and can be immunoreactive portions of intact immunoglobulins. The antibodies in the present invention may exist in a variety of forms including, for example, polyclonal antibodies, monoclonal antibodies, intracellular antibodies (intrabodies), Fv, Fab and F(ab).sub.2, as well as single chain antibodies (scFv), heavy chain antibodies, such as camelid antibodies, and humanized antibodies (Harlow et al., 1999, Using Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, NY; Harlow et al., 1989, Antibodies: A Laboratory Manual, Cold Spring Harbor, N.Y.; Houston et al., 1988, Proc. Natl. Acad. Sci. USA 85:5879-5883; Bird et al., 1988, Science 242:423-426).

(37) By the term synthetic antibody, as used herein, is meant an antibody which is generated using recombinant DNA technology, such as, for example, an antibody expressed by a bacteriophage as described herein. The term should also be construed to mean an antibody which has been generated by the synthesis of a DNA molecule encoding the antibody and which DNA molecule expresses an antibody protein, or an amino acid sequence specifying the antibody, wherein the DNA or amino acid sequence has been obtained using synthetic DNA or amino acid sequence technology which is available and well known in the art.

(38) As used herein, the term heavy chain antibody or heavy chain antibodies comprises immunoglobulin molecules derived from camelid species, either by immunization with a peptide and subsequent isolation of sera, or by the cloning and expression of nucleic acid sequences encoding such antibodies. The term heavy chain antibody or heavy chain antibodies further encompasses immunoglobulin molecules isolated from an animal with heavy chain disease, or prepared by the cloning and expression of V.sub.H (variable heavy chain immunoglobulin) genes from an animal.

(39) As used herein, an immunoassay refers to any binding assay that uses an antibody capable of binding specifically to a target molecule to detect and quantify the target molecule.

(40) It is understood that any and all whole or partial integers between any ranges set forth herein are included herein. As envisioned in the present invention with respect to the disclosed compositions of matter and methods, in one aspect the embodiments of the invention comprise the components and/or steps disclosed herein. In another aspect, the embodiments of the invention consist essentially of the components and/or steps disclosed herein. In yet another aspect, the embodiments of the invention consist of the components and/or steps disclosed herein.

DETAILED DESCRIPTION OF THE INVENTION

(41) COPD is characterized by lung inflammation, cell death and extensive lung tissue remodeling. However, until now methods of diagnosing or staging COPD by employing histones as markers were unknown in the art. There are also few known treatments for COPD. The present invention meets those needs.

(42) Provided are methods for diagnosing or staging COPD by measuring histone protein levels or by detecting post-translational modifications in histone proteins. Diagnosing or staging may be conducted on a patient who is at risk for developing COPD, or someone having one or more risk factors for COPD. Risk factors known in the art include, but are not limited to, a history of tobacco smoking; long term exposure to one or more of organic dust, inorganic dust, chemical fumes, smoke such as from burning biomass or coal, gases, vapors and mists; and .sub.1-antitrypsin deficiency.

(43) Detection of Protein Levels and the Presence of Post-Translational Modifications

(44) The methods described herein rely on assessing the level of a biomarker, whose level correlates in a statistically significant manner with the diagnosis and staging of COPD, in a sample obtained from the patient. The sample may be, without limitations, a biological tissue or a biological fluid. The sample can be selected, without limitations, from lung tissue, bronchoalveolar lavage fluid (BALF), peripheral whole blood, and components thereof such as blood serum (serum) and blood plasma (plasma). In preferred embodiments, the sample is plasma. The sample is obtained from the subject using conventional methods in the art. For instance, one skilled in the art knows how to draw blood and how to process it in order to obtain serum and/or plasma for use in practicing the described methods. Generally speaking, the method of obtaining and storing, if necessary, the sample preferably maintains the integrity of the one or more histone biomarkers the disclosed herein such that it can be accurately quantified in the biological fluid sample.

(45) The methods of the invention include quantitatively measuring the level of an unmodified or post-translationally modified protein biomarker such as H2A, H2B, H3, H3.3 or H4. Methods of quantitatively assessing the level of an unmodified or post-translationally modified protein in a biological fluid such as plasma are well known in the art. In some embodiments, assessing the level of an unmodified or post-translationally modified protein involves the use of a detector molecule for the biomarker. In preferred embodiments, the detector molecule is specific for either the unmodified or the post-translationally modified protein biomarker. Detector molecules can be obtained from commercial vendors or can be prepared using conventional methods in the art. Exemplary detector molecules include, but are not limited to, an antibody that binds specifically to the unmodified or post-translationally modified biomarker, a naturally-occurring cognate receptor, or functional domain thereof, for the unmodified or post-translationally modified biomarker, an aptamer that binds specifically to the unmodified or post-translationally modified biomarker, and a small molecule that binds specifically to the unmodified or post-translationally modified biomarker. Small molecules that bind specifically to an unmodified or post-translationally modified biomarker can be identified using conventional methods in the art, for instance, screening of compounds using combinatorial library methods known in the art, including biological libraries, spatially-addressable parallel solid phase or solution phase libraries, synthetic library methods requiring deconvolution, the one-bead one-compound library method, and synthetic library methods using affinity chromatography selection. Methods for preparing aptamers are also well-known in the art.

(46) The methods of the invention also include detecting the presence or absence of a post-translational modification in a biomarker such as, for example, H3.3, using detector molecules such as those described supra which are specific for a certain post-translationally modified biomarker.

(47) In a preferred embodiment, the level of an unmodified or post-translationally modified biomarker is assessed using an antibody. Thus, exemplary methods for assessing the level of an unmodified or post-translationally modified biomarker in a biological fluid sample include various immunoassays, for example, immunohistochemistry assays, immunocytochemistry assays, ELISA, capture ELISA, sandwich assays, enzyme immunoassay, radioimmunoassay, fluorescence immunoassay, and the like, all of which are known to those of skill in the art. See e.g. Harlow et al., 1988, Antibodies: A Laboratory Manual, Cold Spring Harbor, N.Y.; Harlow et al., 1999, Using Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, NY. Solid phase immunoassays can be particularly useful. Where two or more unmodified or post-translationally modified biomarkers are assessed, a panel of antibodies in an array format can be utilized. Custom antibody microarrays or chips can be obtained commercially.

(48) The generation of polyclonal antibodies is accomplished by inoculating the desired animal with an antigen and isolating antibodies which specifically bind the antigen therefrom.

(49) Monoclonal antibodies directed against one biomarker identified herein may be prepared using any well known monoclonal antibody preparation procedures, such as those described, for example, in Harlow et al. (1988, In: Antibodies, A Laboratory Manual, Cold Spring Harbor, N.Y.) and in Tuszynski et al. (1988, Blood, 72:109-115). Human monoclonal antibodies may be prepared by the method described in U.S. patent publication 2003/0224490. Monoclonal antibodies directed against a biomarker such as H3.3 can be generated, for instance, from mice immunized with the biomarker using standard procedures as referenced herein.

(50) For use in preparing an antibody, a biomarker may be purified from a biological source that endogenously comprises the biomarker, or from a biological source recombinantly-engineered to produce or over-produce the biomarker, using conventional methods known in the art. The amino acid sequence for the biomarker H3.3 is provided as SEQ ID NO:1. Exemplary nucleic acid sequences for the biomarkers described herein are readily available in public sequence databases, such as National Library of Medicine's genetic sequence database GenBank (Benson et al., 2008, Nucleic Acids Research, 36 (Database issue):D25-30).

(51) Nucleic acid encoding the monoclonal antibody obtained using the procedures described herein may be cloned and sequenced using technology which is available in the art, and is described, for example, in Wright et al. (1992, Critical Rev. Immunol. 12 (3,4):125-168) and the references cited therein.

(52) To generate a phage antibody library, a cDNA library is first obtained from mRNA which is isolated from cells, e.g., the hybridoma, which express the desired protein to be expressed on the phage surface, e.g., the desired antibody. cDNA copies of the mRNA are produced using reverse transcriptase. cDNA which specifies immunoglobulin fragments are obtained by PCR and the resulting DNA is cloned into a suitable bacteriophage vector to generate a bacteriophage DNA library comprising DNA specifying immunoglobulin genes. The procedures for making a bacteriophage library comprising heterologous DNA are well known in the art and are described, for example, in Sambrook et al. (2001, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.).

