Ketose 3-epimerase produced by arthrobacter globiformis
09932617 ยท 2018-04-03
Assignee
Inventors
- Ken Izumori (Kita-gun, JP)
- Pushpa Kiran Gullapalli (Itami, JP)
- Tomoya Shintani (Itami, JP)
- Ryo Kikkawa (Itami, JP)
Cpc classification
C12P19/24
CHEMISTRY; METALLURGY
C12Y503/01
CHEMISTRY; METALLURGY
C12N11/00
CHEMISTRY; METALLURGY
International classification
C12N11/00
CHEMISTRY; METALLURGY
C12P19/24
CHEMISTRY; METALLURGY
Abstract
There are provided a highly safe epimerase usable in food industry, and a method for producing a ketose. The epimerase is a ketose 3-epimerase obtainable from a microorganism of the genus Arthrobacter, and having the amino acid sequence represented by SEQ ID NO: 1 of the Sequence Listing, and (1) substrate specificity whereby a D- or L-ketose is epimerized at position 3 to produce a corresponding D- or L-ketose, and (2) the highest substrate specificity for D-fructose and D-psicose among D- and L-ketoses. The ketose 3-epimerase is also represented by SEQ ID NO: 3 or SEQ ID NO: 4 of the Sequence Listing, and epimerizes a D- or L-ketose at position 3 to produce a corresponding D- or L-ketose.
Claims
1. A recombinant expression vector comprising a DNA encoding ketose 3-epimerase having the following substrate specificities (A) and (B): (A) substrate specificity whereby a D- or L-ketose is epimerized at position 3 to produce a corresponding D- or L-ketose; and (B) the highest substrate specificity for D-fructose and D-psicose among D- and L-ketoses, wherein the DNA comprises (a) or (b) below: (a) the base sequence of SEQ ID NO: 2 or SEQ ID NO: 3, or (b) a DNA encoding the amino acid sequence of SEQ ID NO: 1.
2. The recombinant expression vector according to claim 1, wherein the ketose 3-epimerase has the following physical and chemical properties (a) to (f): (a) molecular weight, a homotetramer structure having a subunit molecular weight of 32 kDa, with a subunit molecular weight of about 32 kDa as measured by SDS-PAGE, and a molecular weight of 120 kDa as measured by gel filtration; (b) optimal pH, 6 to 11 under 30 C., 30-min reaction conditions in the presence of 20 mM magnesium (Mg.sup.2+); (c) optimal temperature, 60 to 80 C. under pH 7.5, 30-min reaction conditions in the presence of 20 mM magnesium (Mg.sup.2+); (d) pH stability, stable in at least a pH range of 5 to 11 under 4 C., 24-hour maintained conditions; (e) heat stability, stable at about 50 C. or less under pH 7.5, 1-hour maintained conditions in the presence of 4 mM magnesium ions (Mg.sup.2+), and stable at about 40 C. or less in the absence of magnesium ions (Mg.sup.2+); and (f) metal ion activation, activatable by divalent manganese ions (Mn.sup.2+), divalent cobalt ions (Co.sup.2+), and calcium (Ca.sup.2+) and magnesium ions (Mg.sup.2+).
3. The recombinant expression vector according to claim 1, wherein the ketose 3-epimerase has the following substrate specificities 1 to 8: 1. 43.8% relative activity for a D-fructose substrate; 2. 100% activity for a D-psicose substrate; 3. 1.13% relative activity for a D-sorbose substrate; 4. 18.3% relative activity for a D-tagatose substrate; 5. 0.97% relative activity for an L-fructose substrate; 6. 21.2% relative activity for an L-psicose substrate; 7. 16.6% relative activity for an L-sorbose substrate; and 8. 44.0% relative activity for an L-tagatose substrate, the relative activity for each ketose being an activity relative to the epimerization activity for D-psicose which is taken as 100.
4. A transformant comprising the recombinant expression vector according to claim 1.
5. A transformant comprising the recombinant expression vector according to claim 2.
6. A transformant comprising the recombinant expression vector according to claim 3.
7. A method of producing ketose 3-epimerase, comprising a step of culturing the transformant according to claim 4, wherein the transformant produces the ketose 3-epimerase in a culture thereof.
8. The method according to claim 7, wherein the ketose 3-epimerase is collected from the culture of the transformant.
Description
BRIEF DESCRIPTION OF DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
DESCRIPTION OF EMBODIMENTS
(19) The present invention is concerned with a ketose 3-epimerase obtainable from microorganisms of the genus Arthrobacter, and having the substrate specificity described below. The ketose 3-epimerase of the present invention is characterized by the safety of the bacteria usable in food industry, low optimal pH, heat stability, and metal requirement.
(20) [Safety]
(21) The most notable feature of the present enzyme and Arthrobacter globiformis used for food industry is the safety of the bacteria. This bacterial strain is listed under Glucose Isomerase from Immobilized Arthrobacter globiformis in the FDA's EAFUS (Everything Added to Food in the United States): A Food Additive Database (US). The fact that the bacteria are directly immobilized in the method described in this database is a proof that the safety of the bacteria itself is very high indeed.
(22) In Europe, use of the bacteria is described in citrus fermentation to remove limonin and reduce bitterness in the Inventory of Microorganisms with a Documented History of Use in Food published by EFFCA (The European food & feed cultures association) and IFD (International Federation for the Roofing Trade). This is suggestive of the foregoing bacterial strain being actually used for fermentation the same as yeasts, etc., and being very safe. The Food Additive List published in Japan lists Arthrobacter as the origin for enzymes such as -amylase, isomaltodextranase, invertase, urease, glucanase, -glucosyltransferase, and fructosyltransferase, and as the producer of trehalose or vitamin K (menaquinone).
(23) It is rather surprising that no one has found an epimerase enzyme using this bacterial strain despite its long use in Japan, US, and Europe.
(24) Enzymes, which are known as D-psicose producing enzymes, are from the genus Pseudomonas, the genus Agrobacterium, and the genus Rhizobium, etc. These are not listed in any of the American and European lists. There are reports of these bacteria being opportunistic pathogens, and infecting plant cells.
(25) Many bacterial strains (60 or more strains) have been reported in fructose production from glucose with glucose isomerase, a representative glycoenzyme. However, only a handful of these bacteria, including the genus Streptomyces, the genus Bacillus, and the genus Actinoplanes, and Arthrobacter have actually been put to practical applications. Indeed, Arthrobacter represent highly safe bacterial strains used for food for many years.
(26) [Optimal pH and Metal Requirement]
(27) Other features of the present invention include the following.
(28) The optimal pH of D-psicose producing bacteria is 7 to 9 for the genus Pseudomonas, 9 to 9.5 for the genus Rhizobium, and 7 to 8 for the genus Agrobacterium. On the other hand, the optimal pH range of the enzyme produced by the present bacterial strain is 6 to 8, and D-psicose production is possible also in a less coloring pH range of 7 or less.
(29) There is a report based on 30-min enzyme activity measurement that activity increased in the presence of Mn.sup.2+ and Mg.sup.2+ in the genus Rhizobium, and in the presence of Co.sup.2+ and Mn.sup.2+ in the genus Agrobacterium. The present enzyme has been shown to increase activity in the presence of Mn.sup.2+ or Co.sup.2+. Because the activity also increases in the presence of Mg.sup.2+ and Ca.sup.2+, the present bacterial strain can be used to produce D-psicose with Mg.sup.2+ and other metal ions.
(30) [Origin and Identification of Bacterial Strain]
(31) The present inventors isolated large numbers of bacterial strains, and found an M30 strain producing a novel ketose 3-epimerase. The M30 strain has been found to belong to the genus Arthrobacter globiformis after a phyloanalysis based on 16S rRNA gene base sequence homology.
(32) Identification of Bacterial Strain
(33) (1) 16S rRNA Gene Base Sequence Homology
(34) Analysis of the 16S rRNA gene region specified 734 bases.
(35) (2) Homology Search
(36) A homology search (BLAST search; Japan DNA Databank) was conducted for the 16S rRNA gene base sequence of the bacterial strain, using known bacterial strains. The search identified the M30 strain as an Arthrobacter globiformis from the name of the bacterial strain that had 97% or greater homology against the specified 734-base sequence, and the homology (%) value.
(37) The Arthrobacter globiformis as the M30 bacterial strain having ketose 3-epimerase activity of the present invention has been deposited in the NITE Patent Microorganisms Depositary (Jun. 22, 2011; 2-5-8 Kazusa Kamatari, Kisarazu, Chiba) under the receipt number NITE AP-1111 and the accession number NITE P-1111.
(38) As used herein, ketose means a hexose with a ketose structure, specifically fructose, psicose, tagatose, and sorbose, and D- or L-ketose means D- or L-forms of such sugars.
(39) The ketose 3-epimerase of the present invention has activity to epimerize a D- or L-ketose at position 3 and produce a corresponding D- or L-ketose, and catalyzes the mutual conversion of D- or L-fructose and D- or L-psicose, and the mutual conversion of D- or L-tagatose and D- or L-sorbose. The ketose 3-epimerase of the present invention has the highest substrate specificity for D-fructose and D-psicose among D- and L-ketoses. The enzyme of the present invention can be obtained from microorganisms of the genus Arthrobacter (described later).
(40) The ketose 3-epimerase of the present invention can be prepared by culturing an Arthrobacter microorganism having a ketose 3-epimerase production capability, and collecting the ketose 3-epimerase from the bacteria grown in the culture medium. Examples of the Arthrobacter microorganism advantageous for use include an Arthrobacter globiformis M30 (accession number NITE BP-1111) strain, and mutant strains thereof. The M30 strain has a relatively high ketose 3-epimerase production capability, and is preferred for obtaining the enzyme of the present invention. The M30 strain was originally deposited at the NITE International Patent Organism Depositary (NITE P-1111; Jun. 22, 2011; 2-5-8 higashi-Kazusa Kamatari, Kisarazu, Chiba, Japan), and transferred to the international depositary under the Budapest Treaty upon filing a request (May 2, 2012). The M30 strain has been internationally deposited with the accession number NITE BP-1111.
(41) [Physical and Chemical Properties of the Present Enzyme Before Purification]
(42) The activity of the ketose 3-epimerase enzyme before purification may be measured by measuring the amount of D-psicose produced with a D-fructose substrate. Specifically, an enzyme reaction mixture composition containing 50 mM tris-HCl buffer (pH 7.0; 200 ml), 0.2 M D-fructose (375 l), enzyme liquid (100 l), and 10 mM manganese chloride (75 l) is allowed to react at 55 C. for 30 min, and the reaction is quenched by boiling the mixture for 2 min. The resulting liquid composition is then measured by HPLC. One unit of enzyme activity is defined as the amount of enzyme that epimerizes D-fructose and then produces 1 mol of D-psicose per minute under the foregoing conditions. The enzyme unit for the epimerization of D-psicose to D-fructose in the reverse reaction is defined in the same manner through measurement performed under the same conditions.
(43) The ketose 3-epimerase of the present invention may have the following physical and chemical properties.
(44) (a) optimal pH:
(45) 6.0 to 10 under 55 C., 30-min reaction conditions in the presence of 1 mM divalent cobalt ions (Co.sup.2+);
(46) (b) optimal temperature:
(47) about 50 to about 70 C. under pH 7.0, 30-min reaction conditions in the presence of 1 mM divalent cobalt ions (Co.sup.2+);
(48) (c) pH stability:
(49) stable in at least a pH range of 5.5 to 11 under 4 C., 24-hour maintained conditions;
(50) (d) heat stability:
(51) stable at about 70 C. or less under pH 7.0, 10-min maintained conditions in the presence of 1 mM divalent cobalt ions (Co.sup.2+), and stable at about 60 C. or less in the absence of 1 mM divalent cobalt ions (Co.sup.2+); and
(52) (e) metal ion activation:
(53) activatable by divalent manganese ions (Mn.sup.2+) or divalent cobalt ions (Co.sup.2+).
(54) The ketose conversion reaction is typically performed under the following conditions.
(55) Substrate concentration: 1 to 60% (w/v), desirably about 5 to 50% (w/v)
(56) Reaction temperature: 10 to 70 C., desirably about 30 to 60 C.
(57) Reaction pH: 5 to 10, desirably about 7 to 10
(58) Enzyme activity: 1 unit or more per gram of substrate, desirably selected from 50 to 5,000 units.
(59) Reaction time may be appropriately selected. However, considering economic efficiency, reaction time is typically 5 to 50 hours in the case of a batch reaction.
(60) The reaction solution obtained by the conversion contains the raw material ketose and a newly produced ketose, and may be advantageously used directly as a sweetener, a humectant, a crystallization inhibitor, a shine-imparting agent, or the like. Typically, the reaction solution is decolored with activated carbon, desalted with H-type and OH-type ion conversion resins, and concentrated to produce a syrup-like product according to an ordinary method.