(53) Bacteriophage which encode the desired antibody may be engineered such that the protein is displayed on the surface thereof in such a manner that it is available for binding to the antigen against which the antibody is directed. Thus, when bacteriophage which express a specific antibody are incubated in the presence of the antigen, for instance, antigen immobilized on a resin or surface, the bacteriophage will bind to the antigen. Bacteriophage which do not express the antibody will not bind to the antigen. Such panning techniques are well known in the art and are described for example, in Wright et al., (supra). Processes, such as those described above, have also been developed for the production of human antibodies using M13 bacteriophage display (Burton et al., 1994, Adv. Immunol. 57:191-280).

(54) The procedures just presented describe the generation of phage which encode the Fab portion of an antibody molecule. However, phage which encode single chain antibodies (scFv/phage antibody libraries) are also useful in preparing Fab molecules useful in the invention. Fab molecules comprise the entire Ig light chain, that is, they comprise both the variable and constant region of the light chain, but include only the variable region and first constant region domain (CH1) of the heavy chain. Single chain antibody molecules comprise a single chain of protein comprising the Ig Fv fragment. An Ig Fv fragment includes only the variable regions of the heavy and light chains of the antibody, having no constant region contained therein. Phage libraries comprising scFv DNA may be generated following the procedures described in Marks et al., 1991, J. Mol. Biol. 222:581-597. Panning of phage so generated for the isolation of a desired antibody is conducted in a manner similar to that described for phage libraries comprising Fab DNA. Synthetic phage display libraries in which the heavy and light chain variable regions may be synthesized such that they include nearly all possible specificities (Barbas, 1995, Nature Medicine 1:837-839; de Kruif et al., 1995, J. Mol. Biol. 248:97-105) may also be used to prepare an antibody useful in the practice of the invention.

(55) Other methods for assessing the level of a protein include chromatography (e.g., HPLC, gas chromatography, liquid chromatography), capillary electrophoresis and mass spectrometry (e.g., MS, MS-MS). For instance, a chromatography medium comprising a cognate receptor for the biomarker, an aptamer that binds specifically to the biomarker, or a small molecule that binds specifically to the biomarker can be used to substantially isolate the biomarker from the sample of biological fluid.

(56) The level of substantially isolated protein can be quantitated directly or indirectly using a conventional technique in the art such as spectrometry, Bradford protein assay, Lowry protein assay, biuret protein assay, or bicinchoninic acid protein assay, as well as immunodetection methods.

(57) The level of an unmodified or post-translationally modified biomarker in a biological fluid sample can be normalized. For instance, the level can be normalized to another component of the fluid sample, whose level is independent of whether the patient suffers from COPD. It is well within the skill of the skilled artisan to select a suitable component for normalization. An exemplary, but non-limiting, component for normalization is the IgG light chain.

(58) Kits

(59) A kit is envisaged for practicing every method disclosed herein. The following is a description of a kit useful for diagnosing COPD comprising measuring the level of extracellular H2B, H3, H3.3 or H4 protein in a test sample of a patient and comparing the level of extracellular H2B, H3, H3.3 or H4 protein to the extracellular level of H2B, H3, H3.3 or H4 protein respectively in a control sample, wherein an elevated level of extracellular H2B, H3, H3.3 or H4 protein in the test sample of the patient as compared to the level of extracellular H2B, H3, H3.3 or H4 protein respectively in the control sample indicates that the patient suffers from COPD. The description is not intended to be limiting and should not be construed that way.

(60) Kits can comprise a detector molecule that binds to H2B, H3, H3.3 or H4. For example, the kit can comprise an antibody, an antibody derivative, or an antibody fragment that binds specifically with a biomarker protein of the invention. The kit may alternatively comprise an aptamer or small molecule that binds specifically to a biomarker of the invention. Such kits may also comprise a plurality of antibodies, antibody derivatives, or antibody fragments wherein the plurality of such antibody agents binds specifically with H2B, H3, H3.3 or H4, or a fragment of H2B, H3, H3.3 or H4.

(61) For antibody-based kits, the kit can comprise, for example: (1) a first antibody (e.g., attached to a solid support) that specifically binds to H2B, H3, H3.3 or H4; and, optionally, (2) a second, different antibody that specifically binds to either H2B, H3, H3.3 or H4 or the first antibody and is conjugated to a detectable label.

(62) The kit can further comprise components necessary for detecting the detectable label (e.g., an enzyme or a substrate). Optionally, the kit comprises at least one negative control containing H2B, H3, H3.3 or H4 at a level of about the extracellular level of H2B, H3, H3.3 or H4 which is present in a test sample of a healthy subject. Optionally, the kit also includes at least one positive control containing H2B, H3, H3.3 or H4 at a level of about the extracellular level of H2B, H3, H3.3 or H4 which is present in a test sample of a COPD patient.

(63) Furthermore, the kit can optionally include instructional material for use of the kit in the diagnosis of COPD. Such instructions may comprise instructions to: detect the presence of or assess the level of H2B, H3, H3.3 or H4.

(64) The instructional material may comprise a publication, a recording, a diagram, or any other medium of expression which can be used to communicate the usefulness of the method of the invention in the kit for diagnosis of COPD in a patient. The instructional material of the kit of the invention may, for example, be affixed to a container which contains other contents of the kit, or be shipped together with a container which contains the kit. Alternatively, the instructional material may be shipped separately from the container with the intention that the instructional material and the contents of the kit be used cooperatively by the recipient.

(65) The kit may optionally further include at least one sample container for containing a test sample obtained from the patient. Kits for practice of the invention may also comprise, e.g., buffering agents, preservatives, or protein stabilizing agents. Each component of the kit can be enclosed within an individual container and all of the various containers can be within a single package, along with instructions for interpreting the results of the assays performed using the kit.

(66) The following is a description of a kit useful for staging COPD comprising measuring the level of H2B, H3 or H4 protein in a test sample of a patient; and comparing the level of H2B, H3 or H4 protein to the level of H2B, H3 or H4 protein in a sample from a control healthy person without COPD, a GOLD 0 control, a GOLD I control, a GOLD II control, a GOLD III control or a GOLD IV control, determining which control has the most similar level of H2B, H3 or H4 protein to that of the patient, and assigning to the patient the stage of the control with the most similar level of H2B, H3 or H4 protein to that of the patient. The description is not intended to be limiting and should not be construed that way.

(67) Kits can comprise a detector molecule that binds to H2B, H3 or H4. For example, the kit can comprise an antibody, an antibody derivative, or an antibody fragment that binds specifically with a biomarker protein of the invention. The kit may alternatively comprise an aptamer or small molecule that binds specifically to a biomarker of the invention. Such kits may also comprise a plurality of antibodies, antibody derivatives, or antibody fragments wherein the plurality of such antibody agents binds specifically with H2B, H3 or H4, or a fragment of H2B, H3 or H4.

(68) For antibody-based kits, the kit can comprise, for example: (1) a first antibody (e.g., attached to a solid support) that specifically binds to H2B, H3 or H4; and, optionally, (2) a second, different antibody that specifically binds to either H2B, H3 or H4 or the first antibody and is conjugated to a detectable label.

(69) The kit can further comprise components necessary for detecting the detectable label (e.g., an enzyme or a substrate). Optionally, the kit comprises at least one negative control containing H2B, H3 or H4 at a level of about the extracellular level of H2B, H3 or H4 which is present in a biological sample or in a biological fluid sample of a healthy subject, a GOLD 0 control, a GOLD I control, a GOLD II control, a GOLD III control or a GOLD IV control.

(70) Furthermore, the kit can optionally include instructional material for use of the kit in the assessment of COPD staging. Such instructions may comprise instructions to: detect the presence of or assess the level of H2B, H3 or H4.

(71) The instructional material may comprise a publication, a recording, a diagram, or any other medium of expression which can be used to communicate the usefulness of the method of the invention in the kit for staging of COPD in a patient, as described above.