(61) The newly produced ketose and the raw material ketose in the concentrate may be separated and purified, as required, by, for example, column chromatography that uses an alkali metal or alkaline earth metal strongly acidic cation exchange resin, and the fraction rich in the newly produced ketose may be concentrated to advantageously produce a syrup-like product. In the case of a crystallizable ketose, the ketose may be crystallized to advantageously obtain a crystalline product. Further, the separated raw material ketose may be advantageously reused as the raw material of another conversion reaction.
(62) The ketoses obtained as above are preferable as sweeteners, and may be advantageously used as sweeteners or palatability improvers in various orally ingested products, including food and drinks, feed, bait, toothpastes, oral pastils, sublingual tablets, and oral medicine, and so on. The ketoses may also be advantageously used, for example, as a fermentation carbon source, a reagent, or a raw material or an intermediate of chemicals and drugs.
(63) The present invention is described below in greater detail using experiments. The term ketose 3-epimerase activity used in the experiments below is the D-psicose 3-epimerase activity for the conversion of D-psicose to D-fructose as measured by the activity measurement method described above.
(64) The present invention encompasses not only the ketose 3-epimerase encoded by the base sequence represented by SEQ ID NO: 2 or SEQ ID NO: 3 of the Sequence Listing, and that epimerizes position 3 of D- or L-ketose, and produces a corresponding D- or L-ketose, but a ketose 3-epimerase encoded by the base sequence represented by SEQ ID NO: 2 or SEQ ID NO: 3 of the Sequence Listing with the deletion, substitution, or addition of one or more bases that retains the activity of the encoded enzyme, or by a complementary base sequence thereof, and that epimerizes position 3 of D- or L-ketose, and produces a corresponding D- or L-ketose.
Experiment 1: Arthrobacter globiformis M30 (Accession Number NITE BP-1111) Strain Culture
(65) A seed culture medium 1% (v/v) of the Arthrobacter globiformis M30 (accession number NITE BP-1111) strain was aseptically added to an inorganic salt medium that contained 0.2% D-psicose as a carbon source, and ammonium sulfate as a nitrogen source. The bacteria were cultured at 30 C. for 16 hours while being agitated under aerated conditions. The ketose 3-epimerase activity in the resulting culture medium was about 14 units/100 ml culture medium.
Experiment 2: Arthrobacter globiformis M30 (Accession Number NITE BP-1111) Strain Culture and Extraction of Crude Enzyme
(66) The bacteria were harvested from the culture medium by centrifugation. The harvested bacteria were washed with 1 mM tris-HCl buffer (pH 7.0). The bacteria were then suspended in 10 ml of 1 mM tris-HCl buffer (pH 7.0), and the bacterial suspension was disrupted with an ultrasonic homogenizer (SONICS & MATERIALS) while being cooled in ice-cold water. The disrupted cells were centrifuged at 12,000 rpm for 20 min, and the supernatant was obtained as crude enzyme.
Experiment 3: Dialysis of Crude Enzyme
(67) The crude enzyme was placed in a Cellulose Ester Dialysis Membrane (SPECTRUM Laboratory), and the whole membrane was immersed in a 20 mM EDTA-containing 10 mM tris-HCl buffer for 12 hours for dialysis. The membrane was washed twice with 10 mM tris-HCl (pH 7.0) buffer, and a crude enzyme liquid was removed from the membrane.
Experiment 4: Enzyme Activity Detection
(68) A reaction was allowed under the reaction conditions below. After quenching the reaction by boiling, the reaction liquid was desalted with an ion-exchange resin, and filtered to prepare an HPLC sample. The sample was analyzed by chromatography using CK08EC (Mitsubishi Chemical Corporation) in an HPLC system (Tosoh). Each product sugar was determined by calculations from the peak area values of the chromatogram.
Test Results
Experiment 5: Properties of Ketose 3-Epimerase
(69) 1. Effects of Carbon Source and Carbon Source Concentration on Activity
(70) The Arthrobacter globiformis M30 (accession number NITE BP-1111) strain was cultured in MSM media that contained 0.05 to 1% D-psicose (D-p), 1% D-fructose (D-f), 1% D-tagatose (D-t), 0.1% fructose (D-f), 0.1% D-psicose (D-p), 1% D-psicose (D-p), and 0.1% D-tagatose (D-t). The activity of each crude enzyme was then examined in the same manner as above.
(71) Because the enzyme of the present bacteria was produced in the presence of D-psicose, the enzyme was found to be an enzyme induced by D-psicose, and the activity was the highest when the D-psicose concentration was 0.2% (
(72) 2. Effects of Media on Enzyme Activity
(73) The bacteria were cultured in three different media (minimum inorganic salt (MSM) medium, TSB medium, and yeast extract (YE) medium) at 30 C. for 16 hours, and crude enzymes were obtained in the same manner as above.
(74) The enzyme activity was the highest when D-psicose was added to the minimum inorganic salt medium, which is the least expensive (
(75) 3. Effects of Metal Ions on D-PE Activity
(76) Enzyme activity was measured under the reaction conditions shown in Table 1 below, using the enzyme liquid dialyzed against EDTA-containing buffer in Experiment 3. The results are presented in
(77) The quenched activity by the dialysis against EDTA suggests that the present enzyme requires metal ions. Enzyme activity increased by addition of MnCl.sub.2 and CoCl.sub.2 in the measurement performed to examine the effect of metal ions on enzyme activity. This confirmed that the present enzyme requires Mn.sup.2+ or Co.sup.2+.
(78) TABLE-US-00001 TABLE 1 Reaction conditions 50 mM Tris-HCl buffer (pH 7.0) 200 l 0.2M D-fructose (substrate) 375 l Dialyzed crude enzyme 100 l 10 mM metal salt 75 l Reaction temperature 55 C. Reaction time 30 min
4. Effects of Temperature on D-PE Activity (Optimal Temperature)
(79) Reactions were performed at various temperatures in a 10 to 80 C. range. The reaction conditions used to find the optimal temperature are presented in Table 2. The measurement results are shown in
(80) TABLE-US-00002 TABLE 2 Reaction conditions 50 mM Tris-HCl buffer (pH 7.0) 200 l 0.2M D-fructose (substrate) 375 l Crude enzyme 100 l 10 mM CoCl.sub.2 75 l Reaction temperature 10 to 80 C. Reaction time 30 min
5. Effects of Temperature on D-PE Activity (Heat Stability)
(81) Heat stability was examined in the presence and absence of cobalt ions. A heat treatment was performed in pH 7.0, 10 to 80 C. conditions for 10 min in the presence of 1 mM cobalt ions, and the remaining activity was measured. The results are shown in
(82) 6. Effects of pH on D-PE Activity (Optimal pH)
(83) Enzyme reactions were performed at various pH values to determine the optimal reaction pH. The following buffers were used in different pH ranges. pH 3 to 6: 50 mM citrate buffer pH 6.0 to 8.0: 50 mM phosphate buffer pH 7.0 to 9.0: tris-HCl buffer pH 9.0 to 11.0: glycine-sodium hydroxide buffer
(84) Reaction conditions are presented in Table 3. The results are shown in
(85) TABLE-US-00003 TABLE 3 Reaction conditions 50 mM buffer (pH 8.0 to 11.0) 200 l 0.2M D-fructose 375 l Crude enzyme 100 l 10 mM CoCl.sub.2 75 l Reaction temperature 55 C. Reaction time 30 min
7. Effects of pH on D-PE Activity (pH Stability)
(86) The enzyme was maintained at 4 C. for 24 hours at each pH, and the remaining enzyme activity was determined after a 55 C., 30-min reaction. The results are shown in
(87) 8. D-PE Substrate Specificity
(88) Eight hexose (ketoses) were used to examine the substrate specificity of the present enzyme before purification. An enzyme reaction composition (Table 4) containing each substrate (0.2 M, 350 l) and an enzyme liquid (350 l; Tris buffer pH 7.0) was allowed to react at 55 C. for 30 min, and the ketose epimerized and produced from each sugar was analyzed by HPLC. The results are presented as relative activity for each ketose relative to the D-psicose epimerization activity which is taken as 100, as follows. Table 5 presents relative activity values for D-fructose, D-psicose, D-sorbose, D-tagatose, L-fructose, L-psicose, L-sorbose, D-tagatose, L-fructose, L-psico, and L-tagatose substrates. The activity was the highest for D-psicose, and the second highest for D-fructose. The substrate specificity can be said as characteristic of the D-psicose 3 epimerase (DPE), not other free ketose 3 epimerases, and was clearly different from the specificity of the D-tagatose3-epimerase (DTE) of Pseudomonas cichorii.
(89) TABLE-US-00004 TABLE 4 Reaction conditions Substrate (0.2M hexose, see below) 350 l Crude enzyme 350 l Temperature 55 C. Reaction time 30 min
(90) TABLE-US-00005 TABLE 5 Substrate Relative activity (%) D-fructose 58.14 D-psicose 100* D-sorbose 1.25 D-tagatose 5.42 L-fructose 12 L-psicose 12 L-sorbose 8 L-tagatose 12.5
[Enzyme Purification and Measurement of Physical and Chemical Properties]
(91) The enzyme of the present invention was further purified, and the enzyme in the further purified state was measured for physical and chemical properties.
(92) [Enzyme Activity Measurements During and after Purification, and Protein Measurement]
(93) Enzyme activity was measured by performing an enzyme reaction with the enzyme reaction mixture composition shown in Table 6. The enzyme reaction was performed at 30 C. for 30 min, and the amount of the enzyme that produced 1 micromole of D-fructose in 1 min under these conditions was taken as one unit. After the reaction, the reaction mixture was put in a boiling liquid for 3 min to quench the reaction. After deionization, the product D-fructose was measured by HPLC analysis. Protein measurement was performed by using the Bradford method, using 5 L of the enzyme liquid added to a Bradford solution (250 l) and evenly stirred therein.
(94) TABLE-US-00006 TABLE 6 Composition of enzyme reaction mixture Enzyme liquid 40 l 10 mM Tris-HCl pH 7.5 160 l 20 mM MgCl.sub.2 100 l 400 mM D-psicose 100 l
(95) The purified enzyme was found to be an epimerase of a homotetramer structure that had a subunit molecular weight of about 32 kDa as measured by SDS-PAGE, and a molecular weight of 120 kDa as measured by gel filtration.
(96) [Bacteria Culture]
(97) [Preculture]
(98) The present bacteria were precultured by being inoculated to the medium shown in Table 7. The medium (100 ml) was put in a 500-ml Erlenmeyer flask, and shake cultured at 30 C. and 200 rpm for 12 hours.
(99) TABLE-US-00007 TABLE 7 Medium composition (NH.sub.4).sub.2SO.sub.4 0.26% KH.sub.2PO.sub.4 0.24% K.sub.2HPO.sub.4 0.56% MgSO.sub.47H.sub.2O 0.01% Yeast extract 0.05% D-psicose 0.5%
[Main Culture]
(100) The preculture growth medium (100 mL) was inoculated to the main culture (10 L) shown in Table 8, and cultured at 30 C. for 24 hours under aerated (2 ml/min) and stirred (300 rpm) conditions.
(101) TABLE-US-00008 TABLE 8 Main culture (NH.sub.4).sub.2SO.sub.4 0.52% KH.sub.2PO.sub.4 0.24% K.sub.2HPO.sub.4 0.56% MgSO.sub.47H.sub.2O 0.03% Citric acid 0.2% Yeast extract 0.1% D-psicose 0.5%
[Enzyme Extraction]
(102) Viable bacteria (230 g) were obtained from the main culture (10 L). The bacteria were suspended in 1 l of a buffer (10 mM Tris-HCl pH 7.5+1 mM MgCl.sub.2), and disrupted with a high-pressure homogenizer to extract the enzyme. The disruption was conducted at 20,000 psi. The insoluble matter was removed by centrifugation (10,000 rpm, 20 min, 4 C.) to obtain a crude enzyme liquid (1,150 ml). The crude enzyme liquid (130 ml) was used for enzyme purification.
(103) [Enzyme Purification]
(104) [PEG (Polyethylene Glycol) Fractionation]
(105) PEG 6000 (26 g; concentration 20%) was added to the crude enzyme liquid (130 ml), and dissolved therein by being stirred at low temperature. The resulting precipitate and the supernatant were separated from each other by centrifugation (10,000 rpm, 20 min, 4 C.). The precipitate was dissolved in 30 mL of a buffer. Activity measurement revealed that there was no activity in the precipitate. Thereafter, PEG (26 g; final concentration 40%) was added to the supernatant, and the resulting precipitate was separated from the supernatant. Activity measurement revealed activity in the supernatant, but not in the precipitate.
(106) [PEG Removal Method]
(107) The enzyme did not precipitate, and was present in the supernatant even at 40% PEG concentration. PEG needs to be removed for the subsequent purification of the supernatant enzyme. PEG was removed by taking advantage of the non-adsorbing property of PEG against an ion-exchange resin. Specifically, the enzyme was adsorbed to anion-exchange resin, and the PEG was washed away. The adsorbed enzyme was then eluted from the resin with high-concentration NaCl. The PEG was removed in this manner.