(72) The kit may optionally further include other elements such as containers and buffers, as described above.

(73) The following is a description of a kit useful for diagnosing COPD comprising detecting the level of an H3.3 protein with at least one post-translational modification from a biological sample of a patient, comparing the level of an H3.3 protein with at least one post-translational modification to the level of an H3.3 protein with at least one post-translational modification from a biological sample of a healthy control, wherein an elevated number of post-translational modifications of H3.3 in the patient as compared to the healthy control indicates that the patient suffers from COPD. The description is not intended to be limiting and should not be construed that way.

(74) Kits can comprise a detector molecule that binds to an H3.3 protein with at least one post-translational modification. For example, the kit can comprise an antibody, an antibody derivative, or an antibody fragment that binds specifically with a biomarker protein of the invention. The kit may alternatively comprise an aptamer or small molecule that binds specifically to a biomarker of the invention. Such kits may also comprise a plurality of antibodies, antibody derivatives, or antibody fragments wherein the plurality of such antibody agents bind specifically with an H3.3 protein with at least one post-translational modification, or a fragment of an H3.3 protein with at least one post-translational modification.

(75) For antibody-based kits, the kit can comprise, for example: (1) a first antibody (e.g., attached to a solid support) that specifically binds to an H3.3 protein with at least one post-translational modification; and, optionally, (2) a second, different antibody that binds to either an H3.3 protein with at least one post-translational modification or the first antibody and is conjugated to a detectable label.

(76) The kit can further comprise components necessary for detecting the detectable label (e.g., an enzyme or a substrate). Optionally, the kit comprises at least one negative control containing H3.3 protein at a level of about the extracellular level of an H3.3 protein with at least one post-translational modification which is present in a biological sample or in a biological fluid sample of a healthy subject. Optionally, the kit also includes at least one positive control containing an H3.3 protein with at least one post-translational modification at a level of about the extracellular level of an H3.3 protein with at least one post-translational modification which is present in a biological sample or in a biological fluid sample of a COPD patient.

(77) Furthermore, the kit can optionally include instructional material for use of the kit in the diagnosis of COPD. Such instructions may comprise instructions to: detect the presence of or assess the level of an H3.3 protein with at least one post-translational modification.

(78) The instructional material may comprise a publication, a recording, a diagram, or any other medium of expression which can be used to communicate the usefulness of the method of the invention in the kit for diagnosis of COPD in a patient based on the level of an H3.3 protein with at least one post-translational modification, as described above.

(79) The kit may optionally further include other elements such as containers and buffers, as described above.

(80) The following is a description of a kit useful for diagnosing COPD by a method comprising detecting at least one post-translational modification of an H3.3 protein from a biological sample of a patient at position 10, 15, 28, 38, 43, 80, 107, 111, 116, or 121 of SEQ ID NO:1, wherein the presence of at least one said post-translational modification indicates that the patient suffers from COPD. In a preferred embodiment, the kit is useful for diagnosing COPD by a method comprising detecting at least one post-translational modification of an H3.3 protein from a biological sample of a patient at position 10, 15, 28, 38, 43, 80, 107 or 116 of SEQ ID NO:1. The description is not intended to be limiting and should not be construed that way.

(81) Kits can comprise a detector molecule that binds to post-translationally modified H3.3. For example, the kit can comprise an antibody, an antibody derivative, or an antibody fragment that binds specifically with a biomarker protein of the invention. The kit may alternatively comprise an aptamer or small molecule that binds specifically to a biomarker of the invention. Such kits may also comprise a plurality of antibodies, antibody derivatives, or antibody fragments wherein the plurality of such antibody agents binds specifically with post-translationally modified H3.3, or a fragment of post-translationally modified H3.3.

(82) For antibody-based kits, the kit can comprise, for example: (1) a first antibody (e.g., attached to a solid support) that specifically binds to post-translationally modified H3.3; and, optionally, (2) a second, different antibody that specifically binds to either post-translationally modified H3.3 or the first antibody and is conjugated to a detectable label.

(83) The kit can further comprise components necessary for detecting the detectable label (e.g., an enzyme or a substrate). Optionally, the kit includes at least one positive control containing post-translationally modified H3.3.

(84) Furthermore, the kit can optionally include instructional material for use of the kit in the diagnosis of COPD. Such instructions may comprise instructions to: detect the presence of or assess the level of post-translationally modified H3.3.

(85) The instructional material may comprise a publication, a recording, a diagram, or any other medium of expression which can be used to communicate the usefulness of the method of the invention in the kit for diagnosis of COPD in a patient, as described above.

(86) The kit may optionally further include other elements such as containers and buffers, as described above.

(87) Methods of Treatment for COPD

(88) Provided is a method of treating COPD by administering to a patient suffering from COPD an agent that degrades H3.3 or targets H3.3 for degradation or inhibits the function of H3.3 or prevents the toxicity caused by H3.3. In some embodiments, the agent is DNase I, activated protein C or antibody to H3.3. Methods for administration and the appropriate dosages and pharmaceutical compositions of the agent that degrades H3.3 or targets H3.3 for degradation or inhibits the function of H3.3 or prevents the toxicity caused by H3.3 will be known to a person skilled in the art. A method for administrating the agent can be any method usable in this field of technology, including aerosol delivery, intra-arterial injection, dripping, intravenous injection, intramuscular injection, subcutaneous injection, intradermal injection, oral administration, mucosal administration, and transdermal administration.

(89) Detection of Anti-Histone Antibodies.

(90) Provided is a method for diagnosing COPD comprising determining the levels of anti-H2B, anti-H3, anti-H3.3 or anti-H4 antibodies in a patient, determining the levels of anti-H2B, anti-H3, anti-H3.3 or anti-H4 antibodies in a control, and comparing the level of anti-H2B, anti-H3, anti-H3.3 or anti-H4 antibodies to the level of anti-H2B, anti-H3, anti-H3.3 or anti-H4 antibodies respectively in an ex-smoker control, wherein an elevated level of anti-H2B, anti-H3, anti-H3.3 or anti-H4 antibodies in the patient as compared to the level of anti-H2B, anti-H3, anti-H3.3 or anti-H4 antibodies in the control indicates that the patient suffers from COPD. In preferred embodiments, the anti-H3.3 antibodies specifically recognize post-translationally modified H3.3, wherein the post-translational modifications are characteristic of COPD. In some embodiments, the control is from an ex-smoker who may be at risk of, but does not have COPD, such as a GOLD 0.

(91) In order to perform the immunological assay, the histone peptides that said anti-histone antibodies specifically bind to can be adsorbed or covalently linked or modified with a carrier to bind them to a solid support (e.g. chips, microspheres, gold, polystyrene, reactor vessel or wells, microtiter plate). In a first step of the assay method, the sample of biological fluid to be analyzed is placed in contact and incubated with the preferred histone peptide linked on the solid support. Any anti-histone antibodies that are possibly present in the sample are thus specifically bound to the preferred peptide, producing an antigen/antibody complex. The anti-histone antibodies to be detected in the immunoassay may be IgG immunoglobulins, or any other class of immunoglobulins. The evaluation of the presence and the quantization of the antigen/antibody complex can be performed with a spectroscopic, a piezoelectric or an electrochemical biosensor.

(92) In a preferred embodiment, the above described method is an ELISA immunoassay in which an indicator antibody, such as an anti-human IgG, is conjugated to an enzyme and is added to measure the antibody titer by spectroscopy.

EXAMPLES

Example 1. Elevation of Core Histone Proteins in COPD

(93) Overview

(94) Gene expression is regulated epigenetically by a variety of nuclear proteins, including histones and transcription factors. Accordingly, we characterized protein expression levels in pooled samples of a nuclear-enriched cell fraction using label-free, gel electrophoresis mass spectroscopy.

(95) Clinical Study Material

(96) Lungs were obtained by the region's transplant network, Gift of Life Inc under a protocol approved by the Temple University Institutional Review Board from five ex-smokers (GOLD 0), and five ex-smokers with severe COPD (GOLD 4) (Table 2A). Mean age, smoking history and time from smoking cessation were similar in COPD subjects and controls (Table 2B).

(97) TABLE-US-00008 TABLE 2A Discovery Group GOLD Subj # Gender Age Pk-Yrs Stp-Yrs FEV1% FEV1.FVC % DLCO/VA % 0 291090 F 23 NA NA 104 90 NA 0 119716 M 59 58 15 70 80 NA 0 298520 F 69 NA NA 97 70 99 0 41 F 75 30 16 112 80 64 0 59 M 49 30 4 85 72 75 IV 192361 F 50 70 2 12 20 NA IV 132625 F 63 120 10 23 30 17 IV 174 M 48 60 4 47 49 75 IV 8 F 59 42 6 16 42 63 IV 33 M 56 35 7 16 24 39

(98) TABLE-US-00009 TABLE 2B Subject Demographics Discovery Group (n = 10): Subject Demographics Quit Subject Time GOLD # Gender Race Age PkYrs (Mo) FEV1% FEV1/FVC% GOLD 0 5 3F/2M 2AA/3C 59 (13.3) 38.6 (11.6) 10.6 (4.8) 93.6 (16.5) 78.4 (7.9) GOLD IV 5 3F/2M 2AA/3C 55.2 (6.2) 65.4 (33.5) 5.8 (3.0) 22.8 (14.1) 33 (12.2) Quit Time Age PkYrs (Mo) FEV1% Subject Gender Race Mean Mean Mean Mean FEV1/FVC% Group # F/M AA/H/C (SD) (SD) (SD) (SD) Mean (SD) NS 14 6F/8M 2AA/12C 45.4 (16.7) 0 N/A N/A N/A S 9 3F/6M 2AA/7C 40.1 (14.3) 14.4 (11.3) 0 N/A N/A GOLD 0 11 4F/7M 1AA/10C 63.4 (7.7) 54.4 (36.3) 81.9 (165.5) 81.9 (11.8) 81.8 (5.7) GOLD I-III 14 6F/8M 3AA/11C 67.7 (6.2) 53.6 (29.2) 92.4 (135.4) 64.1 (19.1) 51.5 (15.4) GOLD IV 24 12F/12M 5AA/19C 57.5 (5.9) 49.7 (25.3) 86.8 (65.6) 20.1 (4.8) 31.8 (9.8) IPF/PPH/Sar 9 5F/4M 3AA/6C 55.4 (8.5) 15.5 (19.6) .sup.88 (103.9) 51.2 (13.7) 75.6 (10.7)

(99) All lungs were obtained from beating heart donors, immediately placed in sterile, ice-cold preservation medium (Hall et al. 1994), and shipped to a laboratory on ice within 12 hours of collection. Radiologically and macroscopically normal appearing regions were selected for this study. The region selected, usually an entire lobe, was slowly inflated using a cannula inserted into the supplying airway to instill a 1:1 mix of cryo-embedding medium (Cryomatrix, Thermo Electron Corp.) and 50% sucrose in distilled water.

(100) Portions of the inflated organ were then frozen by suspension in liquid nitrogen fumes for 20-25 minutes, as previously described (Gonzalez et al. 1996), then stored at 80 C. until used. Samples of frozen tissues were cut into 0.111 cm blocks and embedded in OCT (Tissue Tek). Sample sections (6 m) were cut from each block using a cryostat at 20 C. then stained with hematoxylin and eosin for inspection. Since whole lung tissue is comprised of at least 6 major cell types, considerable effort was made to obtain approximately equal amounts of lung parenchyma, small airways and pulmonary vessels. In this regard, the amount (1 cm.sup.3) and location (peripheral tissue extending to include the pleural surface) of the sample were standardized.

(101) Subject Groups:

(102) Study Population

(103) Lung tissue, bronchoalveolar lavage fluid (BALF) and plasma samples were obtained from 15 subjects with GOLD stage 4 COPD and 15 subjects without COPD, i.e., GOLD 0, normal non-smokers and normal active smokers.

(104) Demographics, smoking history, co-morbidities and cause of death are shown in Table 2B. Ex-smokers with severe COPD had higher heavy smoke exposure than ex-smokers (6533 SE pack years, range 35-120 yrs, and 3916 SE pack years, range 30-58 yrs, for ex-smokers with severe COPD and ex-smokers, respectively). The ex-smokers had normal lung function as indicated by FV1.FVC % of 70. In contrast, the ex-smokers with severe COPD had impaired lung function FV1.FVC % of 49.

(105) The two groups appeared evenly matched in terms of age and gender. All were Caucasians except for one African American in the smoker group. Subjects in all 2 groups had co-morbidities, but these appeared to be similar.

(106) Nuclear Protein Fractionation:

(107) In order to reduce red blood cell contamination of samples, the frozen lung tissue was dipped twice in 1.5 ml centrifuge tubes containing 1PBS. Cytosolic and nuclear proteins were extracted from the tissue using a hypotonic lysis buffer consisting of 0.1PBS, 0.1% Triton X-100 and 1 protease inhibitor (Pierce Halt PI cocktail 100). After incubation on ice for 10 min to allow cells to swell, the sample was homogenized for 2 min. Centrifugation at 10,000 g for 15 min separated the cytosolic fraction (supernatant) from the nuclei-enriched fraction (pellet). The cytosolic fraction was stored at 80 C. The nuclear fraction was washed twice with the hypotonic lysis buffer using the same centrifugation protocol then nuclear proteins were extracted from the nuclei by a lysis buffer (1PBS pH 7.9, SDS 1%, EDTA 5 mM, 50 mM DTT, and 1 protease inhibitor cocktail) through 2 min of sonication (20 sec on 20 sec off) at 4 C., centrifuged at 16,000 g for 10 min. The final supernatant (nuclear extract) was collected for storage at 80 C. The specificity of this subcellular fraction method was supported by protein identification results and analysis of distribution of proteins (FIG. 6B).

(108) In-Gel Trypsin Digestion:

(109) Samples containing a total of 30 g of nuclear proteins were diluted with Laemmli sample buffer (BioRad) containing 5% -mercaptoethanol. The mixture was heated for 5 min at 95 C. and loaded onto 10-14% polyacrylamide gel. One dimension SDS PAGE separation was performed using a mini Protean II system (BiorRad) at 200 V for 45 min. Bands were visualized with SimplyBlue SafeStain and lanes were sliced into 15 sections which were diced into 24 mm. Proteins in gel pieces were reduced by 30 min incubation at 37 C. with 50 mM ammonium bicarbonate buffer containing 10 mM DTT. Proteins in the gel were alkylated by 30 min incubation in the dark at RT with 50 mM ammonium bicarbonate buffer containing 50 mM iodoacetamide. After destaining with 50% (v/v) acetonitrile in 50 mM bicarbonate and dehydration with pure acetonitrile, the gel pieces were covered with approximately 40 l 12.5 g/l trypsin in 50 mM ammonium bicarbonate buffer. Incubation for digestion, peptide extraction, and sample cleanup and desalting using Ziptips were as previously described.

(110) GeLC-MS:

(111) Peptides were dried in a vacuum centrifuge then resolubilized in 30 l of 0.1% (vol/vol) trifluoroacetic acid/H.sub.2O. Peptide samples were loaded onto 2 g capacity peptide traps (CapTrap; Michrom Bioresources) and separated using a C18 capillary column (15 cm 75 m, Agilent) with an Agilent 1100 LC pump delivering mobile phase at 300 nl/min. Gradient elution using mobile phases A (1% acetonitrile/0.1% formic acid, balance H.sub.2O) and B (80% acetonitrile/0.1% formic acid, balance H.sub.2O) was as follows (percentages for B, balance A): linear from 0 to 15% at 10 min, linear to 60% at 60 min, linear to 100% at 65 min. The nanoelectrospray ionization (nanoESI) tandem MS was performed using a HCT Ultra ion trap mass spectrometer (Bruker). ESI was delivered using distal-coating spray Silica tip (ID 20 M, tip inner ID 10 M, New Objective) at a spray voltage of 1300 V. Using an automatic switching between MS and MS/MS modes, MS/MS fragmentation was performed on the two most abundant ions on each spectrum using collision-induced dissociation with active exclusion (excluded after two spectra, and released after 2 min). The complete system was fully controlled by HyStar 3.1 software.