(108) Specifically, the PEG was removed as follows.
(109) An enzyme liquid containing 40% PEG was put in a Q-Sepharose Fast Flow (58 ml) equilibrated with a buffer (10 mM Tris-HCl pH 7.5+10 mM MgCl.sub.2), and the mixture was gently stirred for 10 min to adsorb the enzyme. The resin was packed into a column (about 50 ml volume), and the enzyme was eluted with 150 ml of a buffer (1 M NaCl+10 mM Tris-HCl pH 7.5+10 mM MgCl.sub.2). The eluate was fractionated in 10-ml portions, and fractions with activity were collected. The fractions with activity were dialyzed overnight against a buffer (10 mM Tris-HCl pH 7.5+10 mM MgCl.sub.2) to remove NaCl and obtain a PEG fractionated enzyme liquid.
(110) [Purification by Ion-Exchange Chromatography]
(111) The PEG fractionated enzyme liquid was purified by ion chromatography separation. By using a Q-Sepharose High Performance column in an AKTA system, the sample was fractionated into 5-ml fractions with 35% to 60% concentration gradient of 1 M NaCl at a flow rate of 1.5 ml/min. Enzyme activity was detected in the fractions indicated by arrow in
(112) The enzyme purified by ion exchange chromatography separation was further purified by hydrophobic chromatography separation. A RESOURCE PHE column (6 ml) was used. Ammonium sulfate (2 M) was added and dissolved in the enzyme liquid. The sample was eluted into 5-mL fractions with 2 M ammonium sulfate concentration being decreased from 100% to 0% at a flow rate of 3 ml/min. Enzyme activity was detected in the eluates that appeared as large peaks of the arrow in
(113) [Purification Table]
(114) Table 9 below summarizes information concerning the enzyme purification process, including the protein amount and the enzyme activity of the crude enzyme, the PEG fractionated enzyme, the enzyme purified by ion exchange chromatography separation, and the enzyme purified by hydrophobic chromatography. The purification produced the purified enzyme at a yield of 12% with a purification factor of 31.5.
(115) TABLE-US-00009 TABLE 9 Total Protein protein Relative Total Purification Volume concentration amount activity activity Yield Purification step (ml) (g/ml) (mg) (U/mg) (U) (%) factor Crude enzyme 130 3457 450.0 2.24 1006 100 1 After PEG 48.0 1702 81.7 5.74 469 47 2.6 fractionation Q-Sepharose 14.8 259 3.84 62.1 238 24 27.7 Re-phenyl 7.4 222 1.65 70.5 116 12 31.5
[Purity of Purified Enzyme]
(116) The purity of the purified enzyme was confirmed by SDS PAGE (gel concentration 15%) using an ordinary method. In
(117) [Properties of Purified Enzyme]
(118) The properties of the purified enzyme were examined.
(119) [Optimal Reaction pH]
(120) As shown in
(121) For the optimal reaction pH measurement, a reaction was allowed at 30 C. for 30 min with various buffers of pH 4 to 11, using D-psicose as the substrate. The product D-fructose was then measured by HPLC. Table 10 shows the reaction mixture composition used. The buffers used are presented in Table 11.
(122) TABLE-US-00010 TABLE 10 Reaction mixture composition Enzyme liquid 40 l 50 mM buffer of each pH 160 l 20 mM MgCl.sub.2 100 l 400 mM D-psicose 100 l
(123) TABLE-US-00011 TABLE 11 Buffers used pH 4, 5, 6 Citrate pH 6, 7, 8 Na-phosphate pH 7.5, 8, 9 Tris-HCl pH 9, 10, 11 Glycine-NaOH
[Optimal Reaction Temperature]
(124) It was found from
(125) TABLE-US-00012 TABLE 12 Reaction mixture composition and reaction conditions Enzyme liquid 40 l 10 mM Tris-HCl pH 7.5 160 l 20 mM MgCl.sub.2 100 l 400 mM D-psicose 100 l
[pH Stability]
(126) The pH stability of the purified enzyme was examined. The purified enzyme was stable in the pH range of 5 to 11, as shown by the result represented in
(127) The measurement was made under the maintained 4 C., 24-hour conditions at each pH, and an enzyme reaction was allowed at pH 7.5. The remaining activity was measured at 30 C. for 30 min, at pH 7.5. The same buffers used for the optimal pH measurement were used.
(128) The remaining activity values at each pH shown in FIG. 13 are relative to the remaining activity with the citrate buffer at pH 6 which is taken as 100.
(129) [Heat Stability]
(130) The heat stability of the purified enzyme was examined in the presence and absence of Mg.sup.2+ ions. The heat stability greatly differed in the presence and absence of Mg.sup.2+ ions, and the Mg.sup.2+ ions increased the enzyme heat stability. The enzyme remained stable at 50 C. for 1 hour in the presence of Mg.sup.2+ ions. On the other hand, the heat stability was overall about 10 C. lower in the absence of Mg.sup.2+ ions. These results, combined with the optimal reaction temperature of 70 C., suggest that the stability of the present enzyme increases in the presence of the substrate. Specifically, the results appear to indicate high stability of the ES complex.
(131) The heat treatment was performed under the following conditions. A 300-l mixture containing a purified enzyme liquid (40 l), a buffer (10 mM Tris-HCl pH 7.5; 160 l), 4 mM MgCl.sub.2 (100 l; water when Mg.sup.2+ ions were not added) was maintained for 1 hour at each temperature, and cooled in ice-cold water for 10 min. The remaining enzyme activity was then measured according to an ordinary method.
(132) [Effects of Metal Ions]
(133) The enzyme was examined for metal ion requirement. The purified enzyme was dialyzed for 2 hours against 10 mM Tris-HCl containing 1 mM EDTA (pH 7.5). The enzyme was further dialyzed against an EDTA-free 10 mM Tris-HCl buffer (pH 7.5) for a whole day and night to obtain an EDTA treated enzyme. This enzyme was used to measure the effect of metal ions on enzyme activity, using 1 mM of various metal ions, and D-psicose as the substrate. The results are presented in Table 13, in which the activity with addition of each type of metal ions is shown as the relative value with respect to the activity of the enzyme without metal ions which is taken as 100.