(112) Data Analysis:

(113) Mass spectra processing was performed using Bruker Daltonics esquire 6.1 DataAnalysis (Version 3.4). The generated de-isotoped peak list was submitted to an in-house Mascot server 2.2 for searching against the Swiss-Prot database (version 56.6 of 16 Dec. 2008, 405506 sequences). Mascot search parameters were set as follows: species, Homo sapiens (20413 sequences); enzyme, trypsin with maximal 1 missed cleavage; fixed modification, cysteine carboxymethylation; variable modification, methionine oxidation; 0.45 Da mass tolerance for precursor peptide ions; and 0.6 Da for MS/MS fragment ions. All peptides matches were filtered using an ion score cutoff of 10.

(114) Labeled Free Quantitation:

(115) Statistical validation of Mascot results were performed using the ProteinProphet tool of Trans-Proteomic Pipeline (TPP) software. As a result, probability values were generated for protein identification based on MS/MS data. Those proteins with ProteinProphet probabilities >0.90 were subjected to labeled free quantitation analysis using Absolute Protein Expression (APEX) tool. Differentially expressed proteins were analyzed by functional annotation clustering using the Database for Annotation, Visualization and Integrated Discovery (DAVID) v6.7.

(116) Western Blot Analysis:

(117) Protein samples (20 g) were separated by 10-14% gradient SDS-PAGE then transferred to a nitrocellulose membrane in a semi-dry blotting chamber (Biorad) at 10 V for 3 hours. The membrane was blocked with 5% powdered milk in phosphate-buffer saline solution (pH 7.4) containing 0.05% Tween-20 (TBS/T) then probed with antibodies that had been diluted 1:1000 for primary antibodies (anti-H2B and anti-H3, anti-lamin A/C and anti--actin, all mouse monoclonal) and 1:10.000 for secondary antibody (HRP-conjugated goat anti-mouse). Membranes were incubated with primary antibodies overnight at 4 C., washed, and then incubated with HRP-conjugated goat anti-mouse at room temperature for 1 hour. A Western Lightening Chemiluminescence Plus kit (Pelkin Elkins) for HRP was used according to the manufacturer's instruction and signals were captured onto X-ray film.

(118) Results Mass Spectroscopy:

(119) Mass spectroscopy analysis of the pooled nuclear fractions from the ex-smokers with severe COPD (i.e., GOLD 4 category; n=5) and ex-smokers who served as controls (i.e., GOLD 0; n=5) identified 17 differentially expressed proteins in severe COPD compared to controls (Table 4, GO-GIV section). Of considerable interest, H3 was up-regulated 8 fold in COPD compared to controls (p=3.3410.sup.5) In addition, H2B and H4 were up-regulated approximately 2 fold. In fact, increased expression of the core histones was apparent on the 1D gel of the pooled lung samples (FIG. 6A).

(120) TABLE-US-00010 TABLE3 H3.3modificationsinCOPD G0 Intensity Mr(expt) Mr(calc) Score Peptide SEQIDNO: 1 172617 1027.34 1027.61 40 R.KQLATKacAAR.K 8 2 2049354 3450.34 3450.71 102 R.FQSAAIGALQEASEAYLVGLFEDTNLCcaAIHAKme.R 9 3 786579 1069.84 1069.62 65 R.KacQLATKacAAR.K 10 4 13203808 1348.80 1348.70 (28) R.EIAQDFKTDmeLR.F 11 5 6255877 1391.78 1391.69 (29) R.EIAQdeDmeFKacTDLR.F 12 6 3792373 1448.75 1448.73 49 R.EIAQDFKglTDLR.F 13 7 5679177 3439.24 3438.65 35 R.FQdeSAAIGALQdeEASEAYLVGLFEmeDTNdeLCAIHAKac.R 14 GIV Intensity Mr(expt) Mr(calc) Score Peptide SEQIDNO: 1 704419 1504.37 1504.88 45 R.KdiSAPSTGGVKKdiPHR.Y 15 2 1158315 1348.25 1348.70 43 R.EIAQDFKmeTDLR.F 16 3 12160767 3449.52 3450.71 86 R.FQSAAIGALQEASEAYLVGLFEmeDmeTNLCniAIHA 17 trimethylationoflysineatposition80;.R 4 432467 984.29 984.54 57 R.KacSTGGKacAPR.K 18 5 1477098 1027.34 1027.61 53 R.KQLATKacAAR.K 19 6 1419091 1069.29 1069.62 (44) R.KacQLATKacAAR.K 20 7 10169535 3435.41 3435.70 112 R.FQSAAIGALQEASEAYLVGLFEDTNLCAIHAKacme.R 21 8 22322976 3449.44 3449.72 (82) R.FQSAAIGALQEASEAYLVGLFEmeDTNLCAIHAKacme.R 22 9 2435156 859.34 859.49 38 K.RVTIMoxPK.D 23 10 297772 958.39 958.54 52 R.KdiSAPSTGGVK.K 24 11 3759162 1348.26 1348.70 28 R.EIAQDFKmeTDLR.F 25 12 6308548 1059.78 1059.62 49 R.YRdiPGTVALR.E 26 13 808426 1069.91 1069.62 65 R.KacQLATKacAAR.K 27 14 4964585 1448.80 1448.73 52 R.EIAQDFKglTDLR.F 28 15 7104697 3438.33 3437.67 43 R.FQSAAIGALQdeEASEAYLVGLFEmeDTNdeLCAIHAKac.R 29 16 15146324 1348.82 1348.70 47 R.EIAQDFKmeTDLR.F 30 17 6238915 1391.82 1390.75 (33) R.EIAQDFKtrTDmeLR.F 31 Tryptic peptides are shown. The tryptic peptide sequence is shown between the periods, which indicate the trypsin cleavage sites. The amino acid residues immediately flanking the tryptic peptide in the H3.3 sequence are shown. KEY: Oxidation M: Mox Acetyl K: Kac Methyl D: Dme Dimethyl K: Kdi Methyl E: Eme Trimethyl K: Ktr Methyl K: Kme GlyGlyK: Kgl (Diglycine is left at sites of ubiquitinylation after trypsin digestion.) Methyl (C-term): me Carbamidomethyl C: Cca Nitrosyl C: Cni Deamidated N: Nde Dimethyl R: Rdi Deamidated Q: Qde

(121) TABLE-US-00011 TABLE 4 Differential expression of Lung Nuclear Proteins in Chronic Obstructive Pulmonary Disease Protein Differ- Probability Percent Tot Num APEX ential (x) Coverage Peps APEX Score (y) Fold Expres- ACC Gene Name GO GIV GO GIV GO GIV GO GIV (z) sion Description GO- P00367 DHE3_HUMAN 1 1 7.5 22.2 6 13 0.0095 0.0266 2.8 Up Glutamate dehydrogenase GIV 1, mitochondrial P02671-1 FIBA_HUMAN 0.99 1 2.5 8.5 3 8 0.0068 0.0234 3.5 Up Isoform 1 of Fibrinogen alpha chain P02679-1 FIBG_HUMAN 1 1 11 20.4 7 17 0.0189 0.0592 3.1 Up Isoform Gamma-B of Fibrinogen gamma chain P05023-1 AT1A_HUMAN 0.99 1 1.9 7.1 3 9 0.0045 0.0175 3.9 Up Isoform Long of Sodium/potassium- transporting ATPase subunit alpha-1 P05164-1 PERM_HUMAN 1 1 8.5 16.5 5 14 0.0070 0.0253 3.6 Up Isoform H17 of Myeloperoxidase P05362 ICAM1_HUMAN 0.99 1 4.5 16.2 2 8 0.0049 0.0257 5.2 Up Intercellular adhesion molecule 1 P08670 VIME_HUMAN 1 1 58.6 54.5 212 115 0.1631 0.1140 1.4 Down Vimentin P12111-1 CO6A3_HUMAN 1 1 8.7 4.6 61 19 0.0291 0.0117 2.5 Down Isoform 1 of Collagen alpha-3(VI) chain P21980-1 TGM2_HUMAN 1 1 7.3 12.1 7 13 0.142 0.0339 2.4 Up Isoform 1 of Protein- glutamine gamma- glutamyltransferase 2 P26038 MOES_HUMAN 1 1 20.5 22.2 9 19 0.0110 0.0298 2.7 Up Moesin P35579-1 MYH9_HUMAN 1 1 18.1 23.4 55 66 0.0219 0.0338 1.5 Up Isoform 1 of Myosin-9 P35580-1 MYH10_HUMAN 1 1 8.2 10.8 18 25 0.0097 0.0174 1.8 Up Isoform 1 of Myosin-10 P57053 H2BFS_HUMAN 1 1 41.3 29.4 21 31 0.0918 0.1745 1.9 Up Histone H2B type FS P62805 H4_HUMAN 1 1 58.3 58.3 23 33 0.0821 0.1518 1.8 Up Histone H4 P68431 H31_HUMAN 1.00 1 18.7 31.9 3 19 0.0136 0.1108 8.2 Up Histone H3.1 Q9NZN4 EHD2_HUMAN 1 1 32.4 12 22 6 0.0285 0.0100 2.8 Down EH domain-containing protein 2 Q9Y490 TLN1_HUMAN 1 1.00 4.7 0.9 13 2 0.0085 0.0017 5.1 Down Talin-1 GO P68371 TBB2C_HUMAN 1 27.6 23 Tubulin beta-2C chain Only Q9BQE3 TBA1C_HUMAN 1 20.9 10 Tubulin alpha-1C chain P08123 CO1A2_HUMAN 1 2.4 8 Collagen alpha-2(I) chain P13747 HLAE_HUMAN 1 12 5 HLA class 1 histocompatability antigen, alpha chain E Q00610-1 CLH1_HUMAN 1 2.9 5 Isoform 1 of Clathrin heavy chain 1 P02743 SAMP_HUMAN 1 20.2 4 Serum amyloid P- component P10909 CLUS_HUMAN 1 8.9 4 Clusterin P35232 PHB_HUMAN 1 10.7 4 Prohibitin P55083 MFAP4_HUMAN 0.96 7.5 4 Microfibril-associated glycoprotein 4 Q14344 GNA13_HUMAN 1 8 4 Guanine nucleotide-binding protein subunit apha-13 Q6DN03 H2BC_HUMAN 0.90 15.2 4 Putative histone H2B type 2-C O00264 PGRC1_HUMAN 1 14 3 Membrane-associated progesterone receptor component 1 O60504- VINEX_HUMAN 1 10 3 Isoform Alpha of Vinexin 1 O94833- BPAEA_HUMAN 0.94 0.3 3 Isoform 6 of Bullous 2 pemphigoid antigen 1, isoforms 6/9/10 P04275 VWF_HUMAN 0.99 1.1 3 von Willebrand factor P18077 RL35A_HUMAN 0.94 8.2 3 60S ribosomal protein L35a P21291 CSRP1_HUMAN 1.00 15.7 3 Cysteine and glycine-rich protein 1 P51991-1 ROA3_HUMAN 1 7.1 3 Isoform 1 of Heterogeneous nuclear ribonucleoprotein A3 Q13185 CBX3_HUMAN 1 13.7 3 Chromobox protein homolog 3 Q9NYL9 TMOD3_HUMAN 1 6 3 Tropomodulin-3 Q9Y624 JAM1_HUMAN 1 17.7 3 Junctional adhesion molecule A GIV P30483 1B45_HUMAN 1 18.2 9 HLA class 1 Only histocompatibility antigen, B-45 alpha chain Q71U36 TBA1A_HUMAN 1 10 7 Tubulin alpha-1A chain P63244 GBLP_HUMAN 1 25.3 5 Guanine nucleotide-binding protein subunit beta-2-like 1 P01877 IGHA2_HUMAN 1.00 5.6 4 Ig alpha-2 chain C region P09493-1 TPM1_HUMAN 1 20.6 4 Isoform 1 of Tropomyosin alpha-1 chain P00167-1 CYB5_HUMAN 1 43.9 3 Isoform 1 of Cytochrome b5 P02730 B3AT_HUMAN 1 5 3 Band 3 anion transport protein P04217 A1BG_HUMAN 1 6.3 3 Alpha-1B-glycoprotein P05109 S10A8_HUMAN 1 28 3 Protein S100-AB P06702 S10A9_HUMAN 1 24.6 3 Protein S100-A9 P10809 CH60_HUMAN 1 8 3 60 kDa heat shock protein, mitochondrial P20160 CAP7_HUMAN 1 11.2 3 Azurocidin P35221-1 CTNA1_HUMAN 0.92 1.3 3 Isoform 1 of Catenin alpha- 1 P45880-1 VDAC2_HUMAN 0.91 4.2 3 Isoform 1 of Voltage- dependent anion-selective channel protein 2 P55072 TERA_HUMAN 1.00 3.6 3 Transitional endoplasmic reticulum ATPase P62158 CALM_HUMAN 1 20.8 3 Calmodulin Q13011 ECH1_HUMAN 1.00 11.3 3 Delta(3,5)-Delta(2,4)- dienoyl-CoA isomerase, mitochondrial Q14108 SCRB2_HUMAN 0.97 5.1 3 Lysosome membrane protein 2 Q14643-1 ITPR1_HUMAN 0.96 0.6 3 Isoform 1 of Inositol 1,4,5- trisphosphate receptor type 1 Q16777 H2A2C_HUMAN 1.00 34.9 3 Histone H2A type 2-C Q5SSJ5-1 HP1B3_HUMAN 1.00 11.9 3 Isoform 1 of Heterochromatin protein 1- binding protein 3 (X): Error rate <= 0.005 (y): False Positive Rate <= 0.0374 (z): Significant change in expression level p <= 0.05
Results Western Blotting:

(122) To determine histone expression in the nuclear fractions from individual subjects used to form the pooled samples, Western blotting was performed. Whole lung lysates were obtained from the five individual COPD subjects and five of the ex-smoking subjects comprising the pooled sample. Both H2B and H3 levels were greater in all five COPD subjects compared to the control groups (FIG. 1A; p<0.02).

Example 2. H3 is Elevated in COPD

(123) In order to extend these findings to a larger study group (validation group), to determine the effect on early stages of COPD, i.e., GOLD 1, 2 and 3, and to determine the specificity for COPD, an ELISA was developed to evaluate H3 levels. Subject demographics of the validation group are shown in Table 2B. FIG. 1B presents a comparison of H3 levels in GOLD 4 (n=24) and GOLD 1, 2 and 3 (n=12) to control groups consisting of non-smokers (never smoked) (n=14), Gold 0 (ex-smokers) (n=11), smokers (n=9), and patients with other lung inflammatory diseases, i.e., sarcoidosis (n=3), idiopathic pulmonary fibrosis (n=3) and pulmonary hypertension (n=3). The mean H3 levels were elevated in GOLD 4 (10 ng/g protein) as compared to ex-smokers (5 ng/g protein), smokers (3 ng/g protein), healthy never smokers and other lung inflammatory diseases (5 ng/g protein). The fact that H3 expression was greater in ex-smokers with COPD than active smokers without COPD indicates that results are not explainable by an effect of smoking per se.

Example 3. Post-Translational Modifications of Core Histones in COPD

(124) Mass spectroscopy post-translational analysis of the pooled samples described above was performed.

(125) Post-Translational Modifications Identification:

(126) Modification occurrences were analyzed specifically for histone proteins using the same program and database as described above for data analysis except for some search parameters: maximal 3 missed cleavage, with variable modification: Acetyl (K), Acetyl (Protein N-term), Carbamidomethyl (C), Methyl (C-term), Methyl (DEK), Dimethyl (RK), Trimethyl (K), Nitrosylation (C), Oxidation (M), Phospho (ST), Phospho (Y), Ubiquitinylation (K); 0.60 Da mass tolerance for precursor peptide ions; and 0.9 Da for MS/MS fragment ions.