(134) The activity increased 1.3-fold or greater in the presence of Mg.sup.2+, Co.sup.2+, or Mn.sup.2+ ions, and the highest activity was observed in the presence of Mg.sup.2+ ions. The result thus demonstrated that the present enzyme was activated by Mg.sup.2+ ions. Considering the large effect of Mg.sup.2+ ions on heat stability, Mg.sup.2+ ions were found to be important for the reaction of the present enzyme.
(135) TABLE-US-00013 TABLE 13 Metal ion Relative activity (%) Co.sup.2+ 130 Mn.sup.2+ 137 Mg.sup.2+ 150 Ca.sup.2+ 110 Ni.sup.2+ 87 Fe.sup.2+ 32 Zn.sup.2+ 0 Cu.sup.2+ 0 K.sup.+ 117 Na.sup.+ 120 None 100
[Substrate Specificity]
(136) The reactivity of the present enzyme was examined with respect to the all ketohexoses. The reaction mixture composition is shown in Table 14. The enzyme activity was tabulated as the relative activity with respect to the activity for D-psicose which is taken as 100. The present enzyme had activity for the all ketohexoses, and the activity was the highest for D-psicose. This clearly demonstrated that the enzyme was a D-psicose 3-epimerase. The substrate specificity is summarized in Table 15. The initial velocity was determined by allowing a reaction at 70 C. for 120 min for D-sorbose and L-fructose, and 70 C. for 20 min for the other substrates.
(137) TABLE-US-00014 TABLE 14 Reaction mixture composition Enzyme liquid 100 l Buffer 100 l 20 mM MgCl.sub.2 100 l 400 mM substrate 100 l 400 l
(138) TABLE-US-00015 TABLE 15 Substrate Relative activity (%) D-psicose 100 D-fructose 43.8 L-tagatose 44.0 L-psicose 21.2 D-tagatose 18.3 L-sorbose 16.6 D-sorbose 1.13 L-fructose 0.97
[Km and Vmax]
(139) The Km and Vmax of the present enzyme for D-psicose and D-fructose were measured. The measurement was made by measuring enzyme activity at 30 C. in the presence of Mg.sup.2+ ions. The enzyme had V.sub.max=168 U/mg and K.sub.m=30.1 mM for D-psicose, and V.sub.max=68.5 U/mg and K.sub.m=31.5 mM for D-fructose.
(140) [Enzyme Molecular Weight]
(141) [Subunit Molecular Weight]
(142) SDS-PAGE (15% gel concentration) was performed for the purified enzyme and molecular weight markers, and the distances traveled by these molecules were measured. The subunit molecular weight of the present enzyme was found to be about 32 kDa.
(143)
(144) [Enzyme Molecular Weight]
(145) The molecular weight of the present enzyme was measured by gel filtration chromatography. Specifically, the relationship between a standard protein and traveled distance was determined (
(146) A Superdex 200 pg 16/600 column was used for the molecular weight measurement by gel filtration chromatography. The running buffer composition contained 10 mM Tris-HCl (pH 7.5), NaCl (200 mM), and MgCl.sub.2 (1 mM).
(147) The following five standard proteins (markers) were used.
(148) TABLE-US-00016 (1) Ovalbumin MW: 44,000 (2) Conalbumin 75,000 (3) Aldolase 158,000 (4) Ferritin 440,000 (5) Tyroglobulin 669,000
(149) The present enzyme had an elution volume of 72.5 ml, and the molecular weight of the present enzyme was found to be about 120 kDa from calculations based on the relationship between traveled distance and molecular weight. From the subunit molecular weight of about 32 kDa found by SDS-PAGE, and the molecular weight of about 120 kDa the present enzyme found by gel filtration, the present enzyme is believed to have a homotetramer structure with a subunit molecular weight of 32 kDa.
(150) [Comparison with Other DPE and DTE]
(151) Table 16 summarizes the properties of D-tagatose 3-epimerases and D-psicose 3-epimerases reported to date. A notable feature of the enzyme produced by the present bacterial strain compared to the ketohexose 3-epimerases originating in other microorganisms is the higher optimal temperature.
(152) TABLE-US-00017 TABLE 16 Strain for enzyme source A. globiformis C. cellulolyticum A. tumefaciens P. cichorii R. sphaeroides (DPE) (DPE) (DPE) (DTE) (DTE) Molecular 120 (tetramer) 132 (tetramer) 68 (dimer) 64 (dimer) mass (kDa) Optimal 70 55 50 60 40 temperature ( C.) Optimal pH 7.5 8 8 7.5 9 Metal Mg.sup.2+ (Mn.sup.2+, Co.sup.2+) Co.sup.2+ Mn.sup.2+ Mn.sup.2+ Mn.sup.2+ required Substrate D-Psicose D-Psicose D-Psicose D-Tagatose D-Fructose with highest specificity Equilibrium 25:75 (40 C.) 32:68 (55 C.) 32:68 (30 C.) 20:80 (30 C.) 23:77 (40 C.) ratio between 30:70 (70 C.) 33:67 (40 C.) D-fructose and D-psicose
(153) The ketose 3-epimerase of the present invention undergoes an isomerization reaction that does not require coenzyme, as with the case of other epimerases and isomerases. The enzyme can thus be used by being immobilized, and high-activity immobilized enzymes can be obtained by using various immobilization techniques. A continuous and large epimerization reaction is possible with such immobilized enzymes. Because the enzyme can be immobilized in industrial scale, mass production of the target ketose is possible.
(154) [Putative Amino Acid Sequence of Purified Enzyme]
(155) The amino acid sequence of the purified enzyme was analyzed. The purified enzyme protein (about 0.1 to 0.2 g) was treated with trypsin, and the amino acid sequence of the fragment was analyzed with Ultraflxtreme MALDI-TOF MS (Bruker). The result is presented below as SEQ ID NO: 4 of the Sequence Listing.
(156) TABLE-US-00018 [SEQIDNO:4] MKILILGGTRFLGRAFVEEALQRGHEVTLFNRGTNKEIFPEVEQLIGDRN 50 GDVSSLENRKWDVVIDTCGFSPHHIRNVGEVLKDNIEHYIFISSLSVYKD 100 WIPHHIKEDYILQPEPTGDQIKAVENGEISPYEHYGALKVLCEKEAEKYW 150 PGRVLHVRAGLLSGMFDYTDRLPYWIGRVAKGGKVLVPGRKNRPVQIVDI 200 KDVANWGLNMAENNKAGIFNVTGPNYELTMAGLLNTCKKVTNSDAEFVWV 250 EESFMNEHKVQPWTEMPLWLPETISLEGETKPWKGGFSISIESAVKEGLT 300 FRRLEETVTDVYAWMKSVDEWELKAGISGEREKRLLENWYQ 341 (G: glycine, A: alanine, V: valine, L: leucine, I: isoleucine, M: methionine, F: phenylalanine, W: triptophan, Y: tyrosine, P: proline, C: cysteine, E: glutamic acid, D: aspartic acid, Q: glutamine, N: asparagine, K: lycine, R: arginine, H: histidine, S: serine, T: threonine)
Example 1
(157) The present microorganism was grown in a minimum inorganic salt medium supplemented with D-psicose as the carbon source, and the enzyme obtained from the grown bacteria was used to examine the equilibrium ratio of D-psicose and D-fructose. The reaction mixture composition used contained 50 mM Tris buffer (200 l), 0.2 M D-psicose or D-fructose, enzyme liquid (100 l), and 10 mM CoCl.sub.2 (75 l). The reaction was performed for 24 hours at a reaction temperature of 50 C. After the reaction, the D-fructose and D-psicose amounts in the reaction mixture were measured by HPLC.
(158) The same equilibrium ratio was reached irrespective of whether D-psicose or D-fructose was used as the substrate.
(159) D-psicose:D-fructose equilibrium ratio=27:73
(160) The result indicates that a reaction using D-fructose can convert 27% of the D-fructose into D-psicose. This is the clear indication that production of D-psicose from D-fructose is indeed possible.
Example 2
(161) The epimerization equilibrium between D-psicose and D-fructose was examined with the purified enzyme. The D-psicose:D-fructose ratio was 25:75 at 40 C., and 30:70 at 70 C. in the equilibrium state.
Example 3
Specifying DPE Gene Base Sequence Through Whole Genome Analysis of AgM30 Bacterial Strain
(162) The foregoing test results suggested that the DPE of the AgM30 bacterial strain are completely different from known DPEs, and cannot be isolated with PCR amplification techniques or existing protein database. To investigate, the whole genome sequence of the AgM30 bacterial strain was determined, and a protein database was constructed therefrom. Genomic DNA was isolated and purified from the AgM30 bacterial strain with the DNeasy Blood & Tissue kit (Qiagen), and 19.58 g of the genomic DNA was sent to the Takara Bio's Dragon Genomics Center for high speed sequence analysis. As a result, 22 contigs of 4 kb or more were obtained in a total of 513569410 bp analyzed. The 22 contigs, with the length of about 5.1 Mb, were considered to be sufficient to cover the whole genome sequence of the Arthrobacter globiformis M30.
(163) [Construction of AgM30 Bacterial Strain Protein Database]
(164) 4798 putative ORFs were found in the about 5.1 Mb gene sequence by using a GeneMark S program, and the amino acid sequence of each ORF was estimated. These 4798 amino acid sequences were used as an AgM30 bacterial strain protein database.
(165) [Reidentification of Protein with AgM30 Bacterial Strain DPE Activity]
(166) The protein database was submitted to the protein identification system MASCOT server (Matrix Science), and a protein that showed DPE activity was reidentified. The protein had 52% similarity in the underlined portions of the amino acid sequences in the following SEQ ID NO: 1 of the Sequence Listing. This result strongly suggested that the protein was the DPE of the AgM30 bacterial strain.
(167) TABLE-US-00019 [SEQIDNO:1] 1 MKIGCHGLVWTGHFDAEGIRYSVQKTREAGFDLVEFPLMDPFSFDVQTAK 51 SALAEHGLAASASLGLSDATDVSSEDPAVVKAGEELLNRAVDVLAELGAT 101 DFCGVIYSAMKKYMEPATAAGLANSKAAVGRVADRASDLGINVSLEVVNR 151 YETNVLNTGRQALAYLEELNRPNLGIHLDTYHMNIEESDMFSPILDTAEA 201 LRYVHIGESHRGYLGTGSVDFDTFFKALGRIGYDGPVVFESFSSSVVAPD 251 LSRMLGIWRNLWADNEELGAHANAFIRDKLTAIKTIELH
Sequence 2SEQ ID NO: 1: An amino acid sequence identified from the protein database of AgM30 bacterial strain. The underlined amino acid sequences matched the peaks obtained by MALDI-TOF MS.
[Isolation of DPE Gene from AgM30 Bacterial Strain]
(168) Genomic gene information was acquired from the amino acid sequence, and amplification PCR primers (Ag1DPE_F: 5-ATGAAAATTGGTTGCCATG-3, and Ag1DPE_R: 5-TTAGTGCAGTTCGATGGT-3) were designed. The DPE gene was then amplified from the genome of the AgM30 bacterial strain. A sequence analysis of the PCR product found two gene base sequences: a gene sequence of 870 bp represented by the sequence 11 (SEQ ID NO: 2 of the Sequence Listing) below, and a gene sequence represented by sequence 12 (SEQ ID NO: 3 of the Sequence Listing) with a thymine (T) replacing the cytosine (C) at base 15 of sequence 11 (underlined).
(169) [Sequence 3 (SEQ ID NO:) 2 of the Sequence Listing)]
(170) TABLE-US-00020 ATGAAAATTGGTTGCCATGGCCTGGTTTGGACCGGCCACTTCGACGCTG AAGGCATTCGCTACTCCGTCCAGAAAACCAGGGAAGCCGGTTTCGACCT CGTTGAGTTCCCGCTCATGGATCCGTTCTCCTTCGATGTGCAGACGGCC AAGTCCGCACTGGCCGAACATGGGCTGGCGGCCTCGGCATCTCTGGGAC TCTCGGACGCCACTGACGTAAGCAGCGAAGATCCCGCCGTCGTGAAGGC AGGGGAGGAGCTGCTCAACCGCGCCGTGGATGTTCTGGCCGAACTGGGT GCGACGGATTTCTGCGGCGTGATTTATAGCGCCATGAAGAAGTACATGG AGCCGGCAACTGCTGCCGGGCTGGCCAACAGCAAGGCAGCCGTCGGGCG GGTCGCGGACCGGGCATCGGATCTGGGGATCAATGTTTCGCTGGAGGTC GTCAACAGGTACGAAACCAACGTACTGAACACCGGACGTCAGGCCCTTG CCTACTTGGAGGAGCTCAACCGGCCGAACCTGGGCATCCACCTGGACAC TTACCACATGAACATTGAGGAATCGGACATGTTCTCCCCGATCCTGGAC ACCGCGGAGGCCCTGCGGTACGTCCATATCGGCGAAAGCCACCGCGGCT ACCTCGGCACGGGAAGCGTTGACTTCGACACTTTCTTCAAGGCCCTCGG CCGCATCGGCTATGACGGACCCGTTGTCTTCGAATCGTTCTCCTCCTCC GTCGTGGCACCGGATCTGAGCCGGATGCTCGGCATCTGGCGCAACCTGT GGGCCGACAACGAGGAACTGGGTGCGCACGCGAATGCCTTCATCCGCGA CAAGCTCACCGCGATCAAGACCATCGAACTGCACTAA
Sequence 3 (SEQ ID NO: 2 of the Sequence Listing): a DPE gene sequence amplified from the genomic DNA of AgM30 bacterial strain.