(127) Results:

(128) Several unique modifications were identified in severe COPD compared to control ex-smokers (Table 3 and FIG. 2A). H3.3 demonstrated extensive lysine acetylation and methylation in both the amino and carboxy terminal regions in severe COPD but not controls. In COPD, lysines (K) were acetylated at K10, K15, K19, K24, K80, and K116; di-methylated at K28 and K38; and mono-methylated at K80 and K116. In addition, arginine (R) dimethylation (R43), three asparate (D) and glutamate (E) methylations (D82, E106, D107), methionine oxidation (M121), and cysteine nitrosylation (C111) were identified.

(129) H3.3 peptide containing K24Ac (H3.3Kac24; aa 19-27 of SEQ ID No. 1; SEQ ID No. 32) was identified using doubly charged precursor ion (m/z=441.60) (FIG. 2B). The presence of H3.3Kac24 was confirmed by Western blotting, and was shown to be up-regulated in COPD as compared to the control (FIG. 2C). H3.3 was also shown to be up-regulated in COPD as compared to the control. Lamin A/C was used as an internal control.

Example 4. Presence of Extracellular Histones in the Airway in COPD

(130) Extra-cellular histones exert biological effects. Accordingly, the presence of extra-cellular H3 in the lung was assessed by immunohistochemistry using the anti-H3 antibody used for Western blotting, above.

(131) Immunohistochemestry of H2B and H3 in Lungs of COPD Patients:

(132) Randomly selected tissue blocks were taken from the subpleural parenchyma (avoiding areas affected by tumor in patients who underwent lung resection for nodules) of four very severe COPD and four controls ex-smokers (GOLD 0). Samples were fixed in formalin, embedded in paraffin wax, and processed for immunohistochemical analysis of H2B with a monoclonal antibody at 1 ug per ml.

(133) Results:

(134) The results of the immunohistochemical analysis of extra-cellular H3 appear in FIG. 3. All cell nuclei demonstrated H3 immunoreactivity. Of interest, H3 staining was also present in mucus plugs in the airway lumen as well as in cell debris attached to the cilia of airway epithelial cells in severe COPD (n=4). In addition, monocytic cells also demonstrated cytoplasmic as well as nuclear staining for H3 in severe COPD. In contrast, H3 immunoreactivity was present in control subjects in lung cell nuclei only (n=4). These data indicate that H3 is present extra-cellularly as well as intra-cellularly in the airways and lung parenchyma of subjects with COPD.

(135) The potential source of extra-cellular histones in the lung in COPD was not determined in this study but several potential explanations are possible. While not wishing to be bound by any one theory, core histones, H2A, H2B, H3 and H4, are exposed on the cell surface very early in the process of apoptosis and subsequently found in the extranuclear space (Gabler et al., 2003). Accordingly, increases in core histone in the lung in COPD may be a result of the heightened apoptosis of lung structural and inflammatory cells (Agusti, 2005; Demedts et al., 2006). In fact, in COPD, heightened apoptosis has been demonstrated for neutrophils in expectorated sputum, and alveolar pneumocytes and pulmonary artery endothelial cells in lung tissues (Kasahara et al., 2000; Makris et al., 2009; Yokohori et al., 2004).

(136) Of interest, clearance of apoptotic cells by alveolar macrophages is impaired in COPD suggesting that retention of apoptotic material in the lung may be an additional mechanism for the increase in core histones observed in COPD. In fact, the impaired clearance of apoptotic cells by alveolar macrophages in COPD has been linked to activation of the RhoA-Rho kinase pathway (Richens et al., 2009).

Example 5. Detection of H3 in Cell-Free Bronchoalveolar Fluid in COPD

(137) Given the presence of increased amounts of H3 in the lung in COPD and the presence of extracellular H3 in advanced COPD, we sought to determine if this histone were detectable in BALF in subjects with milder COPD. Accordingly, we obtained BALF from stable COPD subjects with mild to moderate disease (GOLD 1 and 2; n=12). Normal, non-smoking subjects (n=12) served as controls.

(138) H3 in Bronchoalveolar Lavage Fluid (BALF) of COPD Patient:

(139) The presence of H3 was evaluated in the supernatant of 2 ml of BALF from 5 healthy controls and 5 COPD patients. In brief, the total BALF was centrifuged at 2000 rpms for 10 minutes at 4 degrees, the pellet of cells were frozen and the proteins of the supernatant were concentrated by acetone precipitation, the total pellet was resuspended in 50 ul of laemmli buffer in order to run a Western blot using a monoclonal antibody against H3.

Example 6. Detection of H3 in Plasma in COPD

(140) Because H3 was present in BALF, we also sought to determine if it was secreted into the systemic circulation.

(141) Histones in Plasma of COPD Patient:

(142) Immunoprecipitation against H2B and H3 was performed to determinate their presence in plasma of 5 healthy smokers and 5 COPD patients. 1 ug of each monoclonal antibody was use to interact with 60 ul of Pan mouse IgG Dynabits for 24 h at 4. The bits were washed twice and diluted in 1 ml with PBS-Tween 0.1%, 100 ul of bits were add to 500 ul of plasma from each subject of the Healthy smokers and COPD patients, after 24 h of incubation at 4 degrees the bits were washed three times (PBS-Tween 0.1%) and boiled in Laemmli buffer 5 for 5 minutes to evaluate the presence of H2B and H3 by Western blot.

(143) Results:

(144) H3 was increased in the BALF supernatant 12 COPD subjects by 6 folds as compared to normal non-smokers (FIG. 4A Bar graph). In contrast, H2B which was up-regulated to a lesser extent in the lung (i.e., 2 fold) than H3 (i.e., 8 fold) was not detected in either COPD or controls (data not shown).

(145) In fact, H3 was present 2 fold higher in the plasma of COPD subjects (n=5) compared with the normal active smokers (n=5) (FIG. 4B). H2B was not detected in the plasma of any of the subjects.

Example 7. Histones Induce Airway Epithelial Cell Apoptosis

(146) Previous studies indicate that histones in the extra-cellular milieu induce apoptosis of human pulmonary endothelial cells. We, therefore, assessed the effects of a mix of histones (i.e., H1, H2A, H2B, H3 and H4) on the viability of cultured human airway epithelial cells. Histone concentrations used to assess airway epithelial cell cytotoxicity in this study were based on blood H3 concentrations present in both experimental and clinical sepsis.

(147) HBEC Culture and Histones Cytotoxicity Assays:

(148) Primary HBEC were extracted from broncoepithelial airway of healthy patients by brush bronchoscopy. Epithelial cells were cultured in 100-mm tissue culture dishes in Bronchial Epithelial Cell Growth medium BEGM (Lonza), in 5% CO2 at 37 C. Cells were grown to 80% confluence before study. At the time of study, medium was replaced with medium containing a mix of histones purified from calf thymus (Sigma) at the concentration and time indicated for each experiment. Cell damage was determined by the incorporation on the cell surface of fluorescence Annexin V and measured by flow cytometry (BD FACSCalibur) or 96 well fluorescent reader (Victor 5.0).

(149) Results:

(150) Histones dose-dependently increased Annexin V expression assessed by flow cytometry (FIGS. 5A and 5B; p<0.01 by repeated measures ANOVA). As has been previously described in sepsis, histones also rapidly (i.e., <3 hours) increased caspase 7 translocation from ER to cytoplasm indicating activation of the caspase pathway of cell apoptosis in human airway epithelial cells (FIG. 5 C).

(151) The effects of histones on apoptosis can be reversed by blood proteins (Pemberton et al., 2010). Accordingly, we assessed the effects of a 4 fold molar excess of bovine serum albumin (BSA) on Annexin V expression at 24 hours. BSA significantly (p<0.05) inhibited histone-induced Annexin V expression but did not eliminate completely histone-induced cytotoxicity. These results with BSA are in agreement with prior studies on histone cytotoxicity in pulmonary endothelial cells (Pemberton et al., 2010; Xu et al., 2009).