[Sequence 4 (SEQ ID NO: 3 of the Sequence Listing)]
(171) TABLE-US-00021 ATGAAAATTGGTTGTCATGGCCTGGTTTGGACCGGCCACTTCGACGCTG AAGGCATTCGCTACTCCGTCCAGAAAACCAGGGAAGCCGGTTTCGACCT CGTTGAGTTCCCGCTCATGGATCCGTTCTCCTTCGATGTGCAGACGGCC AAGTCCGCACTGGCCGAACATGGGCTGGCGGCCTCGGCATCTCTGGGAC TCTCGGACGCCACTGACGTAAGCAGCGAAGATCCCGCCGTCGTGAAGGC AGGGGAGGAGCTGCTCAACCGCGCCGTGGATGTTCTGGCCGAACTGGGT GCGACGGATTTCTGCGGCGTGATTTATAGCGCCATGAAGAAGTACATGG AGCCGGCAACTGCTGCCGGGCTGGCCAACAGCAAGGCAGCCGTCGGGCG GGTCGCGGACCGGGCATCGGATCTGGGGATCAATGTTTCGCTGGAGGTC GTCAACAGGTACGAAACCAACGTACTGAACACCGGACGTCAGGCCCTTG CCTACTTGGAGGAGCTCAACCGGCCGAACCTGGGCATCCACCTGGACAC TTACCACATGAACATTGAGGAATCGGACATGTTCTCCCCGATCCTGGAC ACCGCGGAGGCCCTGCGGTACGTCCATATCGGCGAAAGCCACCGCGGCT ACCTCGGCACGGGAAGCGTTGACTTCGACACTTTCTTCAAGGCCCTCGG CCGCATCGGCTATGACGGACCCGTTGTCTTCGAATCGTTCTCCTCCTCC GTCGTGGCACCGGATCTGAGCCGGATGCTCGGCATCTGGCGCAACCTGT GGGCCGACAACGAGGAACTGGGTGCGCACGCGAATGCCTTCATCCGCGA CAAGCTCACCGCGATCAAGACCATCGAACTGCACTAA
Sequence 4: (SEQ ID NO: 3 of Sequence Listing): a DPE gene sequence amplified from the genomic DNA of AgM30 bacterial strain. The cytosine (C) at base 15 of sequence 11 is replaced with a thymine (T) (underlined).
[Analysis of DPE Gene Product by Escherichia coli Expression System]
(172) An Escherichia coli expression system was constructed by using sequence 11 (SEQ ID NO: 2 of the Sequence Listing). The DPE gene of AgM30 bacterial strain origin was incorporated into a pET vector (Clontech), which was then used to transform Escherichia coli for expression. As a result, an inducible protein was confirmed in a soluble fraction, as shown in
(173) In order to improve activity in an Escherichia coli expression system, the DPE gene of AgM30 bacterial strain origin was incorporated into a pRSET vector (Invitrogen) and a pCold vector (Takara Bio) to create Escherichia coli transformants. The measured DPE activity per milliliter of culture was about the same as that of the wild type in the pRSET vector system, and was about 10 times greater than that of the wild type in the pCold vector system.
(174) [Analysis of DPE Gene Product with Bacillus subtilis Expression System]
(175) Analysis was performed by constructing a Bacillus subtilis system, which reportedly produces a higher yield of genetically recombinant protein than Escherichia coli systems. The DPE gene of AgM30 bacterial strain origin was incorporated into a pHT01 vector (MoBiTec) designed for transformation of the host Bacillus subtilis, and the vector was introduced to transform the host after sequence analysis. As a result, large numbers of transformants with the acquired antibiotic resistance were obtained. However, DPE gene production was not observed in a DPE gene induction experiment, and the activity was undetectable.
(176) [Mass Production of DPE Gene Product with Escherichia coli Expression System]
(177) Given the result that mass production of DPE gene products was not possible with the Bacillus subtilis system, an experiment was conducted to mass produce DPE gene products of AgM30 bacterial strain origin by using the Escherichia coli system. The vector systems formerly used add a His-tag at the N terminus, or a solubilization tag to facilitate easy purification of recombinant protein. Considering that these tags might affect the yield and the enzyme activity of the recombinant protein, a pQE vector (Qiagen) system was used that does not add tags to the recombinant protein. The DPE gene of AgM30 bacterial strain origin was incorporated into a pQE60 vector (Qiagen), and the host Escherichia coli M15 [pREP4] (Qiagen) was transformed. The expression product was then analyzed by SDS-PAGE (gel concentration 12%) electrophoresis. As shown in
INDUSTRIAL APPLICABILITY
(178) The ketose 3-epimerase of the present invention acts on a free D- or L-ketose, or D- or L-ketopentose, and epimerizes these ketoses at position 3 to easily produce a corresponding D- or L-ketose, or D- or L-ketopentose. This reaction paves the way for the D-psicose mass production that uses various ketoses, particularly D-fructose as raw material. Further, the ketose 3-epimerase of the present invention can be used to obtain high-activity immobilized enzymes with the use of various immobilization techniques, and such immobilized enzymes can be used to perform a continuous and large epimerization reaction. Because the enzyme can be immobilized in industrial scale, mass production of the target ketose is possible.
(179) The establishment of the ketose 3-epimerase of the present invention, and the method of production thereof is industrially highly significant not only in sugar production but in a variety of related fields, such as in production of food, cosmetics, and drugs.
(180) The most notable advantage of using the present enzyme-producing Arthrobacter globiformis in food industry is the safety of the bacteria. The fact that this bacterial strain is listed in the FDA's EAFUS in the US is a proof that the safety of the bacteria itself is very high indeed. Enzymes produced by the genus Pseudomonas, the genus Agrobacterium, and the genus Rhizobium are examples of known D-psicose producing enzymes. These are not contained in any of the American and European lists, and there are reports of these bacteria being opportunistic pathogens, and infecting plant cells. It has thus been indeed very laborious to check the safety of these microorganisms. Being able to use bacteria that are very safe by themselves as in the present invention is a large technological improvement.