(152) Apoptosis of endothelial and epithelial cells has been proposed as a mechanism in the development of COPD (Demedts et al., 2006). Apoptosis interferes with lung maintenance and repair, which is necessary to overcome the sustained injury imposed by cigarette smoke (Godtfredsen et al., 2008). Histones in the lung extra-cellular space were biologically active since they induced dose- and time-dependent caspase activation and apoptosis of human airway epithelial cells. Moreover, similar to our results, free core histones induced apoptosis of cultured human pulmonary artery endothelial cells (Xu et al., 2009). In fact, studies in another lung disease, i.e., ARDS induced by sepsis, have found core histones in the blood and these histones contribute to lung damage and death during sepsis. That is, in a mouse model of sepsis, free core histones derived from apoptotic cells and neutrophil extra-cellular traps induced neutrophil migration into the lung, endothelial cell vacuolation, intra-alveolar hemorrhage and macro-microvascular thombosis (Xu et al., 2009).

(153) The disclosures of each and every patent, patent application, and publication cited herein are hereby incorporated herein by reference in their entirety.

(154) One skilled in the art will readily appreciate that the present invention is well adapted to carry out the objects and obtain the ends and advantages mentioned, as well as those inherent therein. While the invention has been disclosed with reference to specific embodiments, it is apparent that other embodiments and variations of this invention may be devised by others skilled in the art without departing from the true spirit and scope used in the practice of the invention. The appended claims are intended to be construed to include all such embodiments and equivalent variations.

REFERENCES

(155) Agusti, A. G. (2005). COPD, a multicomponent disease: implications for management. Respir Med 99, 670-682. Barnes, P. J. (2009a). Histone deacetylase-2 and airway disease. Ther Adv Respir Dis 3, 235-243. Barnes, P. J. (2009b). Role of HDAC2 in the pathophysiology of COPD. Annual review of physiology 71, 451-464. Barnes, P. J. (2009c). Targeting the epigenome in the treatment of asthma and chronic obstructive pulmonary disease. Proc Am Thorac Soc 6, 693-696. Bhavsar, P., Ahmad, T., and Adcock, I. M. (2008). The role of histone deacetylases in asthma and allergic diseases. J Allergy Clin Immunol 121, 580-584. Demedts, I. K., Demoor, T., Bracke, K. R., Joos, G. F., and Brusselle, G. G. (2006). Role of apoptosis in the pathogenesis of COPD and pulmonary emphysema. Respir Res 7, 53. Gabler, C., Blank, N., Winkler, S., Kalden, J. R., and Lorenz, H. M. (2003). Accumulation of histones in cell lysates precedes expression of apoptosis-related phagocytosis signals in human lymphoblasts. Ann N Y Acad Sci 1010, 221-224. Godtfredsen, N. S., Lam, T. H., Hansel, T. T., Leon, M. E., Gray, N., Dresler, C., Burns, D. M., Prescott, E., and Vestbo, J. (2008). COPD-related morbidity and mortality after smoking cessation: status of the evidence. Eur Respir J 32, 844-853. Gonzalez, S., Hards, J., van Eeden, S., and Hogg, J. C. (1996). The expression of adhesion molecules in cigarette smoke-induced airways obstruction. Eur Respir J 9, 1995-2001. Hall, S. M., Komai, H., Reader, J., and Haworth, S. G. (1994). Donor lung preservation: effect of cold preservation fluids on cultured pulmonary endothelial cells. Am J Physiol 267, L508-517. Kasahara, Y., Tuder, R. M., Taraseviciene-Stewart, L., Le Cras, T. D., Abman, S., Hirth, P. K., Waltenberger, J., and Voelkel, N. F. (2000). Inhibition of VEGF receptors causes lung cell apoptosis and emphysema. J Clin Invest 106, 1311-1319. Kawasaki, H., and Iwamuro, S. (2008). Potential roles of histones in host defense as antimicrobial agents. Infect Disord Drug Targets 8, 195-205. Lamond, A. I., and Earnshaw, W. C. (1998). Structure and function in the nucleus. Science 280, 547-553. Lee, G., Walser, T. C., and Dubinett, S. M. (2009). Chronic inflammation, chronic obstructive pulmonary disease, and lung cancer. Curr Opin Pulm Med. Maclay, J. D., Rabinovich, R. A., and MacNee, W. (2009). Update in chronic obstructive pulmonary disease 2008. American journal of respiratory and critical care medicine 179, 533-541. Macnee, W. (2007). Pathogenesis of chronic obstructive pulmonary disease. Clin Chest Med 28, 479-513, v. Makris, D., Vrekoussis, T., Izoldi, M., Alexandra, K., Katerina, D., Dimitris, T., Michalis, A., Tzortzaki, E., Siafakas, N. M., and Tzanakis, N. (2009). Increased apoptosis of neutrophils in induced sputum of COPD patients. Respir Med 103, 1130-1135. Mannino, D. M., Davis, K. J., and Kiri, V. A. (2009). Chronic obstructive pulmonary disease and hospitalizations for pneumonia in a US cohort. Respir Med 103, 224-229. Papayannopoulos, V., and Zychlinsky, A. (2009). NETs: a new strategy for using old weapons. Trends Immunol 30, 513-521. Pemberton, A. D., Brown, J. K., and Inglis, N. F. (2010). Proteomic identification of interactions between histones and plasma proteins: implications for cytoprotection. Proteomics 10, 1484-1493. Postma, D. S., and Timens, W. (2006). Remodeling in asthma and chronic obstructive pulmonary disease. Proc Am Thorac Soc 3, 434-439. Rajendrasozhan, S., Yao, H., and Rahman, I. (2009). Current perspectives on role of chromatin modifications and deacetylases in lung inflammation in COPD. COPD 6, 291-297. Richens, T. R., Linderman, D. J., Horstmann, S. A., Lambert, C., Xiao, Y. Q., Keith, R. L., Boe, D. M., Morimoto, K., Bowler, R. P., Day, B. J., et al. (2009). Cigarette smoke impairs clearance of apoptotic cells through oxidant-dependent activation of RhoA. American journal of respiratory and critical care medicine 179, 1011-1021. Salazar, L. M., and Herrera, A. M. (2011). Fibrotic response of tissue remodeling in COPD. Lung 189, 101-109. Taverna, S. D., Li, H., Ruthenburg, A. J., Allis, C. D., and Patel, D. J. (2007). How chromatin-binding modules interpret histone modifications: lessons from professional pocket pickers. Nat Struct Mol Biol 14, 1025-1040. Voigt, P., and Reinberg, D. (2011). Histone tails: ideal motifs for probing epigenetics through chemical biology approaches. Chembiochem 12, 236-252. Weake, V. M., and Workman, J. L. (2010). Inducible gene expression: diverse regulatory mechanisms. Nat Rev Genet 11, 426-437. Westergren-Thorsson, G., Larsen, K., Nihlberg, K., Andersson-Sjoland, A., Hallgren, O., Marko-Varga, G., and Bjermer, L. (2010). Pathological airway remodelling in inflammation. Clin Respir J 4 Suppl 1, 1-8. Wiesner, J., and Vilcinskas, A. (2010). Antimicrobial peptides: the ancient arm of the human immune system. Virulence 1, 440-464. Wood, C., Snijders, A., Williamson, J., Reynolds, C., Baldwin, J., and Dickman, M. (2009). Post-translational modifications of the linker histone variants and their association with cell mechanisms. FEBS J 276, 3685-3697. Xu, J., Zhang, X., Pelayo, R., Monestier, M., Ammollo, C. T., Semeraro, F., Taylor, F. B., Esmon, N. L., Lupu, F., and Esmon, C. T. (2009). Extracellular histones are major mediators of death in sepsis. Nat Med 15, 1318-1321. Yokohori, N., Aoshiba, K., and Nagai, A. (2004). Increased levels of cell death and proliferation in alveolar wall cells in patients with pulmonary emphysema. Chest 125, 626-632. Yu, Y., and Waters, R. (2005). Histone acetylation, chromatin remodelling and nucleotide excision repair: hint from the study on MFA2 in Saccharomyces cerevisiae. Cell Cycle 4, 1043-1045.